Reviewed,
UniProtKB/Swiss-Prot Q8VBW5 (BBX_MOUSE)
Last modified
January 19, 2010.
Version 58.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: HMG box transcription factor BBX Alternative name(s): Bobby sox homolog HMG box-containing protein 2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 907 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Transcription factor that is necessary for cell cycle progression from G1 to S phase. Ref.5 |
| Subcellular location | Nucleus Probable. |
| Sequence similarities | Contains 1 HMG box DNA-binding domain. |
| Sequence caution | The sequence AAL68987.1 differs from that shown. Reason: Miscellaneous discrepancy. Contaminating sequence. Potential poly-A sequence. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | DNA-binding |
| PTM | Phosphoprotein |
| Technical term | 3D-structure |
| Gene Ontology (GO) | |
| Biological process | regulation of transcription Inferred from electronic annotation. Source: UniProtKB-KW transcriptionInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8VBW5-1) Also known as: BbxA; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8VBW5-2) The sequence of this isoform differs from the canonical sequence as follows: 55-135: Missing. 223-249: Missing. 730-730: S → SKGPFQSQKKNLFHKIVSKYKHKKEKPNVPE | ||||||
| Isoform 3 (identifier: Q8VBW5-3) The sequence of this isoform differs from the canonical sequence as follows: 732-751: Missing. | ||||||
| Isoform 4 (identifier: Q8VBW5-4) The sequence of this isoform differs from the canonical sequence as follows: 733-750: SGDKWSHKQFFLDAIHPT → PFQSQKKNLFHKIVSKYK 751-907: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||
Molecule processing | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 907 | 907 | HMG box transcription factor BBX | PRO_0000232886 | |||||||||||||
Regions | |||||||||||||||||
| DNA binding | 80 – 148 | 69 | HMG box | ||||||||||||||
| Compositional bias | 41 – 50 | 10 | Poly-Glu | ||||||||||||||
| Compositional bias | 444 – 540 | 97 | Lys-rich | ||||||||||||||
| Compositional bias | 715 – 718 | 4 | Poly-Lys | ||||||||||||||
Amino acid modifications | |||||||||||||||||
| Modified residue | 159 | 1 | Phosphoserine By similarity | ||||||||||||||
| Modified residue | 161 | 1 | Phosphothreonine By similarity | ||||||||||||||
| Modified residue | 477 | 1 | Phosphoserine By similarity | ||||||||||||||
| Modified residue | 483 | 1 | Phosphoserine By similarity | ||||||||||||||
| Modified residue | 776 | 1 | Phosphothreonine By similarity | ||||||||||||||
| Modified residue | 789 | 1 | Phosphoserine By similarity | ||||||||||||||
| Modified residue | 811 | 1 | Phosphoserine By similarity | ||||||||||||||
Natural variations | |||||||||||||||||
| Alternative sequence | 55 – 135 | 81 | Missing in isoform 2. | VSP_018007 | |||||||||||||
| Alternative sequence | 223 – 249 | 27 | Missing in isoform 2. | VSP_018008 | |||||||||||||
| Alternative sequence | 730 | 1 | S → SKGPFQSQKKNLFHKIVSKY KHKKEKPNVPE in isoform 2. | VSP_018009 | |||||||||||||
| Alternative sequence | 732 – 751 | 20 | Missing in isoform 3. | VSP_018010 | |||||||||||||
| Alternative sequence | 733 – 750 | 18 | SGDKW…AIHPT → PFQSQKKNLFHKIVSKYK in isoform 4. | VSP_018011 | |||||||||||||
| Alternative sequence | 751 – 907 | 157 | Missing in isoform 4. | VSP_018012 | |||||||||||||
| Natural variant | 30 | 1 | P → L in strain: C3H/He. Ref.4 | ||||||||||||||
| Natural variant | 281 | 1 | Q → H in strain: C3H/He. Ref.4 | ||||||||||||||
Experimental info | |||||||||||||||||
| Sequence conflict | 269 | 1 | L → F in AAL58872. Ref.1 | ||||||||||||||
| Sequence conflict | 269 | 1 | L → F in AAL58873. Ref.1 | ||||||||||||||
| Sequence conflict | 269 | 1 | L → F in BAB30768. Ref.2 | ||||||||||||||
| Sequence conflict | 450 | 1 | K → R in BAC34285. Ref.2 | ||||||||||||||
| Sequence conflict | 455 | 1 | N → T in AAL58872. Ref.1 | ||||||||||||||
| Sequence conflict | 455 | 1 | N → T in AAL58873. Ref.1 | ||||||||||||||
Secondary structure | |||||||||||||||||
Helix Strand Turn | |||||||||||||||||
| Helix | 86 – 101 | 16 | |||||||||||||||
| Beta strand | 103 – 105 | 3 | |||||||||||||||
| Helix | 109 – 119 | 11 | |||||||||||||||
| Helix | 123 – 140 | 18 | |||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "BBX is expressed in developing CNS and in neuronal tumours." Lee C.-J., Chan W.-I., Appleby V.J., Orme A.T., Scotting P.J. Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Strain: C57BL/6J. Tissue: Embryo, Pancreas and Testis. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS LEU-30 AND HIS-281. Strain: C3H/He and NMRI. Tissue: Mammary gland, Mammary tumor and Mesenchymal stem cell. |
| [5] | "HBP2: a new mammalian protein that complements the fission yeast MBF transcription complex." Sanchez-Diaz A., Blanco M.A., Jones N., Moreno S. Curr. Genet. 40:110-118(2001) [PubMed: 11680820] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-454, FUNCTION. Strain: C57BL/6J. Tissue: Mammary gland. |
| [6] | "Solution structure of the HMG-box domain of murine bobby sox homolog." RIKEN structural genomics initiative (RSGI) Submitted (AUG-2005) to the PDB data bank Cited for: STRUCTURE BY NMR OF 80-148. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF454943 mRNA. Translation: AAL58872.1. AF454944 mRNA. Translation: AAL58873.1. AK017487 mRNA. Translation: BAB30768.1. AK029532 mRNA. Translation: BAC26500.2. AK029747 mRNA. Translation: BAC26596.1. AK049516 mRNA. Translation: BAC33788.1. AK050488 mRNA. Translation: BAC34285.1. AK157813 mRNA. Translation: BAE34207.1. CT571273, AC109627 Genomic DNA. Translation: CAX15928.1. CT571273, AC109627 Genomic DNA. Translation: CAX15929.1. CT571273, AC109627 Genomic DNA. Translation: CAX15930.1. CT571273, AC109627 Genomic DNA. Translation: CAX15931.1. BC057869 mRNA. Translation: AAH57869.1. BC066821 mRNA. Translation: AAH66821.1. AF276950 mRNA. Translation: AAL68986.1. AF276951 mRNA. Translation: AAL68987.1. Sequence problems. AF276952 mRNA. Translation: AAL68988.1. Different initiation. | ||||||||||||
| IPI | IPI00625898. IPI00626888. IPI00757307. IPI00757891. | ||||||||||||
| RefSeq | NP_081720.2. | ||||||||||||
| UniGene | Mm.28940 | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | Q8VBW5. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q8VBW5. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q8VBW5. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSMUST00000066037; ENSMUSP00000066384; ENSMUSG00000022641; Mus musculus. [Genome view] ENSMUST00000089399; ENSMUSP00000086821; ENSMUSG00000022641; Mus musculus. [Genome view] ENSMUST00000114488; ENSMUSP00000110132; ENSMUSG00000022641; Mus musculus. [Genome view] ENSMUST00000114489; ENSMUSP00000110133; ENSMUSG00000022641; Mus musculus. [Genome view] | ||||||||||||
| GeneID | 70508. | ||||||||||||
| KEGG | mmu:70508. | ||||||||||||
| UCSC | uc007zkn.1. mouse. uc007zkp.1. mouse. uc007zkq.1. mouse. uc007zkr.1. mouse. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 70508. | ||||||||||||
| MGI | MGI:1917758. Bbx. | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | Q8VBW5. | ||||||||||||
| InParanoid | Q8VBW5. | ||||||||||||
| OMA | PQAPVLI. | ||||||||||||
| PhylomeDB | Q8VBW5. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q8VBW5. | ||||||||||||
| Bgee | Q8VBW5. | ||||||||||||
| CleanEx | MM_BBX. | ||||||||||||
| Genevestigator | Q8VBW5. | ||||||||||||
| GermOnline | ENSMUSG00000022641. Mus musculus. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR000910. HMG_HMG1/HMG2. IPR009071. HMG_superfamily. IPR019102. TF_HMG_box_BBX_DUF2028. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:1.10.30.10. HMG-box. 1 hit. | ||||||||||||
| Pfam | PF09667. DUF2028. 1 hit. PF00505. HMG_box. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00398. HMG. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50118. HMG_BOX_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 331763. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | BBX_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8VBW5 Secondary accession number(s): B8JK46 Q9CS94 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


