Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Soluble calcium-activated nucleotidase 1

Gene

Cant1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > IDP >> UTP > CDP = GTP = ITP. Has very low activity towards ADP and even lower activity towards ATP. Does not hydrolyze AMP and GMP. Involved in proteoglycan synthesis.By similarity

Catalytic activityi

A nucleoside diphosphate + H2O = a nucleoside phosphate + phosphate.By similarity

Cofactori

Ca2+By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei162Important for dimer formationBy similarity1
Metal bindingi170Calcium; via carbonyl oxygenBy similarity1
Metal bindingi171CalciumBy similarity1
Sitei202Important for dimer formationBy similarity1
Sitei204Important for dimer formationBy similarity1
Metal bindingi217Calcium; via carbonyl oxygenBy similarity1
Sitei258Important for dimer formationBy similarity1
Metal bindingi286Calcium; via carbonyl oxygenBy similarity1
Metal bindingi347Calcium; via carbonyl oxygenBy similarity1
Metal bindingi398Calcium; via carbonyl oxygenBy similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-MMU-6798695. Neutrophil degranulation.

Names & Taxonomyi

Protein namesi
Recommended name:
Soluble calcium-activated nucleotidase 1 (EC:3.6.1.6By similarity)
Short name:
SCAN-1
Alternative name(s):
Apyrase homolog
Gene namesi
Name:Cant1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1923275. Cant1.

Subcellular locationi

  • Endoplasmic reticulum membrane By similarity; Single-pass type II membrane protein By similarity
  • Golgi apparatusGolgi stack membrane By similarity; Single-pass type II membrane protein By similarity

  • Note: Processed form: Secreted.By similarity

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 44CytoplasmicSequence analysisAdd BLAST44
Transmembranei45 – 61Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST17
Topological domaini62 – 403LumenalSequence analysisAdd BLAST342

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002099261 – 403Soluble calcium-activated nucleotidase 1Add BLAST403

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi90N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiQ8VCF1.
PaxDbiQ8VCF1.
PeptideAtlasiQ8VCF1.
PRIDEiQ8VCF1.

PTM databases

PhosphoSitePlusiQ8VCF1.

Expressioni

Gene expression databases

BgeeiENSMUSG00000025575.
CleanExiMM_CANT1.
GenevisibleiQ8VCF1. MM.

Interactioni

Subunit structurei

Monomer. Homodimer; dimerization is Ca2+-dependent.By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000017620.

Structurei

3D structure databases

ProteinModelPortaliQ8VCF1.
SMRiQ8VCF1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the apyrase family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4494. Eukaryota.
ENOG410XS4T. LUCA.
GeneTreeiENSGT00390000012872.
HOGENOMiHOG000008129.
HOVERGENiHBG059824.
InParanoidiQ8VCF1.
KOiK12304.
OMAiVVPTHGF.
OrthoDBiEOG091G0DL5.
TreeFamiTF315248.

Family and domain databases

InterProiIPR009283. Apyrase.
[Graphical view]
PANTHERiPTHR13023. PTHR13023. 1 hit.
PfamiPF06079. Apyrase. 1 hit.
[Graphical view]
SUPFAMiSSF101887. SSF101887. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8VCF1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPIQPFDQRE WNEPMHSLRI SVGGLPVLAS MTKATDPRFR PRWRVILTSF
60 70 80 90 100
VGAALLWLLY SHHQGPVPGR PPTHNAHNWR LSQQRISHYN DTYPLSPPQR
110 120 130 140 150
TPGGIRYRIA VIADLDTGSR AQEENTWFSY LKKGYLTLSD SGDRVSVEWD
160 170 180 190 200
KDHGVLESHL AEKGRGMELS DLIVFNGKLY SVDDRTGVIY QIEGTKAVPW
210 220 230 240 250
VILSDGDGTV EKGFKAEWLA VKDEHLYVGG LGKEWTTTTG EVMNENPEWV
260 270 280 290 300
KVVGHRGSVD HENWVSSYNA LRAAAGIRPP GYLIHESACW SDTLQRWFFL
310 320 330 340 350
PRRASHERYS EKDDERKGSN LLLSAAQDFR DISVRQVGTL IPTHGFSSFK
360 370 380 390 400
FIPNTDDQII VALKSEEDNG RIATYVMAFT LDGRFLLPET KIGTVKYEGI

EFI
Length:403
Mass (Da):45,653
Last modified:March 1, 2002 - v1
Checksum:i0CB2BC618CD4714E
GO
Isoform 2 (identifier: Q8VCF1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     214-214: F → K
     215-403: Missing.

Note: No experimental confirmation available.
Show »
Length:214
Mass (Da):24,189
Checksum:i7B0A7526CCF0FBB5
GO
Isoform 3 (identifier: Q8VCF1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     213-213: G → GQLLLLSLALSPPSTRVCMLSSNDSWEQNLILASCVAG

Note: No experimental confirmation available.
Show »
Length:440
Mass (Da):49,566
Checksum:i5B5DA87E19879644
GO

Sequence cautioni

The sequence BAB31014 differs from that shown. Reason: Frameshift at position 11.Curated
The sequence BAC39351 differs from that shown. Reason: Frameshift at positions 233, 306, 323 and 377.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti8Q → E in BAC38139 (PubMed:16141072).Curated1
Sequence conflicti113A → G in BAC38139 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_013762213G → GQLLLLSLALSPPSTRVCML SSNDSWEQNLILASCVAG in isoform 3. 1 Publication1
Alternative sequenceiVSP_013763214F → K in isoform 2. 1 Publication1
Alternative sequenceiVSP_013764215 – 403Missing in isoform 2. 1 PublicationAdd BLAST189

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK006565 mRNA. Translation: BAB24655.1.
AK017942 mRNA. Translation: BAB31014.1. Frameshift.
AK049879 mRNA. Translation: BAC33968.1.
AK081118 mRNA. Translation: BAC38139.1.
AK085059 mRNA. Translation: BAC39351.1. Frameshift.
AL591404 Genomic DNA. Translation: CAM23112.1.
BC020003 mRNA. Translation: AAH20003.1.
CCDSiCCDS25702.1. [Q8VCF1-1]
CCDS59572.1. [Q8VCF1-3]
RefSeqiNP_001020788.1. NM_001025617.2. [Q8VCF1-1]
NP_001020789.1. NM_001025618.2. [Q8VCF1-1]
NP_001254520.1. NM_001267591.1. [Q8VCF1-1]
NP_001254521.1. NM_001267592.1. [Q8VCF1-3]
NP_083778.2. NM_029502.3. [Q8VCF1-1]
XP_006534467.1. XM_006534404.2. [Q8VCF1-3]
XP_006534468.1. XM_006534405.2. [Q8VCF1-3]
XP_006534469.1. XM_006534406.2. [Q8VCF1-3]
XP_006534470.1. XM_006534407.2. [Q8VCF1-3]
XP_006534471.1. XM_006534408.3. [Q8VCF1-3]
XP_006534472.1. XM_006534409.1. [Q8VCF1-3]
XP_006534473.1. XM_006534410.3. [Q8VCF1-3]
UniGeneiMm.177551.

Genome annotation databases

EnsembliENSMUST00000017620; ENSMUSP00000017620; ENSMUSG00000025575. [Q8VCF1-1]
ENSMUST00000092378; ENSMUSP00000090032; ENSMUSG00000025575. [Q8VCF1-1]
ENSMUST00000106287; ENSMUSP00000101894; ENSMUSG00000025575. [Q8VCF1-1]
ENSMUST00000106288; ENSMUSP00000101895; ENSMUSG00000025575. [Q8VCF1-1]
ENSMUST00000106289; ENSMUSP00000101896; ENSMUSG00000025575. [Q8VCF1-3]
ENSMUST00000164927; ENSMUSP00000126919; ENSMUSG00000025575. [Q8VCF1-1]
GeneIDi76025.
KEGGimmu:76025.
UCSCiuc007mpa.2. mouse. [Q8VCF1-1]
uc007mpf.2. mouse. [Q8VCF1-2]
uc011yin.2. mouse. [Q8VCF1-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK006565 mRNA. Translation: BAB24655.1.
AK017942 mRNA. Translation: BAB31014.1. Frameshift.
AK049879 mRNA. Translation: BAC33968.1.
AK081118 mRNA. Translation: BAC38139.1.
AK085059 mRNA. Translation: BAC39351.1. Frameshift.
AL591404 Genomic DNA. Translation: CAM23112.1.
BC020003 mRNA. Translation: AAH20003.1.
CCDSiCCDS25702.1. [Q8VCF1-1]
CCDS59572.1. [Q8VCF1-3]
RefSeqiNP_001020788.1. NM_001025617.2. [Q8VCF1-1]
NP_001020789.1. NM_001025618.2. [Q8VCF1-1]
NP_001254520.1. NM_001267591.1. [Q8VCF1-1]
NP_001254521.1. NM_001267592.1. [Q8VCF1-3]
NP_083778.2. NM_029502.3. [Q8VCF1-1]
XP_006534467.1. XM_006534404.2. [Q8VCF1-3]
XP_006534468.1. XM_006534405.2. [Q8VCF1-3]
XP_006534469.1. XM_006534406.2. [Q8VCF1-3]
XP_006534470.1. XM_006534407.2. [Q8VCF1-3]
XP_006534471.1. XM_006534408.3. [Q8VCF1-3]
XP_006534472.1. XM_006534409.1. [Q8VCF1-3]
XP_006534473.1. XM_006534410.3. [Q8VCF1-3]
UniGeneiMm.177551.

3D structure databases

ProteinModelPortaliQ8VCF1.
SMRiQ8VCF1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000017620.

PTM databases

PhosphoSitePlusiQ8VCF1.

Proteomic databases

EPDiQ8VCF1.
PaxDbiQ8VCF1.
PeptideAtlasiQ8VCF1.
PRIDEiQ8VCF1.

Protocols and materials databases

DNASUi76025.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000017620; ENSMUSP00000017620; ENSMUSG00000025575. [Q8VCF1-1]
ENSMUST00000092378; ENSMUSP00000090032; ENSMUSG00000025575. [Q8VCF1-1]
ENSMUST00000106287; ENSMUSP00000101894; ENSMUSG00000025575. [Q8VCF1-1]
ENSMUST00000106288; ENSMUSP00000101895; ENSMUSG00000025575. [Q8VCF1-1]
ENSMUST00000106289; ENSMUSP00000101896; ENSMUSG00000025575. [Q8VCF1-3]
ENSMUST00000164927; ENSMUSP00000126919; ENSMUSG00000025575. [Q8VCF1-1]
GeneIDi76025.
KEGGimmu:76025.
UCSCiuc007mpa.2. mouse. [Q8VCF1-1]
uc007mpf.2. mouse. [Q8VCF1-2]
uc011yin.2. mouse. [Q8VCF1-3]

Organism-specific databases

CTDi124583.
MGIiMGI:1923275. Cant1.

Phylogenomic databases

eggNOGiKOG4494. Eukaryota.
ENOG410XS4T. LUCA.
GeneTreeiENSGT00390000012872.
HOGENOMiHOG000008129.
HOVERGENiHBG059824.
InParanoidiQ8VCF1.
KOiK12304.
OMAiVVPTHGF.
OrthoDBiEOG091G0DL5.
TreeFamiTF315248.

Enzyme and pathway databases

ReactomeiR-MMU-6798695. Neutrophil degranulation.

Miscellaneous databases

ChiTaRSiCant1. mouse.
PROiQ8VCF1.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000025575.
CleanExiMM_CANT1.
GenevisibleiQ8VCF1. MM.

Family and domain databases

InterProiIPR009283. Apyrase.
[Graphical view]
PANTHERiPTHR13023. PTHR13023. 1 hit.
PfamiPF06079. Apyrase. 1 hit.
[Graphical view]
SUPFAMiSSF101887. SSF101887. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiCANT1_MOUSE
AccessioniPrimary (citable) accession number: Q8VCF1
Secondary accession number(s): B1AQJ8
, Q8C3R8, Q8C4T6, Q9D3F2, Q9D9R1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: March 1, 2002
Last modified: November 30, 2016
This is version 113 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.