Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8VBW5 (BBX_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 90. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
HMG box transcription factor BBX
Alternative name(s):
Bobby sox homolog
HMG box-containing protein 2
Gene names
Name:Bbx
Synonyms:Hbp2
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length907 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Transcription factor that is necessary for cell cycle progression from G1 to S phase. Ref.5

Subcellular location

Nucleus Probable.

Sequence similarities

Contains 1 HMG box DNA-binding domain.

Sequence caution

The sequence AAL68987.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.

The sequence AAL68988.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   LigandDNA-binding
   PTMPhosphoprotein
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processbone development

Inferred from mutant phenotype PubMed 22876197. Source: MGI

regulation of transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentnucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionDNA binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8VBW5-1)

Also known as: BbxA;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8VBW5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     55-135: Missing.
     223-249: Missing.
     730-730: S → SKGPFQSQKKNLFHKIVSKYKHKKEKPNVPE
Isoform 3 (identifier: Q8VBW5-3)

The sequence of this isoform differs from the canonical sequence as follows:
     732-751: Missing.
Isoform 4 (identifier: Q8VBW5-4)

The sequence of this isoform differs from the canonical sequence as follows:
     733-750: SGDKWSHKQFFLDAIHPT → PFQSQKKNLFHKIVSKYK
     751-907: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 907907HMG box transcription factor BBX
PRO_0000232886

Regions

DNA binding80 – 14869HMG box
Compositional bias41 – 5010Poly-Glu
Compositional bias444 – 54097Lys-rich
Compositional bias715 – 7184Poly-Lys

Amino acid modifications

Modified residue2421Phosphoserine By similarity
Modified residue4831Phosphoserine By similarity
Modified residue7011Phosphoserine By similarity
Modified residue7891Phosphoserine By similarity
Modified residue8111Phosphoserine By similarity

Natural variations

Alternative sequence55 – 13581Missing in isoform 2.
VSP_018007
Alternative sequence223 – 24927Missing in isoform 2.
VSP_018008
Alternative sequence7301S → SKGPFQSQKKNLFHKIVSKY KHKKEKPNVPE in isoform 2.
VSP_018009
Alternative sequence732 – 75120Missing in isoform 3.
VSP_018010
Alternative sequence733 – 75018SGDKW…AIHPT → PFQSQKKNLFHKIVSKYK in isoform 4.
VSP_018011
Alternative sequence751 – 907157Missing in isoform 4.
VSP_018012
Natural variant301P → L in strain: C3H/He. Ref.4
Natural variant2811Q → H in strain: C3H/He. Ref.4

Experimental info

Sequence conflict2691L → F in AAL58872. Ref.1
Sequence conflict2691L → F in AAL58873. Ref.1
Sequence conflict2691L → F in BAB30768. Ref.2
Sequence conflict4501K → R in BAC34285. Ref.2
Sequence conflict4551N → T in AAL58872. Ref.1
Sequence conflict4551N → T in AAL58873. Ref.1

Secondary structure

......... 907
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (BbxA) [UniParc].

Last modified April 18, 2006. Version 2.
Checksum: 53E113D4B3DE4DAC

FASTA907100,783
        10         20         30         40         50         60 
MKGSNRNKDH STEGEGDGKR PKRKCLQWHP LLAKKLLDFS EEEEEDEEEE DIDKVQLLEA 

        70         80         90        100        110        120 
DGLEQDVAET EDDESPEQRA RRPMNAFLLF CKRHRSLVRQ EHPRLDNRGA TKILADWWAV 

       130        140        150        160        170        180 
LDPKEKQKYT DMAKEYKDAF MKANPGYRWC PTTNKPVKSP TPTVNPRKKL WAFPPDSSRD 

       190        200        210        220        230        240 
LPTPKKAKTE VPQLNFGMAD PTQMGGLSML LLAGEHALGT PEASSGTCRP DISESPELRQ 

       250        260        270        280        290        300 
KSPLFQFAEI SSRTSHPDAP SKQCQASALF QFAEISSSTS QLGGTEPVKR CGNSALFQLA 

       310        320        330        340        350        360 
EMCLASEGVK MEDTKLIKSK ESDGGRIEEI EKGKEERGTE VEKTTETSFQ KEAEFGKSAK 

       370        380        390        400        410        420 
GNVRESKDLR DIEQLQMDNV MAIKVEDPKE IRKEPEDDQK YSHFPDFSYS ASSKIIISGV 

       430        440        450        460        470        480 
PSRKDHMCHP HGIMIIEDPT TLNKPEKIKK KKKKNKLDRH GNDKSTPKKT CKKRQSSESD 

       490        500        510        520        530        540 
IESVMYTIEA VAKGDWGVDK LGETPRKKVR PSSSGKGGIL DAKPPKKKVK SKEKKVSKEK 

       550        560        570        580        590        600 
CSDITKESRP PDFLSISASK SVPGEVPEGI KAEPLTPTED ALPPSLPGQA KPEDSDCHRK 

       610        620        630        640        650        660 
TETCGSRKSE RSCKGALYKT LVSEGMLTSL RANVDRGKRS SGKGNSSDHE GCWSEESWTF 

       670        680        690        700        710        720 
NQSGTSGSKK FKKKLREDSF LGSAKLDEEF EKKFNSLPQY SPITFDRKCV STPRKKKKTG 

       730        740        750        760        770        780 
NMSSESTKTS KGSGDKWSHK QFFLDAIHPT EAIFSEDKST TEPAFKVKNA LSIPNTPEPT 

       790        800        810        820        830        840 
TMQEPLVGSQ KRKARKTKIT HLVRTADGRV SPAGGTLDDK PKEQLQRSLP KVPGTYCGDN 

       850        860        870        880        890        900 
CSHSTVEEPR SSTPDMPAVS AFFSLAALAE VAAMENVHRG QRSTPLTHDG QPKEMPQAPV 


LISCADQ 

« Hide

Isoform 2 [UniParc].

Checksum: 3685A4E65B4A64EF
Show »

FASTA82991,878
Isoform 3 [UniParc].

Checksum: B1913D47BAE14B1C
Show »

FASTA88798,500
Isoform 4 [UniParc].

Checksum: 5035FF87DBAEAF10
Show »

FASTA75083,986

References

« Hide 'large scale' references
[1]"BBX is expressed in developing CNS and in neuronal tumours."
Lee C.-J., Chan W.-I., Appleby V.J., Orme A.T., Scotting P.J.
Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
Strain: C57BL/6J.
Tissue: Embryo, Pancreas and Testis.
[3]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS LEU-30 AND HIS-281.
Strain: C3H/He and NMRI.
Tissue: Mammary gland, Mammary tumor and Mesenchymal stem cell.
[5]"HBP2: a new mammalian protein that complements the fission yeast MBF transcription complex."
Sanchez-Diaz A., Blanco M.A., Jones N., Moreno S.
Curr. Genet. 40:110-118(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-454, FUNCTION.
Strain: C57BL/6J.
Tissue: Mammary gland.
[6]"The phagosomal proteome in interferon-gamma-activated macrophages."
Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[7]"Solution structure of the HMG-box domain of murine bobby sox homolog."
RIKEN structural genomics initiative (RSGI)
Submitted (AUG-2005) to the PDB data bank
Cited for: STRUCTURE BY NMR OF 80-148.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF454943 mRNA. Translation: AAL58872.1.
AF454944 mRNA. Translation: AAL58873.1.
AK017487 mRNA. Translation: BAB30768.1.
AK029532 mRNA. Translation: BAC26500.2.
AK029747 mRNA. Translation: BAC26596.1.
AK049516 mRNA. Translation: BAC33788.1.
AK050488 mRNA. Translation: BAC34285.1.
AK157813 mRNA. Translation: BAE34207.1.
CT571273, AC109627 Genomic DNA. Translation: CAX15928.1.
CT571273, AC109627 Genomic DNA. Translation: CAX15929.1.
CT571273, AC109627 Genomic DNA. Translation: CAX15930.1.
CT571273, AC109627 Genomic DNA. Translation: CAX15931.1.
BC057869 mRNA. Translation: AAH57869.1.
BC066821 mRNA. Translation: AAH66821.1.
AF276950 mRNA. Translation: AAL68986.1.
AF276951 mRNA. Translation: AAL68987.1. Sequence problems.
AF276952 mRNA. Translation: AAL68988.1. Different initiation.
CCDSCCDS37354.1. [Q8VBW5-1]
RefSeqNP_081720.2. NM_027444.3. [Q8VBW5-1]
XP_006522621.1. XM_006522558.1. [Q8VBW5-1]
XP_006522622.1. XM_006522559.1. [Q8VBW5-1]
XP_006522625.1. XM_006522562.1. [Q8VBW5-3]
XP_006522626.1. XM_006522563.1. [Q8VBW5-3]
UniGeneMm.28940.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1WZ6NMR-A80-148[»]
ProteinModelPortalQ8VBW5.
SMRQ8VBW5. Positions 80-153.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ8VBW5.

Proteomic databases

PRIDEQ8VBW5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000066037; ENSMUSP00000066384; ENSMUSG00000022641. [Q8VBW5-2]
ENSMUST00000089399; ENSMUSP00000086821; ENSMUSG00000022641. [Q8VBW5-4]
ENSMUST00000089404; ENSMUSP00000086826; ENSMUSG00000022641. [Q8VBW5-3]
ENSMUST00000114488; ENSMUSP00000110132; ENSMUSG00000022641. [Q8VBW5-1]
ENSMUST00000138166; ENSMUSP00000119238; ENSMUSG00000022641. [Q8VBW5-1]
GeneID70508.
KEGGmmu:70508.
UCSCuc007zkn.2. mouse. [Q8VBW5-1]
uc007zkp.2. mouse. [Q8VBW5-3]
uc007zkq.2. mouse. [Q8VBW5-2]
uc007zkr.2. mouse. [Q8VBW5-4]

Organism-specific databases

CTD56987.
MGIMGI:1917758. Bbx.

Phylogenomic databases

eggNOGNOG305473.
GeneTreeENSGT00530000063757.
HOVERGENHBG079777.
InParanoidQ8VBW5.
OMAFQFAEIS.
OrthoDBEOG77DJ8X.
PhylomeDBQ8VBW5.
TreeFamTF106402.

Gene expression databases

ArrayExpressQ8VBW5.
BgeeQ8VBW5.
CleanExMM_BBX.
GenevestigatorQ8VBW5.

Family and domain databases

Gene3D1.10.30.10. 1 hit.
InterProIPR009071. HMG_box_dom.
IPR019102. TF_HMG_box_BBX_DUF2028.
[Graphical view]
PfamPF09667. DUF2028. 1 hit.
PF00505. HMG_box. 1 hit.
[Graphical view]
SMARTSM00398. HMG. 1 hit.
[Graphical view]
SUPFAMSSF47095. SSF47095. 1 hit.
PROSITEPS50118. HMG_BOX_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ8VBW5.
NextBio331763.
PROQ8VBW5.
SOURCESearch...

Entry information

Entry nameBBX_MOUSE
AccessionPrimary (citable) accession number: Q8VBW5
Secondary accession number(s): B8JK46 expand/collapse secondary AC list , B8JK47, B8JK48, B8JK49, Q3TZK1, Q6NXY8, Q6PEU3, Q8BQJ7, Q8C7E0, Q8CDQ0, Q8CDV1, Q8VI48, Q8VI49, Q8VI50, Q9CS94
Entry history
Integrated into UniProtKB/Swiss-Prot: April 18, 2006
Last sequence update: April 18, 2006
Last modified: July 9, 2014
This is version 90 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot