Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SH3-containing GRB2-like protein 3-interacting protein 1

Gene

Sgip1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May function in clathrin-mediated endocytosis. Has both a membrane binding/tubulating activity and the ability to recruit proteins essential to the formation of functional clathrin-coated pits. Has a preference for membranes enriched in phosphatidylserine and phosphoinositides and is required for the endocytosis of the transferrin receptor. May also bind tubulin. May play a role in the regulation of energy homeostasis.2 Publications

GO - Molecular functioni

  • microtubule binding Source: UniProtKB
  • phospholipid binding Source: UniProtKB
  • SH3 domain binding Source: MGI
  • tubulin binding Source: UniProtKB

GO - Biological processi

  • clathrin-dependent endocytosis Source: InterPro
  • energy homeostasis Source: UniProtKB
  • plasma membrane tubulation Source: MGI
  • positive regulation of feeding behavior Source: UniProtKB
  • positive regulation of receptor-mediated endocytosis Source: UniProtKB
  • response to dietary excess Source: UniProtKB

Keywordsi

Biological processEndocytosis

Enzyme and pathway databases

ReactomeiR-MMU-8856825 Cargo recognition for clathrin-mediated endocytosis
R-MMU-8856828 Clathrin-mediated endocytosis

Names & Taxonomyi

Protein namesi
Recommended name:
SH3-containing GRB2-like protein 3-interacting protein 1
Alternative name(s):
Endophilin-3-interacting protein
Gene namesi
Name:Sgip1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:1920344 Sgip1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Coated pit, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002483961 – 806SH3-containing GRB2-like protein 3-interacting protein 1Add BLAST806

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei78PhosphoserineCombined sources1
Modified residuei104PhosphoserineBy similarity1
Modified residuei105PhosphoserineBy similarity1
Modified residuei107PhosphoserineBy similarity1
Modified residuei149PhosphoserineCombined sources1
Modified residuei151PhosphoserineCombined sources1
Modified residuei156PhosphoserineCombined sources1
Modified residuei169PhosphoserineBy similarity1
Modified residuei180PhosphothreonineCombined sources1
Modified residuei182PhosphothreonineCombined sources1
Modified residuei236PhosphoserineBy similarity1
Modified residuei247PhosphothreonineCombined sources1
Modified residuei259PhosphothreonineCombined sources1
Modified residuei265PhosphoserineCombined sources1
Modified residuei287PhosphoserineCombined sources1
Modified residuei289PhosphoserineCombined sources1
Modified residuei300PhosphoserineCombined sources1
Modified residuei316PhosphoserineCombined sources1
Modified residuei319PhosphoserineCombined sources1
Modified residuei324PhosphothreonineCombined sources1
Modified residuei328PhosphothreonineCombined sources1
Modified residuei335PhosphothreonineBy similarity1
Modified residuei371PhosphoserineCombined sources1
Modified residuei398PhosphoserineCombined sources1
Modified residuei409PhosphothreonineCombined sources1
Modified residuei484PhosphoserineCombined sources1
Isoform 2 (identifier: Q8VD37-2)
Modified residuei243PhosphoserineCombined sources1
Isoform 3 (identifier: Q8VD37-3)
Modified residuei274PhosphoserineCombined sources1
Modified residuei338PhosphoserineCombined sources1
Isoform 4 (identifier: Q8VD37-4)
Modified residuei274PhosphoserineCombined sources1
Isoform 7 (identifier: Q8VD37-8)
Modified residuei505PhosphoserineCombined sources1
Isoform 6 (identifier: Q8VD37-6)
Modified residuei533PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8VD37
PeptideAtlasiQ8VD37
PRIDEiQ8VD37

PTM databases

iPTMnetiQ8VD37
PhosphoSitePlusiQ8VD37

Expressioni

Tissue specificityi

Detected in brain, spinal cord and cerebellum.1 Publication

Inductioni

Up-regulated in the hypothalamus of obese mice.1 Publication

Gene expression databases

BgeeiENSMUSG00000028524
ExpressionAtlasiQ8VD37 baseline and differential
GenevisibleiQ8VD37 MM

Interactioni

Subunit structurei

Interacts with proteins essential or regulating the formation of functional clathrin-coated pits (Probable). Interacts with CANX (PubMed:17626015, PubMed:21747946). Interacts with AP2A1 (PubMed:17626015). Interacts with EPS15 (PubMed:17626015). Interacts with SH3GL3 (By similarity). Interacts with AMPH (By similarity). Interacts with ITSN1 (via SH3 domains) (By similarity). Interacts with and REPS1 (By similarity).By similarityCurated2 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

  • microtubule binding Source: UniProtKB
  • SH3 domain binding Source: MGI
  • tubulin binding Source: UniProtKB

Protein-protein interaction databases

BioGridi215766, 2 interactors
IntActiQ8VD37, 9 interactors
MINTiQ8VD37
STRINGi10090.ENSMUSP00000079553

Structurei

3D structure databases

ProteinModelPortaliQ8VD37
SMRiQ8VD37
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini537 – 805MHDPROSITE-ProRule annotationAdd BLAST269

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni539 – 545Interaction with DPF motifs-containing proteinsBy similarity7
Regioni571 – 573Interaction with DPF motifs-containing proteinsBy similarity3
Regioni627 – 806Necessary and sufficient to mediate interaction with CANX1 PublicationAdd BLAST180
Regioni645 – 648Interaction with DPF motifs-containing proteinsBy similarity4
Regioni791 – 796Interaction with DPF motifs-containing proteinsBy similarity6

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi106 – 112Poly-GluSequence analysis7
Compositional biasi229 – 497Pro-richPROSITE-ProRule annotationAdd BLAST269

Phylogenomic databases

eggNOGiKOG2398 Eukaryota
ENOG410XTCY LUCA
GeneTreeiENSGT00510000046419
HOGENOMiHOG000231544
HOVERGENiHBG081524
InParanoidiQ8VD37
KOiK20065
OMAiQPEIWGS
OrthoDBiEOG091G0AB1
TreeFamiTF328986

Family and domain databases

CDDicd09266 SGIP1_MHD, 1 hit
InterProiView protein in InterPro
IPR036168 AP2_Mu_C_sf
IPR028565 MHD
IPR018808 Muniscin_C
IPR037984 SGIP1_MHD
PfamiView protein in Pfam
PF10291 muHD, 1 hit
SUPFAMiSSF49447 SSF49447, 1 hit
PROSITEiView protein in PROSITE
PS51072 MHD, 1 hit

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8VD37-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMEGLKKRTR KAFGIRKKEK DTDSTGSPDR DGMQPSPHEP PYHSKAECAR
60 70 80 90 100
EGGKKASKKS NGAPNGFYAE IDWERYNSPE LDEEGYSIRP EEPGSTKGKH
110 120 130 140 150
FYSSSESEEE EESHKKFNIK IKPLQSKDVL KNAATVDELK ASIGNIALSP
160 170 180 190 200
SPVRKSPRRS PGAIKRNLSS EEVARPRRST PTPELTSKKP LDDTLALAPL
210 220 230 240 250
FGPPLESAFD EQKTEVLLDQ PEIWGSGQPM NPSTESPELA RPFPTGTPPP
260 270 280 290 300
LPPKTVPATP PRTGSPLTVA TGNDQAATEA KIEKLPSISD LDSIFGPVLS
310 320 330 340 350
PKSVAVNTEE KWVHFSDASP EHVTPELTPR EQVVTPPAAS DIPADSPAPA
360 370 380 390 400
PPGPTGSAGP PGPPGPRHVP SPLNLEEVQK KVAEQTFIKD DYLETLSSPK
410 420 430 440 450
ECGLGQRATP PPPPPPTYRT VVSSPGPGSG SGTGTTSGAS SPARPATPLV
460 470 480 490 500
PCSTTPPPPP PRPPSRPKLP PGKPGVGDVS RPFSPPIHSS SPPPIAPLAR
510 520 530 540 550
AESTSSISST NSLSAATTPT VGSSRGPSPL TMGAQDTLPV AAAFTETVNA
560 570 580 590 600
YFKGADPSKC IVKITGEMVL SFPAGITRHF ANNPSPAALT FRVVNSSRLE
610 620 630 640 650
HVLPNPQLLC CDNTQNDANT KEFWVNMPNL MTHLKKVSEQ KPQATYYNVD
660 670 680 690 700
MLKYQVSAQG IQSTPLNLAV NWRCEPASTD LRIDYKYNTD AMSTAVALNN
710 720 730 740 750
VQFLVPIDGG VTKLQAVLPP AVWNAEQQRI LWKIPDISQK SENGGVGSLL
760 770 780 790 800
ARFQLSEGPS KPSPLVVQFT SEGSTLSGCD IELVGAGYRF SLIKKRFAAG

KYLADN
Length:806
Mass (Da):86,063
Last modified:March 1, 2002 - v1
Checksum:i4909A6D1DACCC775
GO
Isoform 2 (identifier: Q8VD37-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     35-58: Missing.
     154-161: Missing.
     272-437: Missing.

Show »
Length:608
Mass (Da):65,462
Checksum:i01294472E1F814D2
GO
Isoform 3 (identifier: Q8VD37-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     34-34: Missing.
     272-437: Missing.
     521-521: V → VENEQPSLVWFDRGKFYLTFE

Note: No experimental confirmation available.Combined sources
Show »
Length:659
Mass (Da):71,361
Checksum:i4A2F2788CF03E9F7
GO
Isoform 4 (identifier: Q8VD37-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     34-34: Missing.
     272-437: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:639
Mass (Da):68,873
Checksum:i8EB81B8C8E8331B3
GO
Isoform 5 (identifier: Q8VD37-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-188: RKSPRRSPGAIKRNLSSEEVARPRRSTPTPELTSK → VKKLQDPGVPPQLQNLQARSLWMTLWPLLPSLVHH
     189-806: Missing.

Show »
Length:188
Mass (Da):21,052
Checksum:i869202C079926C05
GO
Isoform 6 (identifier: Q8VD37-6) [UniParc]FASTAAdd to basket
Also known as: SGIP1alpha

The sequence of this isoform differs from the canonical sequence as follows:
     33-33: M → MQGKKKAQKTQLLLTSCFWLRALSLTLSQ
     521-521: V → VENEQPSLVWFDRGKFYLTFE

Note: The N-terminal domain (1-97) of this isoform mediates binding to and tubulation of membranes.Combined sources
Show »
Length:854
Mass (Da):91,725
Checksum:i9FB1695AA4A47D8D
GO
Isoform 7 (identifier: Q8VD37-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     521-521: V → VENEQPSLVWFDRGKFYLTFE

Show »
Length:826
Mass (Da):88,551
Checksum:i706459A1A5A74CB5
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti100H → Q in BAC27870 (PubMed:16141072).Curated1
Sequence conflicti250P → H in BAE28466 (PubMed:16141072).Curated1
Sequence conflicti355T → P in BAF74784 (PubMed:17626015).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04398733M → MQGKKKAQKTQLLLTSCFWL RALSLTLSQ in isoform 6. 1 Publication1
Alternative sequenceiVSP_02027934Missing in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_02028035 – 58Missing in isoform 2. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_020281154 – 188RKSPR…ELTSK → VKKLQDPGVPPQLQNLQARS LWMTLWPLLPSLVHH in isoform 5. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_020282154 – 161Missing in isoform 2. 1 Publication8
Alternative sequenceiVSP_020283189 – 806Missing in isoform 5. 1 PublicationAdd BLAST618
Alternative sequenceiVSP_020284272 – 437Missing in isoform 2, isoform 3 and isoform 4. 1 PublicationAdd BLAST166
Alternative sequenceiVSP_020285521V → VENEQPSLVWFDRGKFYLTF E in isoform 3, isoform 6 and isoform 7. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB262964 mRNA Translation: BAF74784.1
AK014022 mRNA Translation: BAB29118.1
AK032439 mRNA Translation: BAC27870.1
AK043018 mRNA Translation: BAC31435.1
AK148043 mRNA Translation: BAE28309.1
AK148302 mRNA Translation: BAE28466.1
BC017596 mRNA Translation: AAH17596.1
CCDSiCCDS18404.1 [Q8VD37-1]
CCDS71429.1 [Q8VD37-3]
CCDS71430.1 [Q8VD37-4]
RefSeqiNP_001272788.1, NM_001285859.1 [Q8VD37-3]
NP_001272789.1, NM_001285860.1 [Q8VD37-4]
NP_001272791.1, NM_001285862.1
NP_659155.1, NM_144906.2 [Q8VD37-1]
XP_006503491.1, XM_006503428.3 [Q8VD37-8]
XP_017175890.1, XM_017320401.1 [Q8VD37-1]
UniGeneiMm.238094
Mm.446273
Mm.54201

Genome annotation databases

EnsembliENSMUST00000066824; ENSMUSP00000063712; ENSMUSG00000028524 [Q8VD37-3]
ENSMUST00000072481; ENSMUSP00000072301; ENSMUSG00000028524 [Q8VD37-4]
ENSMUST00000080728; ENSMUSP00000079553; ENSMUSG00000028524 [Q8VD37-1]
ENSMUST00000106882; ENSMUSP00000102495; ENSMUSG00000028524 [Q8VD37-8]
ENSMUST00000183855; ENSMUSP00000139337; ENSMUSG00000028524 [Q8VD37-5]
GeneIDi73094
KEGGimmu:73094
UCSCiuc008two.2 mouse [Q8VD37-1]
uc008twq.2 mouse [Q8VD37-6]
uc008twr.2 mouse [Q8VD37-3]
uc008tws.2 mouse [Q8VD37-4]
uc008twt.2 mouse [Q8VD37-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSGIP1_MOUSE
AccessioniPrimary (citable) accession number: Q8VD37
Secondary accession number(s): A7BFW0
, Q3UFU3, Q3UGA0, Q8BXX4, Q8C034, Q9CXT2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: March 1, 2002
Last modified: May 23, 2018
This is version 115 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health