SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8VBW5

- BBX_MOUSE

UniProt

Q8VBW5 - BBX_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

HMG box transcription factor BBX

Gene
Bbx, Hbp2
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Transcription factor that is necessary for cell cycle progression from G1 to S phase.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi80 – 14869HMG boxAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW

GO - Biological processi

  1. bone development Source: MGI
  2. regulation of transcription, DNA-templated Source: UniProtKB-KW
  3. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
HMG box transcription factor BBX
Alternative name(s):
Bobby sox homolog
HMG box-containing protein 2
Gene namesi
Name:Bbx
Synonyms:Hbp2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 16

Organism-specific databases

MGIiMGI:1917758. Bbx.

Subcellular locationi

Nucleus Inferred

GO - Cellular componenti

  1. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 907907HMG box transcription factor BBXPRO_0000232886Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei242 – 2421Phosphoserine By similarity
Modified residuei483 – 4831Phosphoserine By similarity
Modified residuei701 – 7011Phosphoserine By similarity
Modified residuei789 – 7891Phosphoserine By similarity
Modified residuei811 – 8111Phosphoserine By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PRIDEiQ8VBW5.

PTM databases

PhosphoSiteiQ8VBW5.

Expressioni

Gene expression databases

ArrayExpressiQ8VBW5.
BgeeiQ8VBW5.
CleanExiMM_BBX.
GenevestigatoriQ8VBW5.

Structurei

Secondary structure

1
907
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi86 – 10116
Beta strandi103 – 1053
Helixi109 – 11911
Helixi123 – 14018

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1WZ6NMR-A80-148[»]
ProteinModelPortaliQ8VBW5.
SMRiQ8VBW5. Positions 80-153.

Miscellaneous databases

EvolutionaryTraceiQ8VBW5.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi41 – 5010Poly-Glu
Compositional biasi444 – 54097Lys-richAdd
BLAST
Compositional biasi715 – 7184Poly-Lys

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG305473.
GeneTreeiENSGT00530000063757.
HOVERGENiHBG079777.
InParanoidiQ8VBW5.
OMAiFQFAEIS.
OrthoDBiEOG77DJ8X.
PhylomeDBiQ8VBW5.
TreeFamiTF106402.

Family and domain databases

Gene3Di1.10.30.10. 1 hit.
InterProiIPR009071. HMG_box_dom.
IPR019102. TF_HMG_box_BBX_DUF2028.
[Graphical view]
PfamiPF09667. DUF2028. 1 hit.
PF00505. HMG_box. 1 hit.
[Graphical view]
SMARTiSM00398. HMG. 1 hit.
[Graphical view]
SUPFAMiSSF47095. SSF47095. 1 hit.
PROSITEiPS50118. HMG_BOX_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8VBW5-1) [UniParc]FASTAAdd to Basket

Also known as: BbxA

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKGSNRNKDH STEGEGDGKR PKRKCLQWHP LLAKKLLDFS EEEEEDEEEE    50
DIDKVQLLEA DGLEQDVAET EDDESPEQRA RRPMNAFLLF CKRHRSLVRQ 100
EHPRLDNRGA TKILADWWAV LDPKEKQKYT DMAKEYKDAF MKANPGYRWC 150
PTTNKPVKSP TPTVNPRKKL WAFPPDSSRD LPTPKKAKTE VPQLNFGMAD 200
PTQMGGLSML LLAGEHALGT PEASSGTCRP DISESPELRQ KSPLFQFAEI 250
SSRTSHPDAP SKQCQASALF QFAEISSSTS QLGGTEPVKR CGNSALFQLA 300
EMCLASEGVK MEDTKLIKSK ESDGGRIEEI EKGKEERGTE VEKTTETSFQ 350
KEAEFGKSAK GNVRESKDLR DIEQLQMDNV MAIKVEDPKE IRKEPEDDQK 400
YSHFPDFSYS ASSKIIISGV PSRKDHMCHP HGIMIIEDPT TLNKPEKIKK 450
KKKKNKLDRH GNDKSTPKKT CKKRQSSESD IESVMYTIEA VAKGDWGVDK 500
LGETPRKKVR PSSSGKGGIL DAKPPKKKVK SKEKKVSKEK CSDITKESRP 550
PDFLSISASK SVPGEVPEGI KAEPLTPTED ALPPSLPGQA KPEDSDCHRK 600
TETCGSRKSE RSCKGALYKT LVSEGMLTSL RANVDRGKRS SGKGNSSDHE 650
GCWSEESWTF NQSGTSGSKK FKKKLREDSF LGSAKLDEEF EKKFNSLPQY 700
SPITFDRKCV STPRKKKKTG NMSSESTKTS KGSGDKWSHK QFFLDAIHPT 750
EAIFSEDKST TEPAFKVKNA LSIPNTPEPT TMQEPLVGSQ KRKARKTKIT 800
HLVRTADGRV SPAGGTLDDK PKEQLQRSLP KVPGTYCGDN CSHSTVEEPR 850
SSTPDMPAVS AFFSLAALAE VAAMENVHRG QRSTPLTHDG QPKEMPQAPV 900
LISCADQ 907
Length:907
Mass (Da):100,783
Last modified:April 18, 2006 - v2
Checksum:i53E113D4B3DE4DAC
GO
Isoform 2 (identifier: Q8VBW5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     55-135: Missing.
     223-249: Missing.
     730-730: S → SKGPFQSQKKNLFHKIVSKYKHKKEKPNVPE

Show »
Length:829
Mass (Da):91,878
Checksum:i3685A4E65B4A64EF
GO
Isoform 3 (identifier: Q8VBW5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     732-751: Missing.

Show »
Length:887
Mass (Da):98,500
Checksum:iB1913D47BAE14B1C
GO
Isoform 4 (identifier: Q8VBW5-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     733-750: SGDKWSHKQFFLDAIHPT → PFQSQKKNLFHKIVSKYK
     751-907: Missing.

Show »
Length:750
Mass (Da):83,986
Checksum:i5035FF87DBAEAF10
GO

Sequence cautioni

The sequence AAL68987.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
The sequence AAL68988.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti30 – 301P → L in strain: C3H/He. 1 Publication
Natural varianti281 – 2811Q → H in strain: C3H/He. 1 Publication

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei55 – 13581Missing in isoform 2. VSP_018007Add
BLAST
Alternative sequencei223 – 24927Missing in isoform 2. VSP_018008Add
BLAST
Alternative sequencei730 – 7301S → SKGPFQSQKKNLFHKIVSKY KHKKEKPNVPE in isoform 2. VSP_018009
Alternative sequencei732 – 75120Missing in isoform 3. VSP_018010Add
BLAST
Alternative sequencei733 – 75018SGDKW…AIHPT → PFQSQKKNLFHKIVSKYK in isoform 4. VSP_018011Add
BLAST
Alternative sequencei751 – 907157Missing in isoform 4. VSP_018012Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti269 – 2691L → F in AAL58872. 1 Publication
Sequence conflicti269 – 2691L → F in AAL58873. 1 Publication
Sequence conflicti269 – 2691L → F in BAB30768. 1 Publication
Sequence conflicti450 – 4501K → R in BAC34285. 1 Publication
Sequence conflicti455 – 4551N → T in AAL58872. 1 Publication
Sequence conflicti455 – 4551N → T in AAL58873. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF454943 mRNA. Translation: AAL58872.1.
AF454944 mRNA. Translation: AAL58873.1.
AK017487 mRNA. Translation: BAB30768.1.
AK029532 mRNA. Translation: BAC26500.2.
AK029747 mRNA. Translation: BAC26596.1.
AK049516 mRNA. Translation: BAC33788.1.
AK050488 mRNA. Translation: BAC34285.1.
AK157813 mRNA. Translation: BAE34207.1.
CT571273, AC109627 Genomic DNA. Translation: CAX15928.1.
CT571273, AC109627 Genomic DNA. Translation: CAX15929.1.
CT571273, AC109627 Genomic DNA. Translation: CAX15930.1.
CT571273, AC109627 Genomic DNA. Translation: CAX15931.1.
BC057869 mRNA. Translation: AAH57869.1.
BC066821 mRNA. Translation: AAH66821.1.
AF276950 mRNA. Translation: AAL68986.1.
AF276951 mRNA. Translation: AAL68987.1. Sequence problems.
AF276952 mRNA. Translation: AAL68988.1. Different initiation.
CCDSiCCDS37354.1. [Q8VBW5-1]
RefSeqiNP_081720.2. NM_027444.3. [Q8VBW5-1]
XP_006522621.1. XM_006522558.1. [Q8VBW5-1]
XP_006522622.1. XM_006522559.1. [Q8VBW5-1]
XP_006522625.1. XM_006522562.1. [Q8VBW5-3]
XP_006522626.1. XM_006522563.1. [Q8VBW5-3]
UniGeneiMm.28940.

Genome annotation databases

EnsembliENSMUST00000066037; ENSMUSP00000066384; ENSMUSG00000022641. [Q8VBW5-2]
ENSMUST00000089399; ENSMUSP00000086821; ENSMUSG00000022641. [Q8VBW5-4]
ENSMUST00000089404; ENSMUSP00000086826; ENSMUSG00000022641. [Q8VBW5-3]
ENSMUST00000114488; ENSMUSP00000110132; ENSMUSG00000022641. [Q8VBW5-1]
ENSMUST00000138166; ENSMUSP00000119238; ENSMUSG00000022641. [Q8VBW5-1]
GeneIDi70508.
KEGGimmu:70508.
UCSCiuc007zkn.2. mouse. [Q8VBW5-1]
uc007zkp.2. mouse. [Q8VBW5-3]
uc007zkq.2. mouse. [Q8VBW5-2]
uc007zkr.2. mouse. [Q8VBW5-4]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF454943 mRNA. Translation: AAL58872.1 .
AF454944 mRNA. Translation: AAL58873.1 .
AK017487 mRNA. Translation: BAB30768.1 .
AK029532 mRNA. Translation: BAC26500.2 .
AK029747 mRNA. Translation: BAC26596.1 .
AK049516 mRNA. Translation: BAC33788.1 .
AK050488 mRNA. Translation: BAC34285.1 .
AK157813 mRNA. Translation: BAE34207.1 .
CT571273 , AC109627 Genomic DNA. Translation: CAX15928.1 .
CT571273 , AC109627 Genomic DNA. Translation: CAX15929.1 .
CT571273 , AC109627 Genomic DNA. Translation: CAX15930.1 .
CT571273 , AC109627 Genomic DNA. Translation: CAX15931.1 .
BC057869 mRNA. Translation: AAH57869.1 .
BC066821 mRNA. Translation: AAH66821.1 .
AF276950 mRNA. Translation: AAL68986.1 .
AF276951 mRNA. Translation: AAL68987.1 . Sequence problems.
AF276952 mRNA. Translation: AAL68988.1 . Different initiation.
CCDSi CCDS37354.1. [Q8VBW5-1 ]
RefSeqi NP_081720.2. NM_027444.3. [Q8VBW5-1 ]
XP_006522621.1. XM_006522558.1. [Q8VBW5-1 ]
XP_006522622.1. XM_006522559.1. [Q8VBW5-1 ]
XP_006522625.1. XM_006522562.1. [Q8VBW5-3 ]
XP_006522626.1. XM_006522563.1. [Q8VBW5-3 ]
UniGenei Mm.28940.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1WZ6 NMR - A 80-148 [» ]
ProteinModelPortali Q8VBW5.
SMRi Q8VBW5. Positions 80-153.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q8VBW5.

Proteomic databases

PRIDEi Q8VBW5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000066037 ; ENSMUSP00000066384 ; ENSMUSG00000022641 . [Q8VBW5-2 ]
ENSMUST00000089399 ; ENSMUSP00000086821 ; ENSMUSG00000022641 . [Q8VBW5-4 ]
ENSMUST00000089404 ; ENSMUSP00000086826 ; ENSMUSG00000022641 . [Q8VBW5-3 ]
ENSMUST00000114488 ; ENSMUSP00000110132 ; ENSMUSG00000022641 . [Q8VBW5-1 ]
ENSMUST00000138166 ; ENSMUSP00000119238 ; ENSMUSG00000022641 . [Q8VBW5-1 ]
GeneIDi 70508.
KEGGi mmu:70508.
UCSCi uc007zkn.2. mouse. [Q8VBW5-1 ]
uc007zkp.2. mouse. [Q8VBW5-3 ]
uc007zkq.2. mouse. [Q8VBW5-2 ]
uc007zkr.2. mouse. [Q8VBW5-4 ]

Organism-specific databases

CTDi 56987.
MGIi MGI:1917758. Bbx.

Phylogenomic databases

eggNOGi NOG305473.
GeneTreei ENSGT00530000063757.
HOVERGENi HBG079777.
InParanoidi Q8VBW5.
OMAi FQFAEIS.
OrthoDBi EOG77DJ8X.
PhylomeDBi Q8VBW5.
TreeFami TF106402.

Miscellaneous databases

EvolutionaryTracei Q8VBW5.
NextBioi 331763.
PROi Q8VBW5.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8VBW5.
Bgeei Q8VBW5.
CleanExi MM_BBX.
Genevestigatori Q8VBW5.

Family and domain databases

Gene3Di 1.10.30.10. 1 hit.
InterProi IPR009071. HMG_box_dom.
IPR019102. TF_HMG_box_BBX_DUF2028.
[Graphical view ]
Pfami PF09667. DUF2028. 1 hit.
PF00505. HMG_box. 1 hit.
[Graphical view ]
SMARTi SM00398. HMG. 1 hit.
[Graphical view ]
SUPFAMi SSF47095. SSF47095. 1 hit.
PROSITEi PS50118. HMG_BOX_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "BBX is expressed in developing CNS and in neuronal tumours."
    Lee C.-J., Chan W.-I., Appleby V.J., Orme A.T., Scotting P.J.
    Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Strain: C57BL/6J.
    Tissue: Embryo, Pancreas and Testis.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS LEU-30 AND HIS-281.
    Strain: C3H/He and NMRI.
    Tissue: Mammary gland, Mammary tumor and Mesenchymal stem cell.
  5. "HBP2: a new mammalian protein that complements the fission yeast MBF transcription complex."
    Sanchez-Diaz A., Blanco M.A., Jones N., Moreno S.
    Curr. Genet. 40:110-118(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-454, FUNCTION.
    Strain: C57BL/6J.
    Tissue: Mammary gland.
  6. "The phagosomal proteome in interferon-gamma-activated macrophages."
    Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
    Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "Solution structure of the HMG-box domain of murine bobby sox homolog."
    RIKEN structural genomics initiative (RSGI)
    Submitted (AUG-2005) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 80-148.

Entry informationi

Entry nameiBBX_MOUSE
AccessioniPrimary (citable) accession number: Q8VBW5
Secondary accession number(s): B8JK46
, B8JK47, B8JK48, B8JK49, Q3TZK1, Q6NXY8, Q6PEU3, Q8BQJ7, Q8C7E0, Q8CDQ0, Q8CDV1, Q8VI48, Q8VI49, Q8VI50, Q9CS94
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 18, 2006
Last sequence update: April 18, 2006
Last modified: July 9, 2014
This is version 90 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi