Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8VBW5

- BBX_MOUSE

UniProt

Q8VBW5 - BBX_MOUSE

Protein

HMG box transcription factor BBX

Gene

Bbx

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 91 (01 Oct 2014)
      Sequence version 2 (18 Apr 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcription factor that is necessary for cell cycle progression from G1 to S phase.1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi80 – 14869HMG boxPROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW

    GO - Biological processi

    1. bone development Source: MGI
    2. regulation of transcription, DNA-templated Source: UniProtKB-KW
    3. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    HMG box transcription factor BBX
    Alternative name(s):
    Bobby sox homolog
    HMG box-containing protein 2
    Gene namesi
    Name:Bbx
    Synonyms:Hbp2
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 16

    Organism-specific databases

    MGIiMGI:1917758. Bbx.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 907907HMG box transcription factor BBXPRO_0000232886Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei242 – 2421PhosphoserineBy similarity
    Modified residuei483 – 4831PhosphoserineBy similarity
    Modified residuei701 – 7011PhosphoserineBy similarity
    Modified residuei789 – 7891PhosphoserineBy similarity
    Modified residuei811 – 8111PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PRIDEiQ8VBW5.

    PTM databases

    PhosphoSiteiQ8VBW5.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8VBW5.
    BgeeiQ8VBW5.
    CleanExiMM_BBX.
    GenevestigatoriQ8VBW5.

    Structurei

    Secondary structure

    1
    907
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi86 – 10116
    Beta strandi103 – 1053
    Helixi109 – 11911
    Helixi123 – 14018

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1WZ6NMR-A80-148[»]
    ProteinModelPortaliQ8VBW5.
    SMRiQ8VBW5. Positions 80-153.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ8VBW5.

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi41 – 5010Poly-Glu
    Compositional biasi444 – 54097Lys-richAdd
    BLAST
    Compositional biasi715 – 7184Poly-Lys

    Sequence similaritiesi

    Contains 1 HMG box DNA-binding domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG305473.
    GeneTreeiENSGT00530000063757.
    HOVERGENiHBG079777.
    InParanoidiQ8VBW5.
    OMAiFQFAEIS.
    OrthoDBiEOG77DJ8X.
    PhylomeDBiQ8VBW5.
    TreeFamiTF106402.

    Family and domain databases

    Gene3Di1.10.30.10. 1 hit.
    InterProiIPR009071. HMG_box_dom.
    IPR019102. TF_HMG_box_BBX_DUF2028.
    [Graphical view]
    PfamiPF09667. DUF2028. 1 hit.
    PF00505. HMG_box. 1 hit.
    [Graphical view]
    SMARTiSM00398. HMG. 1 hit.
    [Graphical view]
    SUPFAMiSSF47095. SSF47095. 1 hit.
    PROSITEiPS50118. HMG_BOX_2. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8VBW5-1) [UniParc]FASTAAdd to Basket

    Also known as: BbxA

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKGSNRNKDH STEGEGDGKR PKRKCLQWHP LLAKKLLDFS EEEEEDEEEE    50
    DIDKVQLLEA DGLEQDVAET EDDESPEQRA RRPMNAFLLF CKRHRSLVRQ 100
    EHPRLDNRGA TKILADWWAV LDPKEKQKYT DMAKEYKDAF MKANPGYRWC 150
    PTTNKPVKSP TPTVNPRKKL WAFPPDSSRD LPTPKKAKTE VPQLNFGMAD 200
    PTQMGGLSML LLAGEHALGT PEASSGTCRP DISESPELRQ KSPLFQFAEI 250
    SSRTSHPDAP SKQCQASALF QFAEISSSTS QLGGTEPVKR CGNSALFQLA 300
    EMCLASEGVK MEDTKLIKSK ESDGGRIEEI EKGKEERGTE VEKTTETSFQ 350
    KEAEFGKSAK GNVRESKDLR DIEQLQMDNV MAIKVEDPKE IRKEPEDDQK 400
    YSHFPDFSYS ASSKIIISGV PSRKDHMCHP HGIMIIEDPT TLNKPEKIKK 450
    KKKKNKLDRH GNDKSTPKKT CKKRQSSESD IESVMYTIEA VAKGDWGVDK 500
    LGETPRKKVR PSSSGKGGIL DAKPPKKKVK SKEKKVSKEK CSDITKESRP 550
    PDFLSISASK SVPGEVPEGI KAEPLTPTED ALPPSLPGQA KPEDSDCHRK 600
    TETCGSRKSE RSCKGALYKT LVSEGMLTSL RANVDRGKRS SGKGNSSDHE 650
    GCWSEESWTF NQSGTSGSKK FKKKLREDSF LGSAKLDEEF EKKFNSLPQY 700
    SPITFDRKCV STPRKKKKTG NMSSESTKTS KGSGDKWSHK QFFLDAIHPT 750
    EAIFSEDKST TEPAFKVKNA LSIPNTPEPT TMQEPLVGSQ KRKARKTKIT 800
    HLVRTADGRV SPAGGTLDDK PKEQLQRSLP KVPGTYCGDN CSHSTVEEPR 850
    SSTPDMPAVS AFFSLAALAE VAAMENVHRG QRSTPLTHDG QPKEMPQAPV 900
    LISCADQ 907
    Length:907
    Mass (Da):100,783
    Last modified:April 18, 2006 - v2
    Checksum:i53E113D4B3DE4DAC
    GO
    Isoform 2 (identifier: Q8VBW5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         55-135: Missing.
         223-249: Missing.
         730-730: S → SKGPFQSQKKNLFHKIVSKYKHKKEKPNVPE

    Show »
    Length:829
    Mass (Da):91,878
    Checksum:i3685A4E65B4A64EF
    GO
    Isoform 3 (identifier: Q8VBW5-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         732-751: Missing.

    Show »
    Length:887
    Mass (Da):98,500
    Checksum:iB1913D47BAE14B1C
    GO
    Isoform 4 (identifier: Q8VBW5-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         733-750: SGDKWSHKQFFLDAIHPT → PFQSQKKNLFHKIVSKYK
         751-907: Missing.

    Show »
    Length:750
    Mass (Da):83,986
    Checksum:i5035FF87DBAEAF10
    GO

    Sequence cautioni

    The sequence AAL68987.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
    The sequence AAL68988.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti269 – 2691L → F in AAL58872. 1 PublicationCurated
    Sequence conflicti269 – 2691L → F in AAL58873. 1 PublicationCurated
    Sequence conflicti269 – 2691L → F in BAB30768. (PubMed:16141072)Curated
    Sequence conflicti450 – 4501K → R in BAC34285. (PubMed:16141072)Curated
    Sequence conflicti455 – 4551N → T in AAL58872. 1 PublicationCurated
    Sequence conflicti455 – 4551N → T in AAL58873. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti30 – 301P → L in strain: C3H/He. 1 Publication
    Natural varianti281 – 2811Q → H in strain: C3H/He. 1 Publication

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei55 – 13581Missing in isoform 2. 1 PublicationVSP_018007Add
    BLAST
    Alternative sequencei223 – 24927Missing in isoform 2. 1 PublicationVSP_018008Add
    BLAST
    Alternative sequencei730 – 7301S → SKGPFQSQKKNLFHKIVSKY KHKKEKPNVPE in isoform 2. 1 PublicationVSP_018009
    Alternative sequencei732 – 75120Missing in isoform 3. 1 PublicationVSP_018010Add
    BLAST
    Alternative sequencei733 – 75018SGDKW…AIHPT → PFQSQKKNLFHKIVSKYK in isoform 4. 1 PublicationVSP_018011Add
    BLAST
    Alternative sequencei751 – 907157Missing in isoform 4. 1 PublicationVSP_018012Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF454943 mRNA. Translation: AAL58872.1.
    AF454944 mRNA. Translation: AAL58873.1.
    AK017487 mRNA. Translation: BAB30768.1.
    AK029532 mRNA. Translation: BAC26500.2.
    AK029747 mRNA. Translation: BAC26596.1.
    AK049516 mRNA. Translation: BAC33788.1.
    AK050488 mRNA. Translation: BAC34285.1.
    AK157813 mRNA. Translation: BAE34207.1.
    CT571273, AC109627 Genomic DNA. Translation: CAX15928.1.
    CT571273, AC109627 Genomic DNA. Translation: CAX15929.1.
    CT571273, AC109627 Genomic DNA. Translation: CAX15930.1.
    CT571273, AC109627 Genomic DNA. Translation: CAX15931.1.
    BC057869 mRNA. Translation: AAH57869.1.
    BC066821 mRNA. Translation: AAH66821.1.
    AF276950 mRNA. Translation: AAL68986.1.
    AF276951 mRNA. Translation: AAL68987.1. Sequence problems.
    AF276952 mRNA. Translation: AAL68988.1. Different initiation.
    CCDSiCCDS37354.1. [Q8VBW5-1]
    RefSeqiNP_081720.2. NM_027444.3. [Q8VBW5-1]
    XP_006522621.1. XM_006522558.1. [Q8VBW5-1]
    XP_006522622.1. XM_006522559.1. [Q8VBW5-1]
    XP_006522625.1. XM_006522562.1. [Q8VBW5-3]
    XP_006522626.1. XM_006522563.1. [Q8VBW5-3]
    UniGeneiMm.28940.

    Genome annotation databases

    EnsembliENSMUST00000066037; ENSMUSP00000066384; ENSMUSG00000022641. [Q8VBW5-2]
    ENSMUST00000089399; ENSMUSP00000086821; ENSMUSG00000022641. [Q8VBW5-4]
    ENSMUST00000089404; ENSMUSP00000086826; ENSMUSG00000022641. [Q8VBW5-3]
    ENSMUST00000114488; ENSMUSP00000110132; ENSMUSG00000022641. [Q8VBW5-1]
    ENSMUST00000138166; ENSMUSP00000119238; ENSMUSG00000022641. [Q8VBW5-1]
    GeneIDi70508.
    KEGGimmu:70508.
    UCSCiuc007zkn.2. mouse. [Q8VBW5-1]
    uc007zkp.2. mouse. [Q8VBW5-3]
    uc007zkq.2. mouse. [Q8VBW5-2]
    uc007zkr.2. mouse. [Q8VBW5-4]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF454943 mRNA. Translation: AAL58872.1 .
    AF454944 mRNA. Translation: AAL58873.1 .
    AK017487 mRNA. Translation: BAB30768.1 .
    AK029532 mRNA. Translation: BAC26500.2 .
    AK029747 mRNA. Translation: BAC26596.1 .
    AK049516 mRNA. Translation: BAC33788.1 .
    AK050488 mRNA. Translation: BAC34285.1 .
    AK157813 mRNA. Translation: BAE34207.1 .
    CT571273 , AC109627 Genomic DNA. Translation: CAX15928.1 .
    CT571273 , AC109627 Genomic DNA. Translation: CAX15929.1 .
    CT571273 , AC109627 Genomic DNA. Translation: CAX15930.1 .
    CT571273 , AC109627 Genomic DNA. Translation: CAX15931.1 .
    BC057869 mRNA. Translation: AAH57869.1 .
    BC066821 mRNA. Translation: AAH66821.1 .
    AF276950 mRNA. Translation: AAL68986.1 .
    AF276951 mRNA. Translation: AAL68987.1 . Sequence problems.
    AF276952 mRNA. Translation: AAL68988.1 . Different initiation.
    CCDSi CCDS37354.1. [Q8VBW5-1 ]
    RefSeqi NP_081720.2. NM_027444.3. [Q8VBW5-1 ]
    XP_006522621.1. XM_006522558.1. [Q8VBW5-1 ]
    XP_006522622.1. XM_006522559.1. [Q8VBW5-1 ]
    XP_006522625.1. XM_006522562.1. [Q8VBW5-3 ]
    XP_006522626.1. XM_006522563.1. [Q8VBW5-3 ]
    UniGenei Mm.28940.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1WZ6 NMR - A 80-148 [» ]
    ProteinModelPortali Q8VBW5.
    SMRi Q8VBW5. Positions 80-153.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q8VBW5.

    Proteomic databases

    PRIDEi Q8VBW5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000066037 ; ENSMUSP00000066384 ; ENSMUSG00000022641 . [Q8VBW5-2 ]
    ENSMUST00000089399 ; ENSMUSP00000086821 ; ENSMUSG00000022641 . [Q8VBW5-4 ]
    ENSMUST00000089404 ; ENSMUSP00000086826 ; ENSMUSG00000022641 . [Q8VBW5-3 ]
    ENSMUST00000114488 ; ENSMUSP00000110132 ; ENSMUSG00000022641 . [Q8VBW5-1 ]
    ENSMUST00000138166 ; ENSMUSP00000119238 ; ENSMUSG00000022641 . [Q8VBW5-1 ]
    GeneIDi 70508.
    KEGGi mmu:70508.
    UCSCi uc007zkn.2. mouse. [Q8VBW5-1 ]
    uc007zkp.2. mouse. [Q8VBW5-3 ]
    uc007zkq.2. mouse. [Q8VBW5-2 ]
    uc007zkr.2. mouse. [Q8VBW5-4 ]

    Organism-specific databases

    CTDi 56987.
    MGIi MGI:1917758. Bbx.

    Phylogenomic databases

    eggNOGi NOG305473.
    GeneTreei ENSGT00530000063757.
    HOVERGENi HBG079777.
    InParanoidi Q8VBW5.
    OMAi FQFAEIS.
    OrthoDBi EOG77DJ8X.
    PhylomeDBi Q8VBW5.
    TreeFami TF106402.

    Miscellaneous databases

    EvolutionaryTracei Q8VBW5.
    NextBioi 331763.
    PROi Q8VBW5.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8VBW5.
    Bgeei Q8VBW5.
    CleanExi MM_BBX.
    Genevestigatori Q8VBW5.

    Family and domain databases

    Gene3Di 1.10.30.10. 1 hit.
    InterProi IPR009071. HMG_box_dom.
    IPR019102. TF_HMG_box_BBX_DUF2028.
    [Graphical view ]
    Pfami PF09667. DUF2028. 1 hit.
    PF00505. HMG_box. 1 hit.
    [Graphical view ]
    SMARTi SM00398. HMG. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47095. SSF47095. 1 hit.
    PROSITEi PS50118. HMG_BOX_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "BBX is expressed in developing CNS and in neuronal tumours."
      Lee C.-J., Chan W.-I., Appleby V.J., Orme A.T., Scotting P.J.
      Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
      Strain: C57BL/6J.
      Tissue: Embryo, Pancreas and Testis.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS LEU-30 AND HIS-281.
      Strain: C3H/He and NMRI.
      Tissue: Mammary gland, Mammary tumor and Mesenchymal stem cell.
    5. "HBP2: a new mammalian protein that complements the fission yeast MBF transcription complex."
      Sanchez-Diaz A., Blanco M.A., Jones N., Moreno S.
      Curr. Genet. 40:110-118(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-454, FUNCTION.
      Strain: C57BL/6J.
      Tissue: Mammary gland.
    6. "The phagosomal proteome in interferon-gamma-activated macrophages."
      Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
      Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. "Solution structure of the HMG-box domain of murine bobby sox homolog."
      RIKEN structural genomics initiative (RSGI)
      Submitted (AUG-2005) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 80-148.

    Entry informationi

    Entry nameiBBX_MOUSE
    AccessioniPrimary (citable) accession number: Q8VBW5
    Secondary accession number(s): B8JK46
    , B8JK47, B8JK48, B8JK49, Q3TZK1, Q6NXY8, Q6PEU3, Q8BQJ7, Q8C7E0, Q8CDQ0, Q8CDV1, Q8VI48, Q8VI49, Q8VI50, Q9CS94
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 18, 2006
    Last sequence update: April 18, 2006
    Last modified: October 1, 2014
    This is version 91 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3