Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8TF72

- SHRM3_HUMAN

UniProt

Q8TF72 - SHRM3_HUMAN

Protein

Protein Shroom3

Gene

SHROOM3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 94 (01 Oct 2014)
      Sequence version 2 (13 Jul 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Controls cell shape changes in the neuroepithelium during neural tube closure. Induces apical constriction in epithelial cells by promoting the apical accumulation of F-actin and myosin II, and probably by bundling stress fibers. Induces apicobasal cell elongation by redistributing gamma-tubulin and directing the assembly of robust apicobasal microtubule arrays By similarity.By similarity

    GO - Biological processi

    1. actin cytoskeleton organization Source: Ensembl
    2. apical protein localization Source: HGNC
    3. cell morphogenesis Source: HGNC
    4. cellular pigment accumulation Source: HGNC
    5. columnar/cuboidal epithelial cell development Source: Ensembl
    6. neural tube closure Source: Ensembl
    7. pattern specification process Source: HGNC
    8. regulation of cell shape Source: UniProtKB-KW

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Cell shape

    Keywords - Ligandi

    Actin-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein Shroom3
    Alternative name(s):
    Shroom-related protein
    Short name:
    hShrmL
    Gene namesi
    Name:SHROOM3
    Synonyms:KIAA1481, SHRML
    ORF Names:MSTP013
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:30422. SHROOM3.

    Subcellular locationi

    Cell junctionadherens junction By similarity. Cytoplasmcytoskeleton By similarity
    Note: Colocalizes with F-actin in stress fibers and adherens junctions.By similarity

    GO - Cellular componenti

    1. adherens junction Source: HGNC
    2. apical junction complex Source: UniProtKB
    3. apical plasma membrane Source: HGNC
    4. cytoplasm Source: UniProtKB-KW
    5. cytoskeleton Source: HGNC
    6. microtubule Source: UniProtKB-KW

    Keywords - Cellular componenti

    Cell junction, Cytoplasm, Cytoskeleton, Microtubule

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA147357295.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 19961996Protein Shroom3PRO_0000286066Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei439 – 4391Phosphoserine1 Publication
    Modified residuei443 – 4431Phosphoserine1 Publication
    Modified residuei910 – 9101Phosphoserine4 Publications
    Modified residuei913 – 9131Phosphoserine2 Publications
    Modified residuei970 – 9701Phosphoserine1 Publication
    Modified residuei1221 – 12211Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ8TF72.
    PaxDbiQ8TF72.
    PRIDEiQ8TF72.

    PTM databases

    PhosphoSiteiQ8TF72.

    Expressioni

    Gene expression databases

    BgeeiQ8TF72.
    CleanExiHS_SHROOM3.
    GenevestigatoriQ8TF72.

    Organism-specific databases

    HPAiHPA047784.

    Interactioni

    Subunit structurei

    Interacts with F-actin.By similarity

    Protein-protein interaction databases

    BioGridi121665. 5 interactions.
    IntActiQ8TF72. 6 interactions.
    MINTiMINT-2812419.
    STRINGi9606.ENSP00000296043.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8TF72.
    SMRiQ8TF72. Positions 25-108, 1779-1955.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini25 – 11086PDZPROSITE-ProRule annotationAdd
    BLAST
    Domaini928 – 1030103ASD1PROSITE-ProRule annotationAdd
    BLAST
    Domaini1669 – 1957289ASD2PROSITE-ProRule annotationAdd
    BLAST

    Domaini

    The ASD1 domain mediates F-actin binding.By similarity
    The ASD2 domain is required for apical constriction induction.By similarity

    Sequence similaritiesi

    Belongs to the shroom family.Curated
    Contains 1 ASD1 domain.PROSITE-ProRule annotation
    Contains 1 ASD2 domain.PROSITE-ProRule annotation
    Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG72784.
    HOGENOMiHOG000169233.
    HOVERGENiHBG108489.
    InParanoidiQ8TF72.
    OMAiHTPRERH.
    OrthoDBiEOG7QZG8T.
    PhylomeDBiQ8TF72.
    TreeFamiTF333370.

    Family and domain databases

    Gene3Di2.30.42.10. 1 hit.
    InterProiIPR014800. ASD1.
    IPR014799. ASD2.
    IPR001478. PDZ.
    IPR027685. Shroom_fam.
    [Graphical view]
    PANTHERiPTHR15012. PTHR15012. 1 hit.
    PfamiPF08688. ASD1. 1 hit.
    PF08687. ASD2. 1 hit.
    PF00595. PDZ. 1 hit.
    [Graphical view]
    SMARTiSM00228. PDZ. 1 hit.
    [Graphical view]
    SUPFAMiSSF50156. SSF50156. 1 hit.
    PROSITEiPS51306. ASD1. 1 hit.
    PS51307. ASD2. 1 hit.
    PS50106. PDZ. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8TF72-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MMRTTEDFHK PSATLNSNTA TKGRYIYLEA FLEGGAPWGF TLKGGLEHGE     50
    PLIISKVEEG GKADTLSSKL QAGDEVVHIN EVTLSSSRKE AVSLVKGSYK 100
    TLRLVVRRDV CTDPGHADTG ASNFVSPEHL TSGPQHRKAA WSGGVKLRLK 150
    HRRSEPAGRP HSWHTTKSGE KQPDASMMQI SQGMIGPPWH QSYHSSSSTS 200
    DLSNYDHAYL RRSPDQCSSQ GSMESLEPSG AYPPCHLSPA KSTGSIDQLS 250
    HFHNKRDSAY SSFSTSSSIL EYPHPGISGR ERSGSMDNTS ARGGLLEGMR 300
    QADIRYVKTV YDTRRGVSAE YEVNSSALLL QGREARASAN GQGYDKWSNI 350
    PRGKGVPPPS WSQQCPSSLE TATDNLPPKV GAPLPPARSD SYAAFRHRER 400
    PSSWSSLDQK RLCRPQANSL GSLKSPFIEE QLHTVLEKSP ENSPPVKPKH 450
    NYTQKAQPGQ PLLPTSIYPV PSLEPHFAQV PQPSVSSNGM LYPALAKESG 500
    YIAPQGACNK MATIDENGNQ NGSGRPGFAF CQPLEHDLLS PVEKKPEATA 550
    KYVPSKVHFC SVPENEEDAS LKRHLTPPQG NSPHSNERKS THSNKPSSHP 600
    HSLKCPQAQA WQAGEDKRSS RLSEPWEGDF QEDHNANLWR RLEREGLGQS 650
    LSGNFGKTKS AFSSLQNIPE SLRRHSSLEL GRGTQEGYPG GRPTCAVNTK 700
    AEDPGRKAAP DLGSHLDRQV SYPRPEGRTG ASASFNSTDP SPEEPPAPSH 750
    PHTSSLGRRG PGPGSASALQ GFQYGKPHCS VLEKVSKFEQ REQGSQRPSV 800
    GGSGFGHNYR PHRTVSTSST SGNDFEETKA HIRFSESAEP LGNGEQHFKN 850
    GELKLEEASR QPCGQQLSGG ASDSGRGPQR PDARLLRSQS TFQLSSEPER 900
    EPEWRDRPGS PESPLLDAPF SRAYRNSIKD AQSRVLGATS FRRRDLELGA 950
    PVASRSWRPR PSSAHVGLRS PEASASASPH TPRERHSVTP AEGDLARPVP 1000
    PAARRGARRR LTPEQKKRSY SEPEKMNEVG IVEEAEPAPL GPQRNGMRFP 1050
    ESSVADRRRL FERDGKACST LSLSGPELKQ FQQSALADYI QRKTGKRPTS 1100
    AAGCSLQEPG PLRERAQSAY LQPGPAALEG SGLASASSLS SLREPSLQPR 1150
    REATLLPATV AETQQAPRDR SSSFAGGRRL GERRRGDLLS GANGGTRGTQ 1200
    RGDETPREPS SWGARAGKSM SAEDLLERSD VLAGPVHVRS RSSPATADKR 1250
    QDVLLGQDSG FGLVKDPCYL AGPGSRSLSC SERGQEEMLP LFHHLTPRWG 1300
    GSGCKAIGDS SVPSECPGTL DHQRQASRTP CPRPPLAGTQ GLVTDTRAAP 1350
    LTPIGTPLPS AIPSGYCSQD GQTGRQPLPP YTPAMMHRSN GHTLTQPPGP 1400
    RGCEGDGPEH GVEEGTRKRV SLPQWPPPSR AKWAHAARED SLPEESSAPD 1450
    FANLKHYQKQ QSLPSLCSTS DPDTPLGAPS TPGRISLRIS ESVLRDSPPP 1500
    HEDYEDEVFV RDPHPKATSS PTFEPLPPPP PPPPSQETPV YSMDDFPPPP 1550
    PHTVCEAQLD SEDPEGPRPS FNKLSKVTIA RERHMPGAAH VVGSQTLASR 1600
    LQTSIKGSEA ESTPPSFMSV HAQLAGSLGG QPAPIQTQSL SHDPVSGTQG 1650
    LEKKVSPDPQ KSSEDIRTEA LAKEIVHQDK SLADILDPDS RLKTTMDLME 1700
    GLFPRDVNLL KENSVKRKAI QRTVSSSGCE GKRNEDKEAV SMLVNCPAYY 1750
    SVSAPKAELL NKIKEMPAEV NEEEEQADVN EKKAELIGSL THKLETLQEA 1800
    KGSLLTDIKL NNALGEEVEA LISELCKPNE FDKYRMFIGD LDKVVNLLLS 1850
    LSGRLARVEN VLSGLGEDAS NEERSSLYEK RKILAGQHED ARELKENLDR 1900
    RERVVLGILA NYLSEEQLQD YQHFVKMKST LLIEQRKLDD KIKLGQEQVK 1950
    CLLESLPSDF IPKAGALALP PNLTSEPIPA GGCTFSGIFP TLTSPL 1996
    Length:1,996
    Mass (Da):216,857
    Last modified:July 13, 2010 - v2
    Checksum:i735F6CD20FF64BC6
    GO
    Isoform 2 (identifier: Q8TF72-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-125: Missing.
         126-153: SPEHLTSGPQHRKAAWSGGVKLRLKHRR → MAFYSTPEYDIQLARGLLSGMFLFATRR
         277-311: ISGRERSGSMDNTSARGGLLEGMRQADIRYVKTVY → KRVKTRDLPGSQSPGRAISRKTTMPTSGGGWREKA
         312-1996: Missing.

    Show »
    Length:186
    Mass (Da):20,457
    Checksum:i5A9561BA6C6EF074
    GO

    Sequence cautioni

    The sequence AAQ13515.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence BAB84689.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti153 – 1531R → S in BAB84689. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti147 – 1471L → H.
    Corresponds to variant rs3821979 [ dbSNP | Ensembl ].
    VAR_032062
    Natural varianti279 – 2791G → A.1 Publication
    Corresponds to variant rs344140 [ dbSNP | Ensembl ].
    VAR_032063
    Natural varianti469 – 4691P → A.1 Publication
    Corresponds to variant rs344141 [ dbSNP | Ensembl ].
    VAR_032064
    Natural varianti1290 – 12901P → L.2 Publications
    Corresponds to variant rs3733242 [ dbSNP | Ensembl ].
    VAR_032065

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 125125Missing in isoform 2. 1 PublicationVSP_024965Add
    BLAST
    Alternative sequencei126 – 15328SPEHL…LKHRR → MAFYSTPEYDIQLARGLLSG MFLFATRR in isoform 2. 1 PublicationVSP_024966Add
    BLAST
    Alternative sequencei277 – 31135ISGRE…VKTVY → KRVKTRDLPGSQSPGRAISR KTTMPTSGGGWREKA in isoform 2. 1 PublicationVSP_024967Add
    BLAST
    Alternative sequencei312 – 19961685Missing in isoform 2. 1 PublicationVSP_024968Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB055660 mRNA. Translation: BAB84689.1. Different initiation.
    AK127929 mRNA. Translation: BAC87195.1.
    AC096743 Genomic DNA. No translation available.
    AC107051 Genomic DNA. No translation available.
    AC107072 Genomic DNA. No translation available.
    AC112249 Genomic DNA. No translation available.
    AC121158 Genomic DNA. No translation available.
    AB040914 mRNA. Translation: BAA96005.1.
    BC007291 mRNA. Translation: AAH07291.1.
    AF109367 mRNA. Translation: AAQ13515.1. Different initiation.
    CCDSiCCDS3579.2. [Q8TF72-1]
    RefSeqiNP_065910.3. NM_020859.3. [Q8TF72-1]
    XP_005263219.1. XM_005263162.2. [Q8TF72-1]
    UniGeneiHs.702168.

    Genome annotation databases

    EnsembliENST00000296043; ENSP00000296043; ENSG00000138771. [Q8TF72-1]
    GeneIDi57619.
    KEGGihsa:57619.
    UCSCiuc003hkf.1. human. [Q8TF72-1]

    Polymorphism databases

    DMDMi300669666.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB055660 mRNA. Translation: BAB84689.1 . Different initiation.
    AK127929 mRNA. Translation: BAC87195.1 .
    AC096743 Genomic DNA. No translation available.
    AC107051 Genomic DNA. No translation available.
    AC107072 Genomic DNA. No translation available.
    AC112249 Genomic DNA. No translation available.
    AC121158 Genomic DNA. No translation available.
    AB040914 mRNA. Translation: BAA96005.1 .
    BC007291 mRNA. Translation: AAH07291.1 .
    AF109367 mRNA. Translation: AAQ13515.1 . Different initiation.
    CCDSi CCDS3579.2. [Q8TF72-1 ]
    RefSeqi NP_065910.3. NM_020859.3. [Q8TF72-1 ]
    XP_005263219.1. XM_005263162.2. [Q8TF72-1 ]
    UniGenei Hs.702168.

    3D structure databases

    ProteinModelPortali Q8TF72.
    SMRi Q8TF72. Positions 25-108, 1779-1955.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121665. 5 interactions.
    IntActi Q8TF72. 6 interactions.
    MINTi MINT-2812419.
    STRINGi 9606.ENSP00000296043.

    PTM databases

    PhosphoSitei Q8TF72.

    Polymorphism databases

    DMDMi 300669666.

    Proteomic databases

    MaxQBi Q8TF72.
    PaxDbi Q8TF72.
    PRIDEi Q8TF72.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000296043 ; ENSP00000296043 ; ENSG00000138771 . [Q8TF72-1 ]
    GeneIDi 57619.
    KEGGi hsa:57619.
    UCSCi uc003hkf.1. human. [Q8TF72-1 ]

    Organism-specific databases

    CTDi 57619.
    GeneCardsi GC04P077356.
    H-InvDB HIX0004309.
    HIX0163999.
    HGNCi HGNC:30422. SHROOM3.
    HPAi HPA047784.
    MIMi 604570. gene.
    neXtProti NX_Q8TF72.
    PharmGKBi PA147357295.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG72784.
    HOGENOMi HOG000169233.
    HOVERGENi HBG108489.
    InParanoidi Q8TF72.
    OMAi HTPRERH.
    OrthoDBi EOG7QZG8T.
    PhylomeDBi Q8TF72.
    TreeFami TF333370.

    Miscellaneous databases

    ChiTaRSi SHROOM3. human.
    GeneWikii SHROOM3.
    GenomeRNAii 57619.
    NextBioi 64290.
    PROi Q8TF72.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8TF72.
    CleanExi HS_SHROOM3.
    Genevestigatori Q8TF72.

    Family and domain databases

    Gene3Di 2.30.42.10. 1 hit.
    InterProi IPR014800. ASD1.
    IPR014799. ASD2.
    IPR001478. PDZ.
    IPR027685. Shroom_fam.
    [Graphical view ]
    PANTHERi PTHR15012. PTHR15012. 1 hit.
    Pfami PF08688. ASD1. 1 hit.
    PF08687. ASD2. 1 hit.
    PF00595. PDZ. 1 hit.
    [Graphical view ]
    SMARTi SM00228. PDZ. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50156. SSF50156. 1 hit.
    PROSITEi PS51306. ASD1. 1 hit.
    PS51307. ASD2. 1 hit.
    PS50106. PDZ. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning of FKBP12-associated protein."
      Koide M., Iio A., Obata K., Inagaki M., Yokota M., Ono T., Tuan R.S.
      Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ALA-279; ALA-469 AND LEU-1290.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Spleen.
    3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
      DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 617-1996 (ISOFORM 1), VARIANT LEU-1290.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1230-1996 (ISOFORM 1).
      Tissue: Colon.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1799-1996 (ISOFORM 1).
      Tissue: Aorta.
    7. Cited for: NOMENCLATURE.
    8. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
      Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
      J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-910 AND SER-913, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-439; SER-443; SER-910; SER-913 AND SER-1221, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    10. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-910, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-910 AND SER-970, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiSHRM3_HUMAN
    AccessioniPrimary (citable) accession number: Q8TF72
    Secondary accession number(s): Q5QTQ3
    , Q6ZRW3, Q96IR9, Q9P247
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 1, 2007
    Last sequence update: July 13, 2010
    Last modified: October 1, 2014
    This is version 94 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Caution

    It is uncertain whether Met-1 or Met-2 is the initiator. Met-2 is more conserved than Met-1 among the orthologs.Curated

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3