Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Soluble calcium-activated nucleotidase 1

Gene

Cant1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > IDP >> UTP > CDP = GTP = ITP. Has very low activity towards ADP and even lower activity towards ATP. Does not hydrolyze AMP and GMP. Involved in proteoglycan synthesis.By similarity

Catalytic activityi

A nucleoside diphosphate + H2O = a nucleoside phosphate + phosphate.By similarity

Cofactori

Ca2+By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei162Important for dimer formationBy similarity1
Metal bindingi170Calcium; via carbonyl oxygenBy similarity1
Metal bindingi171CalciumBy similarity1
Sitei202Important for dimer formationBy similarity1
Sitei204Important for dimer formationBy similarity1
Metal bindingi217Calcium; via carbonyl oxygenBy similarity1
Sitei258Important for dimer formationBy similarity1
Metal bindingi286Calcium; via carbonyl oxygenBy similarity1
Metal bindingi347Calcium; via carbonyl oxygenBy similarity1
Metal bindingi398Calcium; via carbonyl oxygenBy similarity1

GO - Molecular functioni

GO - Biological processi

  • proteoglycan biosynthetic process Source: UniProtKB
  • ribonucleoside diphosphate catabolic process Source: MGI

Keywordsi

Molecular functionHydrolase
LigandCalcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-MMU-6798695 Neutrophil degranulation

Names & Taxonomyi

Protein namesi
Recommended name:
Soluble calcium-activated nucleotidase 1 (EC:3.6.1.6By similarity)
Short name:
SCAN-1
Alternative name(s):
Apyrase homolog
Gene namesi
Name:Cant1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1923275 Cant1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 44CytoplasmicSequence analysisAdd BLAST44
Transmembranei45 – 61Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST17
Topological domaini62 – 403LumenalSequence analysisAdd BLAST342

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002099261 – 403Soluble calcium-activated nucleotidase 1Add BLAST403

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi90N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiQ8VCF1
PaxDbiQ8VCF1
PeptideAtlasiQ8VCF1
PRIDEiQ8VCF1

PTM databases

iPTMnetiQ8VCF1
PhosphoSitePlusiQ8VCF1

Expressioni

Gene expression databases

BgeeiENSMUSG00000025575
CleanExiMM_CANT1
GenevisibleiQ8VCF1 MM

Interactioni

Subunit structurei

Monomer. Homodimer; dimerization is Ca2+-dependent.By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000017620

Structurei

3D structure databases

ProteinModelPortaliQ8VCF1
SMRiQ8VCF1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the apyrase family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4494 Eukaryota
ENOG410XS4T LUCA
GeneTreeiENSGT00390000012872
HOGENOMiHOG000008129
HOVERGENiHBG059824
InParanoidiQ8VCF1
KOiK12304
OMAiGSMGKEW
OrthoDBiEOG091G0DL5
TreeFamiTF315248

Family and domain databases

Gene3Di2.120.10.100, 1 hit
InterProiView protein in InterPro
IPR009283 Apyrase
IPR036258 Apyrase_sf
PANTHERiPTHR13023 PTHR13023, 1 hit
PfamiView protein in Pfam
PF06079 Apyrase, 1 hit
SUPFAMiSSF101887 SSF101887, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8VCF1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPIQPFDQRE WNEPMHSLRI SVGGLPVLAS MTKATDPRFR PRWRVILTSF
60 70 80 90 100
VGAALLWLLY SHHQGPVPGR PPTHNAHNWR LSQQRISHYN DTYPLSPPQR
110 120 130 140 150
TPGGIRYRIA VIADLDTGSR AQEENTWFSY LKKGYLTLSD SGDRVSVEWD
160 170 180 190 200
KDHGVLESHL AEKGRGMELS DLIVFNGKLY SVDDRTGVIY QIEGTKAVPW
210 220 230 240 250
VILSDGDGTV EKGFKAEWLA VKDEHLYVGG LGKEWTTTTG EVMNENPEWV
260 270 280 290 300
KVVGHRGSVD HENWVSSYNA LRAAAGIRPP GYLIHESACW SDTLQRWFFL
310 320 330 340 350
PRRASHERYS EKDDERKGSN LLLSAAQDFR DISVRQVGTL IPTHGFSSFK
360 370 380 390 400
FIPNTDDQII VALKSEEDNG RIATYVMAFT LDGRFLLPET KIGTVKYEGI

EFI
Length:403
Mass (Da):45,653
Last modified:March 1, 2002 - v1
Checksum:i0CB2BC618CD4714E
GO
Isoform 2 (identifier: Q8VCF1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     214-214: F → K
     215-403: Missing.

Note: No experimental confirmation available.
Show »
Length:214
Mass (Da):24,189
Checksum:i7B0A7526CCF0FBB5
GO
Isoform 3 (identifier: Q8VCF1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     213-213: G → GQLLLLSLALSPPSTRVCMLSSNDSWEQNLILASCVAG

Note: No experimental confirmation available.
Show »
Length:440
Mass (Da):49,566
Checksum:i5B5DA87E19879644
GO

Sequence cautioni

The sequence BAB31014 differs from that shown. Reason: Frameshift at position 11.Curated
The sequence BAC39351 differs from that shown. Reason: Frameshift at positions 233, 306, 323 and 377.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti8Q → E in BAC38139 (PubMed:16141072).Curated1
Sequence conflicti113A → G in BAC38139 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_013762213G → GQLLLLSLALSPPSTRVCML SSNDSWEQNLILASCVAG in isoform 3. 1 Publication1
Alternative sequenceiVSP_013763214F → K in isoform 2. 1 Publication1
Alternative sequenceiVSP_013764215 – 403Missing in isoform 2. 1 PublicationAdd BLAST189

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK006565 mRNA Translation: BAB24655.1
AK017942 mRNA Translation: BAB31014.1 Frameshift.
AK049879 mRNA Translation: BAC33968.1
AK081118 mRNA Translation: BAC38139.1
AK085059 mRNA Translation: BAC39351.1 Frameshift.
AL591404 Genomic DNA Translation: CAM23112.1
BC020003 mRNA Translation: AAH20003.1
CCDSiCCDS25702.1 [Q8VCF1-1]
CCDS59572.1 [Q8VCF1-3]
RefSeqiNP_001020788.1, NM_001025617.2 [Q8VCF1-1]
NP_001020789.1, NM_001025618.2 [Q8VCF1-1]
NP_001254520.1, NM_001267591.1 [Q8VCF1-1]
NP_001254521.1, NM_001267592.1 [Q8VCF1-3]
NP_083778.2, NM_029502.3 [Q8VCF1-1]
XP_006534467.1, XM_006534404.2 [Q8VCF1-3]
XP_006534468.1, XM_006534405.2 [Q8VCF1-3]
XP_006534469.1, XM_006534406.2 [Q8VCF1-3]
XP_006534470.1, XM_006534407.2 [Q8VCF1-3]
XP_006534471.1, XM_006534408.3 [Q8VCF1-3]
XP_006534472.1, XM_006534409.1 [Q8VCF1-3]
XP_006534473.1, XM_006534410.3 [Q8VCF1-3]
UniGeneiMm.177551

Genome annotation databases

EnsembliENSMUST00000017620; ENSMUSP00000017620; ENSMUSG00000025575 [Q8VCF1-1]
ENSMUST00000092378; ENSMUSP00000090032; ENSMUSG00000025575 [Q8VCF1-1]
ENSMUST00000106287; ENSMUSP00000101894; ENSMUSG00000025575 [Q8VCF1-1]
ENSMUST00000106288; ENSMUSP00000101895; ENSMUSG00000025575 [Q8VCF1-1]
ENSMUST00000106289; ENSMUSP00000101896; ENSMUSG00000025575 [Q8VCF1-3]
ENSMUST00000164927; ENSMUSP00000126919; ENSMUSG00000025575 [Q8VCF1-1]
GeneIDi76025
KEGGimmu:76025
UCSCiuc007mpa.2 mouse [Q8VCF1-1]
uc007mpf.2 mouse [Q8VCF1-2]
uc011yin.2 mouse [Q8VCF1-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCANT1_MOUSE
AccessioniPrimary (citable) accession number: Q8VCF1
Secondary accession number(s): B1AQJ8
, Q8C3R8, Q8C4T6, Q9D3F2, Q9D9R1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: March 1, 2002
Last modified: March 28, 2018
This is version 120 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health