Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SH3-containing GRB2-like protein 3-interacting protein 1

Gene

Sgip1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May function in clathrin-mediated endocytosis. Has both a membrane binding/tubulating activity and the ability to recruit proteins essential to the formation of functional clathrin-coated pits. Has a preference for membranes enriched in phosphatidylserine and phosphoinositides and is required for the endocytosis of the transferrin receptor. May also bind tubulin. May play a role in the regulation of energy homeostasis.2 Publications

GO - Molecular functioni

  • microtubule binding Source: UniProtKB
  • phospholipid binding Source: UniProtKB
  • SH3 domain binding Source: MGI
  • tubulin binding Source: UniProtKB

GO - Biological processi

  • endocytosis Source: UniProtKB-KW
  • membrane tubulation Source: MGI
  • positive regulation of energy homeostasis Source: UniProtKB
  • positive regulation of feeding behavior Source: UniProtKB
  • positive regulation of receptor-mediated endocytosis Source: UniProtKB
  • response to dietary excess Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Endocytosis

Enzyme and pathway databases

ReactomeiR-MMU-8856825. Cargo recognition for clathrin-mediated endocytosis.
R-MMU-8856828. Clathrin-mediated endocytosis.

Names & Taxonomyi

Protein namesi
Recommended name:
SH3-containing GRB2-like protein 3-interacting protein 1
Alternative name(s):
Endophilin-3-interacting protein
Gene namesi
Name:Sgip1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:1920344. Sgip1.

Subcellular locationi

GO - Cellular componenti

  • AP-2 adaptor complex Source: UniProtKB
  • clathrin-coated pit Source: MGI
  • clathrin-coated vesicle Source: UniProtKB
  • cytoplasm Source: UniProtKB
  • plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Coated pit, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002483961 – 806SH3-containing GRB2-like protein 3-interacting protein 1Add BLAST806

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei78PhosphoserineCombined sources1
Modified residuei104PhosphoserineBy similarity1
Modified residuei105PhosphoserineBy similarity1
Modified residuei107PhosphoserineBy similarity1
Modified residuei149PhosphoserineCombined sources1
Modified residuei151PhosphoserineCombined sources1
Modified residuei156PhosphoserineCombined sources1
Modified residuei169PhosphoserineBy similarity1
Modified residuei180PhosphothreonineCombined sources1
Modified residuei182PhosphothreonineCombined sources1
Modified residuei236PhosphoserineBy similarity1
Modified residuei247PhosphothreonineCombined sources1
Modified residuei259PhosphothreonineCombined sources1
Modified residuei265PhosphoserineCombined sources1
Modified residuei287PhosphoserineCombined sources1
Modified residuei289PhosphoserineCombined sources1
Modified residuei300PhosphoserineCombined sources1
Modified residuei316PhosphoserineCombined sources1
Modified residuei319PhosphoserineCombined sources1
Modified residuei324PhosphothreonineCombined sources1
Modified residuei328PhosphothreonineCombined sources1
Modified residuei335PhosphothreonineBy similarity1
Modified residuei371PhosphoserineCombined sources1
Modified residuei398PhosphoserineCombined sources1
Modified residuei409PhosphothreonineCombined sources1
Modified residuei484PhosphoserineCombined sources1
Isoform 2 (identifier: Q8VD37-2)
Modified residuei243PhosphoserineCombined sources1
Isoform 3 (identifier: Q8VD37-3)
Modified residuei274PhosphoserineCombined sources1
Modified residuei338PhosphoserineCombined sources1
Isoform 4 (identifier: Q8VD37-4)
Modified residuei274PhosphoserineCombined sources1
Isoform 7 (identifier: Q8VD37-8)
Modified residuei505PhosphoserineCombined sources1
Isoform 6 (identifier: Q8VD37-6)
Modified residuei533PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8VD37.
PeptideAtlasiQ8VD37.
PRIDEiQ8VD37.

PTM databases

iPTMnetiQ8VD37.
PhosphoSitePlusiQ8VD37.

Expressioni

Tissue specificityi

Detected in brain, spinal cord and cerebellum.1 Publication

Inductioni

Up-regulated in the hypothalamus of obese mice.1 Publication

Gene expression databases

BgeeiENSMUSG00000028524.
ExpressionAtlasiQ8VD37. baseline and differential.
GenevisibleiQ8VD37. MM.

Interactioni

Subunit structurei

Interacts with proteins essential or regulating the formation of functional clathrin-coated pits (By similarity). Interacts with CANX. Interacts with AP2A1. Interacts with EPS15. Interacts with SH3GL3 (By similarity). Interacts with AMPH (By similarity). Interacts with ITSN1 (via SH3 domains) (By similarity). Interacts with and REPS1 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
A7BFV94EBI-776269,EBI-6095043From a different organism.
CanxP355643EBI-776269,EBI-738422

GO - Molecular functioni

  • microtubule binding Source: UniProtKB
  • SH3 domain binding Source: MGI
  • tubulin binding Source: UniProtKB

Protein-protein interaction databases

IntActiQ8VD37. 7 interactors.
MINTiMINT-4119735.
STRINGi10090.ENSMUSP00000079553.

Structurei

3D structure databases

ProteinModelPortaliQ8VD37.
SMRiQ8VD37.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini537 – 805MHDPROSITE-ProRule annotationAdd BLAST269

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni627 – 806Necessary and sufficient to mediate interaction with CANX1 PublicationAdd BLAST180

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi106 – 112Poly-Glu7
Compositional biasi229 – 497Pro-richAdd BLAST269

Sequence similaritiesi

Contains 1 MHD (mu homology) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG2398. Eukaryota.
ENOG410XTCY. LUCA.
GeneTreeiENSGT00510000046419.
HOGENOMiHOG000231544.
HOVERGENiHBG081524.
InParanoidiQ8VD37.
KOiK20065.
OMAiIDWDRYN.
OrthoDBiEOG091G0AB1.
TreeFamiTF328986.

Family and domain databases

InterProiIPR028565. MHD.
IPR018808. Muniscin_C.
[Graphical view]
PfamiPF10291. muHD. 1 hit.
[Graphical view]
SUPFAMiSSF49447. SSF49447. 1 hit.
PROSITEiPS51072. MHD. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8VD37-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMEGLKKRTR KAFGIRKKEK DTDSTGSPDR DGMQPSPHEP PYHSKAECAR
60 70 80 90 100
EGGKKASKKS NGAPNGFYAE IDWERYNSPE LDEEGYSIRP EEPGSTKGKH
110 120 130 140 150
FYSSSESEEE EESHKKFNIK IKPLQSKDVL KNAATVDELK ASIGNIALSP
160 170 180 190 200
SPVRKSPRRS PGAIKRNLSS EEVARPRRST PTPELTSKKP LDDTLALAPL
210 220 230 240 250
FGPPLESAFD EQKTEVLLDQ PEIWGSGQPM NPSTESPELA RPFPTGTPPP
260 270 280 290 300
LPPKTVPATP PRTGSPLTVA TGNDQAATEA KIEKLPSISD LDSIFGPVLS
310 320 330 340 350
PKSVAVNTEE KWVHFSDASP EHVTPELTPR EQVVTPPAAS DIPADSPAPA
360 370 380 390 400
PPGPTGSAGP PGPPGPRHVP SPLNLEEVQK KVAEQTFIKD DYLETLSSPK
410 420 430 440 450
ECGLGQRATP PPPPPPTYRT VVSSPGPGSG SGTGTTSGAS SPARPATPLV
460 470 480 490 500
PCSTTPPPPP PRPPSRPKLP PGKPGVGDVS RPFSPPIHSS SPPPIAPLAR
510 520 530 540 550
AESTSSISST NSLSAATTPT VGSSRGPSPL TMGAQDTLPV AAAFTETVNA
560 570 580 590 600
YFKGADPSKC IVKITGEMVL SFPAGITRHF ANNPSPAALT FRVVNSSRLE
610 620 630 640 650
HVLPNPQLLC CDNTQNDANT KEFWVNMPNL MTHLKKVSEQ KPQATYYNVD
660 670 680 690 700
MLKYQVSAQG IQSTPLNLAV NWRCEPASTD LRIDYKYNTD AMSTAVALNN
710 720 730 740 750
VQFLVPIDGG VTKLQAVLPP AVWNAEQQRI LWKIPDISQK SENGGVGSLL
760 770 780 790 800
ARFQLSEGPS KPSPLVVQFT SEGSTLSGCD IELVGAGYRF SLIKKRFAAG

KYLADN
Length:806
Mass (Da):86,063
Last modified:March 1, 2002 - v1
Checksum:i4909A6D1DACCC775
GO
Isoform 2 (identifier: Q8VD37-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     35-58: Missing.
     154-161: Missing.
     272-437: Missing.

Show »
Length:608
Mass (Da):65,462
Checksum:i01294472E1F814D2
GO
Isoform 3 (identifier: Q8VD37-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     34-34: Missing.
     272-437: Missing.
     521-521: V → VENEQPSLVWFDRGKFYLTFE

Note: No experimental confirmation available.Combined sources
Show »
Length:659
Mass (Da):71,361
Checksum:i4A2F2788CF03E9F7
GO
Isoform 4 (identifier: Q8VD37-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     34-34: Missing.
     272-437: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:639
Mass (Da):68,873
Checksum:i8EB81B8C8E8331B3
GO
Isoform 5 (identifier: Q8VD37-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-188: RKSPRRSPGAIKRNLSSEEVARPRRSTPTPELTSK → VKKLQDPGVPPQLQNLQARSLWMTLWPLLPSLVHH
     189-806: Missing.

Show »
Length:188
Mass (Da):21,052
Checksum:i869202C079926C05
GO
Isoform 6 (identifier: Q8VD37-6) [UniParc]FASTAAdd to basket
Also known as: SGIP1alpha

The sequence of this isoform differs from the canonical sequence as follows:
     33-33: M → MQGKKKAQKTQLLLTSCFWLRALSLTLSQ
     521-521: V → VENEQPSLVWFDRGKFYLTFE

Note: The N-terminal domain (1-97) of this isoform mediates binding to and tubulation of membranes.Combined sources
Show »
Length:854
Mass (Da):91,725
Checksum:i9FB1695AA4A47D8D
GO
Isoform 7 (identifier: Q8VD37-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     521-521: V → VENEQPSLVWFDRGKFYLTFE

Show »
Length:826
Mass (Da):88,551
Checksum:i706459A1A5A74CB5
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti100H → Q in BAC27870 (PubMed:16141072).Curated1
Sequence conflicti250P → H in BAE28466 (PubMed:16141072).Curated1
Sequence conflicti355T → P in BAF74784 (PubMed:17626015).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04398733M → MQGKKKAQKTQLLLTSCFWL RALSLTLSQ in isoform 6. 1 Publication1
Alternative sequenceiVSP_02027934Missing in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_02028035 – 58Missing in isoform 2. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_020281154 – 188RKSPR…ELTSK → VKKLQDPGVPPQLQNLQARS LWMTLWPLLPSLVHH in isoform 5. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_020282154 – 161Missing in isoform 2. 1 Publication8
Alternative sequenceiVSP_020283189 – 806Missing in isoform 5. 1 PublicationAdd BLAST618
Alternative sequenceiVSP_020284272 – 437Missing in isoform 2, isoform 3 and isoform 4. 1 PublicationAdd BLAST166
Alternative sequenceiVSP_020285521V → VENEQPSLVWFDRGKFYLTF E in isoform 3, isoform 6 and isoform 7. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB262964 mRNA. Translation: BAF74784.1.
AK014022 mRNA. Translation: BAB29118.1.
AK032439 mRNA. Translation: BAC27870.1.
AK043018 mRNA. Translation: BAC31435.1.
AK148043 mRNA. Translation: BAE28309.1.
AK148302 mRNA. Translation: BAE28466.1.
BC017596 mRNA. Translation: AAH17596.1.
CCDSiCCDS18404.1. [Q8VD37-1]
CCDS71429.1. [Q8VD37-3]
CCDS71430.1. [Q8VD37-4]
RefSeqiNP_001272788.1. NM_001285859.1. [Q8VD37-3]
NP_001272789.1. NM_001285860.1. [Q8VD37-4]
NP_001272791.1. NM_001285862.1.
NP_659155.1. NM_144906.2. [Q8VD37-1]
XP_006503491.1. XM_006503428.3. [Q8VD37-8]
XP_017175890.1. XM_017320401.1. [Q8VD37-1]
UniGeneiMm.238094.
Mm.446273.
Mm.54201.

Genome annotation databases

EnsembliENSMUST00000066824; ENSMUSP00000063712; ENSMUSG00000028524. [Q8VD37-3]
ENSMUST00000072481; ENSMUSP00000072301; ENSMUSG00000028524. [Q8VD37-4]
ENSMUST00000080728; ENSMUSP00000079553; ENSMUSG00000028524. [Q8VD37-1]
ENSMUST00000106882; ENSMUSP00000102495; ENSMUSG00000028524. [Q8VD37-8]
ENSMUST00000183855; ENSMUSP00000139337; ENSMUSG00000028524. [Q8VD37-5]
GeneIDi73094.
KEGGimmu:73094.
UCSCiuc008two.2. mouse. [Q8VD37-1]
uc008twq.2. mouse. [Q8VD37-6]
uc008twr.2. mouse. [Q8VD37-3]
uc008tws.2. mouse. [Q8VD37-4]
uc008twt.2. mouse. [Q8VD37-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB262964 mRNA. Translation: BAF74784.1.
AK014022 mRNA. Translation: BAB29118.1.
AK032439 mRNA. Translation: BAC27870.1.
AK043018 mRNA. Translation: BAC31435.1.
AK148043 mRNA. Translation: BAE28309.1.
AK148302 mRNA. Translation: BAE28466.1.
BC017596 mRNA. Translation: AAH17596.1.
CCDSiCCDS18404.1. [Q8VD37-1]
CCDS71429.1. [Q8VD37-3]
CCDS71430.1. [Q8VD37-4]
RefSeqiNP_001272788.1. NM_001285859.1. [Q8VD37-3]
NP_001272789.1. NM_001285860.1. [Q8VD37-4]
NP_001272791.1. NM_001285862.1.
NP_659155.1. NM_144906.2. [Q8VD37-1]
XP_006503491.1. XM_006503428.3. [Q8VD37-8]
XP_017175890.1. XM_017320401.1. [Q8VD37-1]
UniGeneiMm.238094.
Mm.446273.
Mm.54201.

3D structure databases

ProteinModelPortaliQ8VD37.
SMRiQ8VD37.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8VD37. 7 interactors.
MINTiMINT-4119735.
STRINGi10090.ENSMUSP00000079553.

PTM databases

iPTMnetiQ8VD37.
PhosphoSitePlusiQ8VD37.

Proteomic databases

PaxDbiQ8VD37.
PeptideAtlasiQ8VD37.
PRIDEiQ8VD37.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000066824; ENSMUSP00000063712; ENSMUSG00000028524. [Q8VD37-3]
ENSMUST00000072481; ENSMUSP00000072301; ENSMUSG00000028524. [Q8VD37-4]
ENSMUST00000080728; ENSMUSP00000079553; ENSMUSG00000028524. [Q8VD37-1]
ENSMUST00000106882; ENSMUSP00000102495; ENSMUSG00000028524. [Q8VD37-8]
ENSMUST00000183855; ENSMUSP00000139337; ENSMUSG00000028524. [Q8VD37-5]
GeneIDi73094.
KEGGimmu:73094.
UCSCiuc008two.2. mouse. [Q8VD37-1]
uc008twq.2. mouse. [Q8VD37-6]
uc008twr.2. mouse. [Q8VD37-3]
uc008tws.2. mouse. [Q8VD37-4]
uc008twt.2. mouse. [Q8VD37-2]

Organism-specific databases

CTDi84251.
MGIiMGI:1920344. Sgip1.

Phylogenomic databases

eggNOGiKOG2398. Eukaryota.
ENOG410XTCY. LUCA.
GeneTreeiENSGT00510000046419.
HOGENOMiHOG000231544.
HOVERGENiHBG081524.
InParanoidiQ8VD37.
KOiK20065.
OMAiIDWDRYN.
OrthoDBiEOG091G0AB1.
TreeFamiTF328986.

Enzyme and pathway databases

ReactomeiR-MMU-8856825. Cargo recognition for clathrin-mediated endocytosis.
R-MMU-8856828. Clathrin-mediated endocytosis.

Miscellaneous databases

PROiQ8VD37.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000028524.
ExpressionAtlasiQ8VD37. baseline and differential.
GenevisibleiQ8VD37. MM.

Family and domain databases

InterProiIPR028565. MHD.
IPR018808. Muniscin_C.
[Graphical view]
PfamiPF10291. muHD. 1 hit.
[Graphical view]
SUPFAMiSSF49447. SSF49447. 1 hit.
PROSITEiPS51072. MHD. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSGIP1_MOUSE
AccessioniPrimary (citable) accession number: Q8VD37
Secondary accession number(s): A7BFW0
, Q3UFU3, Q3UGA0, Q8BXX4, Q8C034, Q9CXT2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: March 1, 2002
Last modified: November 2, 2016
This is version 106 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.