SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8TF72

- SHRM3_HUMAN

UniProt

Q8TF72 - SHRM3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Protein Shroom3
Gene
SHROOM3, KIAA1481, SHRML, MSTP013
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Controls cell shape changes in the neuroepithelium during neural tube closure. Induces apical constriction in epithelial cells by promoting the apical accumulation of F-actin and myosin II, and probably by bundling stress fibers. Induces apicobasal cell elongation by redistributing gamma-tubulin and directing the assembly of robust apicobasal microtubule arrays By similarity.

GO - Biological processi

  1. actin cytoskeleton organization Source: Ensembl
  2. apical protein localization Source: HGNC
  3. cell morphogenesis Source: HGNC
  4. cellular pigment accumulation Source: HGNC
  5. columnar/cuboidal epithelial cell development Source: Ensembl
  6. neural tube closure Source: Ensembl
  7. pattern specification process Source: HGNC
  8. regulation of cell shape Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Cell shape

Keywords - Ligandi

Actin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protein Shroom3
Alternative name(s):
Shroom-related protein
Short name:
hShrmL
Gene namesi
Name:SHROOM3
Synonyms:KIAA1481, SHRML
ORF Names:MSTP013
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:30422. SHROOM3.

Subcellular locationi

Cell junctionadherens junction By similarity. Cytoplasmcytoskeleton By similarity
Note: Colocalizes with F-actin in stress fibers and adherens junctions By similarity.

GO - Cellular componenti

  1. adherens junction Source: HGNC
  2. apical junction complex Source: UniProtKB
  3. apical plasma membrane Source: HGNC
  4. cytoplasm Source: UniProtKB-KW
  5. cytoskeleton Source: HGNC
  6. microtubule Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA147357295.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 19961996Protein Shroom3
PRO_0000286066Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei439 – 4391Phosphoserine1 Publication
Modified residuei443 – 4431Phosphoserine1 Publication
Modified residuei910 – 9101Phosphoserine4 Publications
Modified residuei913 – 9131Phosphoserine2 Publications
Modified residuei970 – 9701Phosphoserine1 Publication
Modified residuei1221 – 12211Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8TF72.
PaxDbiQ8TF72.
PRIDEiQ8TF72.

PTM databases

PhosphoSiteiQ8TF72.

Expressioni

Gene expression databases

BgeeiQ8TF72.
CleanExiHS_SHROOM3.
GenevestigatoriQ8TF72.

Organism-specific databases

HPAiHPA047784.

Interactioni

Subunit structurei

Interacts with F-actin By similarity.

Protein-protein interaction databases

BioGridi121665. 5 interactions.
IntActiQ8TF72. 6 interactions.
MINTiMINT-2812419.
STRINGi9606.ENSP00000296043.

Structurei

3D structure databases

ProteinModelPortaliQ8TF72.
SMRiQ8TF72. Positions 25-108, 1779-1955.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini25 – 11086PDZ
Add
BLAST
Domaini928 – 1030103ASD1
Add
BLAST
Domaini1669 – 1957289ASD2
Add
BLAST

Domaini

The ASD1 domain mediates F-actin binding By similarity.
The ASD2 domain is required for apical constriction induction By similarity.

Sequence similaritiesi

Belongs to the shroom family.
Contains 1 ASD1 domain.
Contains 1 ASD2 domain.
Contains 1 PDZ (DHR) domain.

Phylogenomic databases

eggNOGiNOG72784.
HOGENOMiHOG000169233.
HOVERGENiHBG108489.
InParanoidiQ8TF72.
OMAiHTPRERH.
OrthoDBiEOG7QZG8T.
PhylomeDBiQ8TF72.
TreeFamiTF333370.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
InterProiIPR014800. ASD1.
IPR014799. ASD2.
IPR001478. PDZ.
IPR027685. Shroom_fam.
[Graphical view]
PANTHERiPTHR15012. PTHR15012. 1 hit.
PfamiPF08688. ASD1. 1 hit.
PF08687. ASD2. 1 hit.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS51306. ASD1. 1 hit.
PS51307. ASD2. 1 hit.
PS50106. PDZ. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8TF72-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MMRTTEDFHK PSATLNSNTA TKGRYIYLEA FLEGGAPWGF TLKGGLEHGE     50
PLIISKVEEG GKADTLSSKL QAGDEVVHIN EVTLSSSRKE AVSLVKGSYK 100
TLRLVVRRDV CTDPGHADTG ASNFVSPEHL TSGPQHRKAA WSGGVKLRLK 150
HRRSEPAGRP HSWHTTKSGE KQPDASMMQI SQGMIGPPWH QSYHSSSSTS 200
DLSNYDHAYL RRSPDQCSSQ GSMESLEPSG AYPPCHLSPA KSTGSIDQLS 250
HFHNKRDSAY SSFSTSSSIL EYPHPGISGR ERSGSMDNTS ARGGLLEGMR 300
QADIRYVKTV YDTRRGVSAE YEVNSSALLL QGREARASAN GQGYDKWSNI 350
PRGKGVPPPS WSQQCPSSLE TATDNLPPKV GAPLPPARSD SYAAFRHRER 400
PSSWSSLDQK RLCRPQANSL GSLKSPFIEE QLHTVLEKSP ENSPPVKPKH 450
NYTQKAQPGQ PLLPTSIYPV PSLEPHFAQV PQPSVSSNGM LYPALAKESG 500
YIAPQGACNK MATIDENGNQ NGSGRPGFAF CQPLEHDLLS PVEKKPEATA 550
KYVPSKVHFC SVPENEEDAS LKRHLTPPQG NSPHSNERKS THSNKPSSHP 600
HSLKCPQAQA WQAGEDKRSS RLSEPWEGDF QEDHNANLWR RLEREGLGQS 650
LSGNFGKTKS AFSSLQNIPE SLRRHSSLEL GRGTQEGYPG GRPTCAVNTK 700
AEDPGRKAAP DLGSHLDRQV SYPRPEGRTG ASASFNSTDP SPEEPPAPSH 750
PHTSSLGRRG PGPGSASALQ GFQYGKPHCS VLEKVSKFEQ REQGSQRPSV 800
GGSGFGHNYR PHRTVSTSST SGNDFEETKA HIRFSESAEP LGNGEQHFKN 850
GELKLEEASR QPCGQQLSGG ASDSGRGPQR PDARLLRSQS TFQLSSEPER 900
EPEWRDRPGS PESPLLDAPF SRAYRNSIKD AQSRVLGATS FRRRDLELGA 950
PVASRSWRPR PSSAHVGLRS PEASASASPH TPRERHSVTP AEGDLARPVP 1000
PAARRGARRR LTPEQKKRSY SEPEKMNEVG IVEEAEPAPL GPQRNGMRFP 1050
ESSVADRRRL FERDGKACST LSLSGPELKQ FQQSALADYI QRKTGKRPTS 1100
AAGCSLQEPG PLRERAQSAY LQPGPAALEG SGLASASSLS SLREPSLQPR 1150
REATLLPATV AETQQAPRDR SSSFAGGRRL GERRRGDLLS GANGGTRGTQ 1200
RGDETPREPS SWGARAGKSM SAEDLLERSD VLAGPVHVRS RSSPATADKR 1250
QDVLLGQDSG FGLVKDPCYL AGPGSRSLSC SERGQEEMLP LFHHLTPRWG 1300
GSGCKAIGDS SVPSECPGTL DHQRQASRTP CPRPPLAGTQ GLVTDTRAAP 1350
LTPIGTPLPS AIPSGYCSQD GQTGRQPLPP YTPAMMHRSN GHTLTQPPGP 1400
RGCEGDGPEH GVEEGTRKRV SLPQWPPPSR AKWAHAARED SLPEESSAPD 1450
FANLKHYQKQ QSLPSLCSTS DPDTPLGAPS TPGRISLRIS ESVLRDSPPP 1500
HEDYEDEVFV RDPHPKATSS PTFEPLPPPP PPPPSQETPV YSMDDFPPPP 1550
PHTVCEAQLD SEDPEGPRPS FNKLSKVTIA RERHMPGAAH VVGSQTLASR 1600
LQTSIKGSEA ESTPPSFMSV HAQLAGSLGG QPAPIQTQSL SHDPVSGTQG 1650
LEKKVSPDPQ KSSEDIRTEA LAKEIVHQDK SLADILDPDS RLKTTMDLME 1700
GLFPRDVNLL KENSVKRKAI QRTVSSSGCE GKRNEDKEAV SMLVNCPAYY 1750
SVSAPKAELL NKIKEMPAEV NEEEEQADVN EKKAELIGSL THKLETLQEA 1800
KGSLLTDIKL NNALGEEVEA LISELCKPNE FDKYRMFIGD LDKVVNLLLS 1850
LSGRLARVEN VLSGLGEDAS NEERSSLYEK RKILAGQHED ARELKENLDR 1900
RERVVLGILA NYLSEEQLQD YQHFVKMKST LLIEQRKLDD KIKLGQEQVK 1950
CLLESLPSDF IPKAGALALP PNLTSEPIPA GGCTFSGIFP TLTSPL 1996
Length:1,996
Mass (Da):216,857
Last modified:July 13, 2010 - v2
Checksum:i735F6CD20FF64BC6
GO
Isoform 2 (identifier: Q8TF72-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-125: Missing.
     126-153: SPEHLTSGPQHRKAAWSGGVKLRLKHRR → MAFYSTPEYDIQLARGLLSGMFLFATRR
     277-311: ISGRERSGSMDNTSARGGLLEGMRQADIRYVKTVY → KRVKTRDLPGSQSPGRAISRKTTMPTSGGGWREKA
     312-1996: Missing.

Show »
Length:186
Mass (Da):20,457
Checksum:i5A9561BA6C6EF074
GO

Sequence cautioni

The sequence AAQ13515.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence BAB84689.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti147 – 1471L → H.
Corresponds to variant rs3821979 [ dbSNP | Ensembl ].
VAR_032062
Natural varianti279 – 2791G → A.1 Publication
Corresponds to variant rs344140 [ dbSNP | Ensembl ].
VAR_032063
Natural varianti469 – 4691P → A.1 Publication
Corresponds to variant rs344141 [ dbSNP | Ensembl ].
VAR_032064
Natural varianti1290 – 12901P → L.2 Publications
Corresponds to variant rs3733242 [ dbSNP | Ensembl ].
VAR_032065

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 125125Missing in isoform 2.
VSP_024965Add
BLAST
Alternative sequencei126 – 15328SPEHL…LKHRR → MAFYSTPEYDIQLARGLLSG MFLFATRR in isoform 2.
VSP_024966Add
BLAST
Alternative sequencei277 – 31135ISGRE…VKTVY → KRVKTRDLPGSQSPGRAISR KTTMPTSGGGWREKA in isoform 2.
VSP_024967Add
BLAST
Alternative sequencei312 – 19961685Missing in isoform 2.
VSP_024968Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti153 – 1531R → S in BAB84689. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB055660 mRNA. Translation: BAB84689.1. Different initiation.
AK127929 mRNA. Translation: BAC87195.1.
AC096743 Genomic DNA. No translation available.
AC107051 Genomic DNA. No translation available.
AC107072 Genomic DNA. No translation available.
AC112249 Genomic DNA. No translation available.
AC121158 Genomic DNA. No translation available.
AB040914 mRNA. Translation: BAA96005.1.
BC007291 mRNA. Translation: AAH07291.1.
AF109367 mRNA. Translation: AAQ13515.1. Different initiation.
CCDSiCCDS3579.2. [Q8TF72-1]
RefSeqiNP_065910.3. NM_020859.3. [Q8TF72-1]
XP_005263219.1. XM_005263162.2. [Q8TF72-1]
UniGeneiHs.702168.

Genome annotation databases

EnsembliENST00000296043; ENSP00000296043; ENSG00000138771. [Q8TF72-1]
GeneIDi57619.
KEGGihsa:57619.
UCSCiuc003hkf.1. human. [Q8TF72-1]

Polymorphism databases

DMDMi300669666.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB055660 mRNA. Translation: BAB84689.1 . Different initiation.
AK127929 mRNA. Translation: BAC87195.1 .
AC096743 Genomic DNA. No translation available.
AC107051 Genomic DNA. No translation available.
AC107072 Genomic DNA. No translation available.
AC112249 Genomic DNA. No translation available.
AC121158 Genomic DNA. No translation available.
AB040914 mRNA. Translation: BAA96005.1 .
BC007291 mRNA. Translation: AAH07291.1 .
AF109367 mRNA. Translation: AAQ13515.1 . Different initiation.
CCDSi CCDS3579.2. [Q8TF72-1 ]
RefSeqi NP_065910.3. NM_020859.3. [Q8TF72-1 ]
XP_005263219.1. XM_005263162.2. [Q8TF72-1 ]
UniGenei Hs.702168.

3D structure databases

ProteinModelPortali Q8TF72.
SMRi Q8TF72. Positions 25-108, 1779-1955.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121665. 5 interactions.
IntActi Q8TF72. 6 interactions.
MINTi MINT-2812419.
STRINGi 9606.ENSP00000296043.

PTM databases

PhosphoSitei Q8TF72.

Polymorphism databases

DMDMi 300669666.

Proteomic databases

MaxQBi Q8TF72.
PaxDbi Q8TF72.
PRIDEi Q8TF72.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000296043 ; ENSP00000296043 ; ENSG00000138771 . [Q8TF72-1 ]
GeneIDi 57619.
KEGGi hsa:57619.
UCSCi uc003hkf.1. human. [Q8TF72-1 ]

Organism-specific databases

CTDi 57619.
GeneCardsi GC04P077356.
H-InvDB HIX0004309.
HIX0163999.
HGNCi HGNC:30422. SHROOM3.
HPAi HPA047784.
MIMi 604570. gene.
neXtProti NX_Q8TF72.
PharmGKBi PA147357295.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG72784.
HOGENOMi HOG000169233.
HOVERGENi HBG108489.
InParanoidi Q8TF72.
OMAi HTPRERH.
OrthoDBi EOG7QZG8T.
PhylomeDBi Q8TF72.
TreeFami TF333370.

Miscellaneous databases

ChiTaRSi SHROOM3. human.
GeneWikii SHROOM3.
GenomeRNAii 57619.
NextBioi 64290.
PROi Q8TF72.
SOURCEi Search...

Gene expression databases

Bgeei Q8TF72.
CleanExi HS_SHROOM3.
Genevestigatori Q8TF72.

Family and domain databases

Gene3Di 2.30.42.10. 1 hit.
InterProi IPR014800. ASD1.
IPR014799. ASD2.
IPR001478. PDZ.
IPR027685. Shroom_fam.
[Graphical view ]
PANTHERi PTHR15012. PTHR15012. 1 hit.
Pfami PF08688. ASD1. 1 hit.
PF08687. ASD2. 1 hit.
PF00595. PDZ. 1 hit.
[Graphical view ]
SMARTi SM00228. PDZ. 1 hit.
[Graphical view ]
SUPFAMi SSF50156. SSF50156. 1 hit.
PROSITEi PS51306. ASD1. 1 hit.
PS51307. ASD2. 1 hit.
PS50106. PDZ. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning of FKBP12-associated protein."
    Koide M., Iio A., Obata K., Inagaki M., Yokota M., Ono T., Tuan R.S.
    Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ALA-279; ALA-469 AND LEU-1290.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Spleen.
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
    DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 617-1996 (ISOFORM 1), VARIANT LEU-1290.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1230-1996 (ISOFORM 1).
    Tissue: Colon.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1799-1996 (ISOFORM 1).
    Tissue: Aorta.
  7. Cited for: NOMENCLATURE.
  8. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-910 AND SER-913, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-439; SER-443; SER-910; SER-913 AND SER-1221, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-910, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-910 AND SER-970, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiSHRM3_HUMAN
AccessioniPrimary (citable) accession number: Q8TF72
Secondary accession number(s): Q5QTQ3
, Q6ZRW3, Q96IR9, Q9P247
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: July 13, 2010
Last modified: September 3, 2014
This is version 93 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

It is uncertain whether Met-1 or Met-2 is the initiator. Met-2 is more conserved than Met-1 among the orthologs.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi