Q8TF72 (SHRM3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 80.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein Shroom3 Alternative name(s): Shroom-related protein Short name=hShrmL | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1996 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Controls cell shape changes in the neuroepithelium during neural tube closure. Induces apical constriction in epithelial cells by promoting the apical accumulation of F-actin and myosin II, and probably by bundling stress fibers. Induces apicobasal cell elongation by redistributing gamma-tubulin and directing the assembly of robust apicobasal microtubule arrays By similarity. |
| Subunit structure | Interacts with F-actin By similarity. |
| Subcellular location | Cell junction › adherens junction By similarity. Cytoplasm › cytoskeleton By similarity. Note: Colocalizes with F-actin in stress fibers and adherens junctions By similarity. |
| Domain | The ASD1 domain mediates F-actin binding By similarity. The ASD2 domain is required for apical constriction induction By similarity. |
| Sequence similarities | Belongs to the shroom family. Contains 1 ASD1 domain. Contains 1 ASD2 domain. Contains 1 PDZ (DHR) domain. |
| Caution | It is uncertain whether Met-1 or Met-2 is the initiator. Met-2 is more conserved than Met-1 among the orthologs. |
| Sequence caution | The sequence AAQ13515.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAB84689.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8TF72-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8TF72-2) The sequence of this isoform differs from the canonical sequence as follows: 1-125: Missing. 126-153: SPEHLTSGPQHRKAAWSGGVKLRLKHRR → MAFYSTPEYDIQLARGLLSGMFLFATRR 277-311: ISGRERSGSMDNTSARGGLLEGMRQADIRYVKTVY → KRVKTRDLPGSQSPGRAISRKTTMPTSGGGWREKA 312-1996: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1996 | 1996 | Protein Shroom3 | PRO_0000286066 | |||||
Regions | |||||||||
| Domain | 25 – 110 | 86 | PDZ | ||||||
| Domain | 928 – 1030 | 103 | ASD1 | ||||||
| Domain | 1669 – 1957 | 289 | ASD2 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 439 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 443 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 890 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 910 | 1 | Phosphoserine Ref.8 Ref.9 Ref.10 Ref.11 | ||||||
| Modified residue | 913 | 1 | Phosphoserine Ref.8 Ref.9 | ||||||
| Modified residue | 970 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 1221 | 1 | Phosphoserine Ref.9 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 125 | 125 | Missing in isoform 2. | VSP_024965 | |||||
| Alternative sequence | 126 – 153 | 28 | SPEHL…LKHRR → MAFYSTPEYDIQLARGLLSG MFLFATRR in isoform 2. | VSP_024966 | |||||
| Alternative sequence | 277 – 311 | 35 | ISGRE…VKTVY → KRVKTRDLPGSQSPGRAISR KTTMPTSGGGWREKA in isoform 2. | VSP_024967 | |||||
| Alternative sequence | 312 – 1996 | 1685 | Missing in isoform 2. | VSP_024968 | |||||
| Natural variant | 147 | 1 | L → H. Corresponds to variant rs3821979 [ dbSNP | Ensembl ]. | VAR_032062 | |||||
| Natural variant | 279 | 1 | G → A. Ref.1 Corresponds to variant rs344140 [ dbSNP | Ensembl ]. | VAR_032063 | |||||
| Natural variant | 469 | 1 | P → A. Ref.1 Corresponds to variant rs344141 [ dbSNP | Ensembl ]. | VAR_032064 | |||||
| Natural variant | 1290 | 1 | P → L. Ref.1 Ref.4 Corresponds to variant rs3733242 [ dbSNP | Ensembl ]. | VAR_032065 | |||||
Experimental info | |||||||||
| Sequence conflict | 153 | 1 | R → S in BAB84689. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of FKBP12-associated protein." Koide M., Iio A., Obata K., Inagaki M., Yokota M., Ono T., Tuan R.S. Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ALA-279; ALA-469 AND LEU-1290. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Spleen. |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 617-1996 (ISOFORM 1), VARIANT LEU-1290. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1230-1996 (ISOFORM 1). Tissue: Colon. |
| [6] | Hui R.T., Liu Y.Q., Liu B., Zhao B., Meng X.M., Sheng H., Xu Y.Y., Wang X.Y., Ye J., Song L., Gao Y., Wei Y.J., Zhang C.L., Zhang J., Chai M.Q., Chen J.Z., Sun Y.H., Zhou X.L. Zhao M.S.Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1799-1996 (ISOFORM 1). Tissue: Aorta. |
| [7] | "A new standard nomenclature for proteins related to Apx and Shroom." Hagens O., Ballabio A., Kalscheuer V., Kraehenbuhl J.-P., Schiaffino M.V., Smith P., Staub O., Hildebrand J.D., Wallingford J.B. BMC Cell Biol. 7:18-18(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NOMENCLATURE. |
| [8] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-910 AND SER-913, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-439; SER-443; SER-910; SER-913 AND SER-1221, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-910, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-910 AND SER-970, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB055660 mRNA. Translation: BAB84689.1. Different initiation. AK127929 mRNA. Translation: BAC87195.1. AC096743 Genomic DNA. No translation available. AC107051 Genomic DNA. No translation available. AC107072 Genomic DNA. No translation available. AC112249 Genomic DNA. No translation available. AC121158 Genomic DNA. No translation available. AB040914 mRNA. Translation: BAA96005.1. BC007291 mRNA. Translation: AAH07291.1. AF109367 mRNA. Translation: AAQ13515.1. Different initiation. |
| IPI | IPI00152881. IPI01018742. |
| RefSeq | NP_065910.3. NM_020859.3. |
| UniGene | Hs.702168. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1VB7 based on UniProtKB Q8R1G6. |
| ProteinModelPortal | Q8TF72. |
| SMR | Q8TF72. Positions 25-108, 1779-1955. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8TF72. 2 interactions. |
| MINT | MINT-2812419. |
| STRING | 9606.ENSP00000296043. |
PTM databases | |
| PhosphoSite | Q8TF72. |
Polymorphism databases | |
| DMDM | 300669666. |
Proteomic databases | |
| PaxDb | Q8TF72. |
| PRIDE | Q8TF72. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000296043; ENSP00000296043; ENSG00000138771. |
| GeneID | 57619. |
| KEGG | hsa:57619. |
| UCSC | uc003hkf.1. human. |
Organism-specific databases | |
| CTD | 57619. |
| GeneCards | GC04P077356. |
| H-InvDB | HIX0004309. HIX0163999. |
| HGNC | HGNC:30422. SHROOM3. |
| HPA | HPA047784. |
| MIM | 604570. gene. |
| neXtProt | NX_Q8TF72. |
| PharmGKB | PA147357295. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG72784. |
| HOGENOM | HOG000169233. |
| HOVERGEN | HBG108489. |
| InParanoid | Q8TF72. |
| OMA | RNSIKDA. |
| OrthoDB | EOG44QT03. |
Gene expression databases | |
| Bgee | Q8TF72. |
| CleanEx | HS_SHROOM3. |
| Genevestigator | Q8TF72. |
Family and domain databases | |
| InterPro | IPR014800. ASD1. IPR014799. ASD2. IPR001478. PDZ. [Graphical view] |
| Pfam | PF08688. ASD1. 1 hit. PF08687. ASD2. 1 hit. PF00595. PDZ. 1 hit. [Graphical view] |
| SMART | SM00228. PDZ. 1 hit. [Graphical view] |
| SUPFAM | SSF50156. PDZ. 1 hit. |
| PROSITE | PS51306. ASD1. 1 hit. PS51307. ASD2. 1 hit. PS50106. PDZ. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SHROOM3. human. |
| GenomeRNAi | 57619. |
| NextBio | 64290. |
| SOURCE | Search... |
Entry information
| Entry name | SHRM3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8TF72 Secondary accession number(s): Q5QTQ3 Q9P247 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
