Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

5-hydroxytryptamine receptor 2B

Gene

htr2b

Organism
Tetraodon fluviatilis (Green pufferfish) (Chelonodon fluviatilis)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various ergot alkaloid derivatives and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and down-stream signaling cascades and promotes the release of Ca2+ ions from intracellular stores. Plays a role in the regulation of dopamine and 5-hydroxytryptamine release, 5-hydroxytryptamine uptake and in the regulation of extracellular dopamine and 5-hydroxytryptamine levels, and thereby affects neural activity (By similarity).By similarity

GO - Molecular functioni

  • Gq/11-coupled serotonin receptor activity Source: UniProtKB
  • neurotransmitter receptor activity Source: UniProtKB

GO - Biological processi

  • behavior Source: UniProtKB-KW
  • embryonic morphogenesis Source: UniProtKB
  • heart development Source: InterPro
  • regulation of behavior Source: InterPro
  • serotonin uptake Source: UniProtKB
  • smooth muscle contraction Source: InterPro
  • vasoconstriction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Keywords - Biological processi

Behavior

Names & Taxonomyi

Protein namesi
Recommended name:
5-hydroxytryptamine receptor 2B
Short name:
5-HT-2B
Short name:
5-HT2B
Alternative name(s):
Serotonin receptor 2B
Gene namesi
Name:htr2b
OrganismiTetraodon fluviatilis (Green pufferfish) (Chelonodon fluviatilis)
Taxonomic identifieri47145 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiActinopterygiiNeopterygiiTeleosteiNeoteleosteiAcanthomorphataEupercariaTetraodontiformesTetradontoideaTetraodontidaeTetraodon

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 2626ExtracellularBy similarityAdd
BLAST
Transmembranei27 – 4923Helical; Name=1By similarityAdd
BLAST
Topological domaini50 – 6011CytoplasmicBy similarityAdd
BLAST
Transmembranei61 – 8323Helical; Name=2By similarityAdd
BLAST
Topological domaini84 – 9916ExtracellularBy similarityAdd
BLAST
Transmembranei100 – 12122Helical; Name=3By similarityAdd
BLAST
Topological domaini122 – 14120CytoplasmicBy similarityAdd
BLAST
Transmembranei142 – 16221Helical; Name=4By similarityAdd
BLAST
Topological domaini163 – 19129ExtracellularBy similarityAdd
BLAST
Transmembranei192 – 21423Helical; Name=5By similarityAdd
BLAST
Topological domaini215 – 30894CytoplasmicBy similarityAdd
BLAST
Transmembranei309 – 32921Helical; Name=6By similarityAdd
BLAST
Topological domaini330 – 34415ExtracellularBy similarityAdd
BLAST
Transmembranei345 – 36622Helical; Name=7By similarityAdd
BLAST
Topological domaini367 – 471105CytoplasmicBy similarityAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Synapse, Synaptosome

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 4714715-hydroxytryptamine receptor 2BPRO_0000239461Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi12 – 121N-linked (GlcNAc...)Sequence analysis
Disulfide bondi98 ↔ 182PROSITE-ProRule annotation
Glycosylationi173 – 1731N-linked (GlcNAc...)Sequence analysis
Glycosylationi179 – 1791N-linked (GlcNAc...)Sequence analysis
Disulfide bondi334 ↔ 337PROSITE-ProRule annotation
Lipidationi381 – 3811S-palmitoyl cysteineSequence analysis

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Expressioni

Tissue specificityi

Detected in brain, heart and gut.1 Publication

Structurei

3D structure databases

ProteinModelPortaliQ8UUG8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni105 – 1106Agonist bindingBy similarity
Regioni321 – 3255Agonist bindingBy similarity

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi122 – 1243DRY motif; important for ligand-induced conformation changesBy similarity
Motifi360 – 3645NPxxY motif; important for ligand-induced conformation changes and signalingBy similarity
Motifi469 – 4713PDZ-bindingBy similarity

Domaini

Ligands are bound in a hydrophobic pocket formed by the transmembrane helices.By similarity

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

HOVERGENiHBG107487.

Family and domain databases

InterProiIPR000482. 5HT2B_rcpt.
IPR002231. 5HT_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PANTHERiPTHR24247:SF31. PTHR24247:SF31. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00651. 5HT2BRECEPTR.
PR01101. 5HTRECEPTOR.
PR00237. GPCRRHODOPSN.
SMARTiSM01381. 7TM_GPCR_Srsx. 1 hit.
[Graphical view]
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q8UUG8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFQAAVGPLQ TNISLPEETP GLELNWAALL IVMVIIPTIG GNILVILAVW
60 70 80 90 100
LEKKLQNATN FFLMSLAVAD LLVGLLVMPI ALITILYDSD WPLPEPLCPI
110 120 130 140 150
WLFLDVLFST ASIMHLCAIS LDRYIAIKKP IQHSQYKSRA KVMLKIALVW
160 170 180 190 200
LISICIAIPI PIKGLRNYPH PNNITFTSNH TCVLKTDTFQ EFIIFGSLVA
210 220 230 240 250
FFIPLTIMMI IYFLTVRVLR KKVYLLRSKV TQRFSYPIIS TVFQREQAAN
260 270 280 290 300
PPQPEQPDST GNSLARIQEK TDTDGMSSPT GDEKSFRRLS TMGKKSMQTL
310 320 330 340 350
TNEQRASKVL GIVFLLFVVM WCPFFITNIT SALCGPCDAN IIGRLMEIFS
360 370 380 390 400
WVGYVSSGIN PLVYTLFNKT FRQAFTRYIT CNYRNFASKE QGRSFRASTV
410 420 430 440 450
DRMLTHISPR SSVAENAKLF TKQEIKNETT DYRSPLGCLQ PSAQTSTGVV
460 470
LDKILLTHTE NCKQEERVSC V
Length:471
Mass (Da):53,057
Last modified:March 1, 2002 - v1
Checksum:i60DC34CA971E18CB
GO
Isoform 21 Publication (identifier: Q8UUG8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-155: DSDWPLPEPLCPIWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQHSQYKSRAKVMLKIALVWLISIC → G

Show »
Length:404
Mass (Da):45,291
Checksum:i6EF54F07CCA9806D
GO
Isoform 31 Publication (identifier: Q8UUG8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-177: WLISICIAIPIPIKGLRNYPHPNNITFT → LQSQFQLRGLGTTLILTTSPLPVTIHAC
     178-471: Missing.

Show »
Length:177
Mass (Da):19,514
Checksum:iA14B7F5A32ECB892
GO
Isoform 41 Publication (identifier: Q8UUG8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     32-471: Missing.

Show »
Length:31
Mass (Da):3,338
Checksum:i8E9C24A4DC585390
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti5 – 51A → V in CAC86249 (PubMed:11744166).Curated
Sequence conflicti20 – 201P → L in CAC86249 (PubMed:11744166).Curated
Sequence conflicti213 – 2131F → L in CAC86247 (PubMed:11744166).Curated
Sequence conflicti220 – 2201R → H in CAC86247 (PubMed:11744166).Curated
Sequence conflicti242 – 2421V → G in CAC86247 (PubMed:11744166).Curated
Sequence conflicti254 – 2541P → S in CAC86247 (PubMed:11744166).Curated
Sequence conflicti261 – 2611G → D in CAC86247 (PubMed:11744166).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei32 – 471440Missing in isoform 4. 1 PublicationVSP_052050Add
BLAST
Alternative sequencei88 – 15568DSDWP…LISIC → G in isoform 2. 1 PublicationVSP_052051Add
BLAST
Alternative sequencei150 – 17728WLISI…NITFT → LQSQFQLRGLGTTLILTTSP LPVTIHAC in isoform 3. 1 PublicationVSP_052052Add
BLAST
Alternative sequencei178 – 471294Missing in isoform 3. 1 PublicationVSP_052053Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ315179 Genomic DNA. Translation: CAC86245.1.
AJ315180 mRNA. Translation: CAC86246.1.
AJ315181 mRNA. Translation: CAC86247.1.
AJ315182 mRNA. Translation: CAC86248.1.
AJ315183 mRNA. Translation: CAC86249.1.
AJ320211 mRNA. Translation: CAC85962.1.
AJ320212 mRNA. Translation: CAC85912.1.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ315179 Genomic DNA. Translation: CAC86245.1.
AJ315180 mRNA. Translation: CAC86246.1.
AJ315181 mRNA. Translation: CAC86247.1.
AJ315182 mRNA. Translation: CAC86248.1.
AJ315183 mRNA. Translation: CAC86249.1.
AJ320211 mRNA. Translation: CAC85962.1.
AJ320212 mRNA. Translation: CAC85912.1.

3D structure databases

ProteinModelPortaliQ8UUG8.
ModBaseiSearch...
MobiDBiSearch...

Protein family/group databases

GPCRDBiSearch...

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Phylogenomic databases

HOVERGENiHBG107487.

Family and domain databases

InterProiIPR000482. 5HT2B_rcpt.
IPR002231. 5HT_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PANTHERiPTHR24247:SF31. PTHR24247:SF31. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00651. 5HT2BRECEPTR.
PR01101. 5HTRECEPTOR.
PR00237. GPCRRHODOPSN.
SMARTiSM01381. 7TM_GPCR_Srsx. 1 hit.
[Graphical view]
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry namei5HT2B_TETFL
AccessioniPrimary (citable) accession number: Q8UUG8
Secondary accession number(s): Q8UUP7
, Q8UUP8, Q8UUP9, Q8UUQ0, Q8UUQ1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: March 1, 2002
Last modified: July 6, 2016
This is version 65 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.