Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8TF72 (SHRM3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 92. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein Shroom3
Alternative name(s):
Shroom-related protein
Short name=hShrmL
Gene names
Name:SHROOM3
Synonyms:KIAA1481, SHRML
ORF Names:MSTP013
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1996 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Controls cell shape changes in the neuroepithelium during neural tube closure. Induces apical constriction in epithelial cells by promoting the apical accumulation of F-actin and myosin II, and probably by bundling stress fibers. Induces apicobasal cell elongation by redistributing gamma-tubulin and directing the assembly of robust apicobasal microtubule arrays By similarity.

Subunit structure

Interacts with F-actin By similarity.

Subcellular location

Cell junctionadherens junction By similarity. Cytoplasmcytoskeleton By similarity. Note: Colocalizes with F-actin in stress fibers and adherens junctions By similarity.

Domain

The ASD1 domain mediates F-actin binding By similarity.

The ASD2 domain is required for apical constriction induction By similarity.

Sequence similarities

Belongs to the shroom family.

Contains 1 ASD1 domain.

Contains 1 ASD2 domain.

Contains 1 PDZ (DHR) domain.

Caution

It is uncertain whether Met-1 or Met-2 is the initiator. Met-2 is more conserved than Met-1 among the orthologs.

Sequence caution

The sequence AAQ13515.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence BAB84689.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Ontologies

Keywords
   Biological processCell shape
   Cellular componentCell junction
Cytoplasm
Cytoskeleton
Microtubule
   Coding sequence diversityAlternative splicing
Polymorphism
   LigandActin-binding
   Molecular functionDevelopmental protein
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processactin cytoskeleton organization

Inferred from electronic annotation. Source: Ensembl

apical protein localization

Inferred from sequence or structural similarity. Source: HGNC

cell morphogenesis

Inferred from sequence or structural similarity. Source: HGNC

cellular pigment accumulation

Inferred from sequence or structural similarity. Source: HGNC

columnar/cuboidal epithelial cell development

Inferred from electronic annotation. Source: Ensembl

neural tube closure

Inferred from electronic annotation. Source: Ensembl

pattern specification process

Inferred from sequence or structural similarity. Source: HGNC

regulation of cell shape

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentadherens junction

Inferred from sequence or structural similarity. Source: HGNC

apical junction complex

Inferred from sequence or structural similarity. Source: UniProtKB

apical plasma membrane

Inferred from sequence or structural similarity. Source: HGNC

cytoplasm

Inferred from electronic annotation. Source: UniProtKB-KW

cytoskeleton

Inferred from sequence or structural similarity. Source: HGNC

microtubule

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8TF72-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8TF72-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-125: Missing.
     126-153: SPEHLTSGPQHRKAAWSGGVKLRLKHRR → MAFYSTPEYDIQLARGLLSGMFLFATRR
     277-311: ISGRERSGSMDNTSARGGLLEGMRQADIRYVKTVY → KRVKTRDLPGSQSPGRAISRKTTMPTSGGGWREKA
     312-1996: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 19961996Protein Shroom3
PRO_0000286066

Regions

Domain25 – 11086PDZ
Domain928 – 1030103ASD1
Domain1669 – 1957289ASD2

Amino acid modifications

Modified residue4391Phosphoserine Ref.9
Modified residue4431Phosphoserine Ref.9
Modified residue9101Phosphoserine Ref.8 Ref.9 Ref.11 Ref.12
Modified residue9131Phosphoserine Ref.8 Ref.9
Modified residue9701Phosphoserine Ref.12
Modified residue12211Phosphoserine Ref.9

Natural variations

Alternative sequence1 – 125125Missing in isoform 2.
VSP_024965
Alternative sequence126 – 15328SPEHL…LKHRR → MAFYSTPEYDIQLARGLLSG MFLFATRR in isoform 2.
VSP_024966
Alternative sequence277 – 31135ISGRE…VKTVY → KRVKTRDLPGSQSPGRAISR KTTMPTSGGGWREKA in isoform 2.
VSP_024967
Alternative sequence312 – 19961685Missing in isoform 2.
VSP_024968
Natural variant1471L → H.
Corresponds to variant rs3821979 [ dbSNP | Ensembl ].
VAR_032062
Natural variant2791G → A. Ref.1
Corresponds to variant rs344140 [ dbSNP | Ensembl ].
VAR_032063
Natural variant4691P → A. Ref.1
Corresponds to variant rs344141 [ dbSNP | Ensembl ].
VAR_032064
Natural variant12901P → L. Ref.1 Ref.4
Corresponds to variant rs3733242 [ dbSNP | Ensembl ].
VAR_032065

Experimental info

Sequence conflict1531R → S in BAB84689. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 13, 2010. Version 2.
Checksum: 735F6CD20FF64BC6

FASTA1,996216,857
        10         20         30         40         50         60 
MMRTTEDFHK PSATLNSNTA TKGRYIYLEA FLEGGAPWGF TLKGGLEHGE PLIISKVEEG 

        70         80         90        100        110        120 
GKADTLSSKL QAGDEVVHIN EVTLSSSRKE AVSLVKGSYK TLRLVVRRDV CTDPGHADTG 

       130        140        150        160        170        180 
ASNFVSPEHL TSGPQHRKAA WSGGVKLRLK HRRSEPAGRP HSWHTTKSGE KQPDASMMQI 

       190        200        210        220        230        240 
SQGMIGPPWH QSYHSSSSTS DLSNYDHAYL RRSPDQCSSQ GSMESLEPSG AYPPCHLSPA 

       250        260        270        280        290        300 
KSTGSIDQLS HFHNKRDSAY SSFSTSSSIL EYPHPGISGR ERSGSMDNTS ARGGLLEGMR 

       310        320        330        340        350        360 
QADIRYVKTV YDTRRGVSAE YEVNSSALLL QGREARASAN GQGYDKWSNI PRGKGVPPPS 

       370        380        390        400        410        420 
WSQQCPSSLE TATDNLPPKV GAPLPPARSD SYAAFRHRER PSSWSSLDQK RLCRPQANSL 

       430        440        450        460        470        480 
GSLKSPFIEE QLHTVLEKSP ENSPPVKPKH NYTQKAQPGQ PLLPTSIYPV PSLEPHFAQV 

       490        500        510        520        530        540 
PQPSVSSNGM LYPALAKESG YIAPQGACNK MATIDENGNQ NGSGRPGFAF CQPLEHDLLS 

       550        560        570        580        590        600 
PVEKKPEATA KYVPSKVHFC SVPENEEDAS LKRHLTPPQG NSPHSNERKS THSNKPSSHP 

       610        620        630        640        650        660 
HSLKCPQAQA WQAGEDKRSS RLSEPWEGDF QEDHNANLWR RLEREGLGQS LSGNFGKTKS 

       670        680        690        700        710        720 
AFSSLQNIPE SLRRHSSLEL GRGTQEGYPG GRPTCAVNTK AEDPGRKAAP DLGSHLDRQV 

       730        740        750        760        770        780 
SYPRPEGRTG ASASFNSTDP SPEEPPAPSH PHTSSLGRRG PGPGSASALQ GFQYGKPHCS 

       790        800        810        820        830        840 
VLEKVSKFEQ REQGSQRPSV GGSGFGHNYR PHRTVSTSST SGNDFEETKA HIRFSESAEP 

       850        860        870        880        890        900 
LGNGEQHFKN GELKLEEASR QPCGQQLSGG ASDSGRGPQR PDARLLRSQS TFQLSSEPER 

       910        920        930        940        950        960 
EPEWRDRPGS PESPLLDAPF SRAYRNSIKD AQSRVLGATS FRRRDLELGA PVASRSWRPR 

       970        980        990       1000       1010       1020 
PSSAHVGLRS PEASASASPH TPRERHSVTP AEGDLARPVP PAARRGARRR LTPEQKKRSY 

      1030       1040       1050       1060       1070       1080 
SEPEKMNEVG IVEEAEPAPL GPQRNGMRFP ESSVADRRRL FERDGKACST LSLSGPELKQ 

      1090       1100       1110       1120       1130       1140 
FQQSALADYI QRKTGKRPTS AAGCSLQEPG PLRERAQSAY LQPGPAALEG SGLASASSLS 

      1150       1160       1170       1180       1190       1200 
SLREPSLQPR REATLLPATV AETQQAPRDR SSSFAGGRRL GERRRGDLLS GANGGTRGTQ 

      1210       1220       1230       1240       1250       1260 
RGDETPREPS SWGARAGKSM SAEDLLERSD VLAGPVHVRS RSSPATADKR QDVLLGQDSG 

      1270       1280       1290       1300       1310       1320 
FGLVKDPCYL AGPGSRSLSC SERGQEEMLP LFHHLTPRWG GSGCKAIGDS SVPSECPGTL 

      1330       1340       1350       1360       1370       1380 
DHQRQASRTP CPRPPLAGTQ GLVTDTRAAP LTPIGTPLPS AIPSGYCSQD GQTGRQPLPP 

      1390       1400       1410       1420       1430       1440 
YTPAMMHRSN GHTLTQPPGP RGCEGDGPEH GVEEGTRKRV SLPQWPPPSR AKWAHAARED 

      1450       1460       1470       1480       1490       1500 
SLPEESSAPD FANLKHYQKQ QSLPSLCSTS DPDTPLGAPS TPGRISLRIS ESVLRDSPPP 

      1510       1520       1530       1540       1550       1560 
HEDYEDEVFV RDPHPKATSS PTFEPLPPPP PPPPSQETPV YSMDDFPPPP PHTVCEAQLD 

      1570       1580       1590       1600       1610       1620 
SEDPEGPRPS FNKLSKVTIA RERHMPGAAH VVGSQTLASR LQTSIKGSEA ESTPPSFMSV 

      1630       1640       1650       1660       1670       1680 
HAQLAGSLGG QPAPIQTQSL SHDPVSGTQG LEKKVSPDPQ KSSEDIRTEA LAKEIVHQDK 

      1690       1700       1710       1720       1730       1740 
SLADILDPDS RLKTTMDLME GLFPRDVNLL KENSVKRKAI QRTVSSSGCE GKRNEDKEAV 

      1750       1760       1770       1780       1790       1800 
SMLVNCPAYY SVSAPKAELL NKIKEMPAEV NEEEEQADVN EKKAELIGSL THKLETLQEA 

      1810       1820       1830       1840       1850       1860 
KGSLLTDIKL NNALGEEVEA LISELCKPNE FDKYRMFIGD LDKVVNLLLS LSGRLARVEN 

      1870       1880       1890       1900       1910       1920 
VLSGLGEDAS NEERSSLYEK RKILAGQHED ARELKENLDR RERVVLGILA NYLSEEQLQD 

      1930       1940       1950       1960       1970       1980 
YQHFVKMKST LLIEQRKLDD KIKLGQEQVK CLLESLPSDF IPKAGALALP PNLTSEPIPA 

      1990 
GGCTFSGIFP TLTSPL 

« Hide

Isoform 2 [UniParc].

Checksum: 5A9561BA6C6EF074
Show »

FASTA18620,457

References

« Hide 'large scale' references
[1]"Molecular cloning of FKBP12-associated protein."
Koide M., Iio A., Obata K., Inagaki M., Yokota M., Ono T., Tuan R.S.
Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ALA-279; ALA-469 AND LEU-1290.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Spleen.
[3]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 617-1996 (ISOFORM 1), VARIANT LEU-1290.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1230-1996 (ISOFORM 1).
Tissue: Colon.
[6]Hui R.T., Liu Y.Q., Liu B., Zhao B., Meng X.M., Sheng H., Xu Y.Y., Wang X.Y., Ye J., Song L., Gao Y., Wei Y.J., Zhang C.L., Zhang J., Chai M.Q., Chen J.Z., Sun Y.H., Zhou X.L. expand/collapse author list , Jiang Y.X., Zhao X.W., Liu S., Cao H.Q., Zhao Y., Liu D.Q., Ding J.F., Liu L.S., Gao R.L., Wu Q.Y., Qiang B.Q., Yuan J.G., Liew C.C., Zhao M.S.
Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1799-1996 (ISOFORM 1).
Tissue: Aorta.
[7]"A new standard nomenclature for proteins related to Apx and Shroom."
Hagens O., Ballabio A., Kalscheuer V., Kraehenbuhl J.-P., Schiaffino M.V., Smith P., Staub O., Hildebrand J.D., Wallingford J.B.
BMC Cell Biol. 7:18-18(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NOMENCLATURE.
[8]"Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-910 AND SER-913, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-439; SER-443; SER-910; SER-913 AND SER-1221, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[10]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[11]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-910, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[12]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-910 AND SER-970, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB055660 mRNA. Translation: BAB84689.1. Different initiation.
AK127929 mRNA. Translation: BAC87195.1.
AC096743 Genomic DNA. No translation available.
AC107051 Genomic DNA. No translation available.
AC107072 Genomic DNA. No translation available.
AC112249 Genomic DNA. No translation available.
AC121158 Genomic DNA. No translation available.
AB040914 mRNA. Translation: BAA96005.1.
BC007291 mRNA. Translation: AAH07291.1.
AF109367 mRNA. Translation: AAQ13515.1. Different initiation.
CCDSCCDS3579.2. [Q8TF72-1]
RefSeqNP_065910.3. NM_020859.3. [Q8TF72-1]
XP_005263219.1. XM_005263162.2. [Q8TF72-1]
UniGeneHs.702168.

3D structure databases

ProteinModelPortalQ8TF72.
SMRQ8TF72. Positions 25-108, 1779-1955.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid121665. 14 interactions.
IntActQ8TF72. 6 interactions.
MINTMINT-2812419.
STRING9606.ENSP00000296043.

PTM databases

PhosphoSiteQ8TF72.

Polymorphism databases

DMDM300669666.

Proteomic databases

MaxQBQ8TF72.
PaxDbQ8TF72.
PRIDEQ8TF72.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000296043; ENSP00000296043; ENSG00000138771. [Q8TF72-1]
GeneID57619.
KEGGhsa:57619.
UCSCuc003hkf.1. human. [Q8TF72-1]

Organism-specific databases

CTD57619.
GeneCardsGC04P077356.
H-InvDBHIX0004309.
HIX0163999.
HGNCHGNC:30422. SHROOM3.
HPAHPA047784.
MIM604570. gene.
neXtProtNX_Q8TF72.
PharmGKBPA147357295.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG72784.
HOGENOMHOG000169233.
HOVERGENHBG108489.
InParanoidQ8TF72.
OMAHTPRERH.
OrthoDBEOG7QZG8T.
PhylomeDBQ8TF72.
TreeFamTF333370.

Gene expression databases

BgeeQ8TF72.
CleanExHS_SHROOM3.
GenevestigatorQ8TF72.

Family and domain databases

Gene3D2.30.42.10. 1 hit.
InterProIPR014800. ASD1.
IPR014799. ASD2.
IPR001478. PDZ.
IPR027685. Shroom_fam.
[Graphical view]
PANTHERPTHR15012. PTHR15012. 1 hit.
PfamPF08688. ASD1. 1 hit.
PF08687. ASD2. 1 hit.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTSM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMSSF50156. SSF50156. 1 hit.
PROSITEPS51306. ASD1. 1 hit.
PS51307. ASD2. 1 hit.
PS50106. PDZ. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSSHROOM3. human.
GeneWikiSHROOM3.
GenomeRNAi57619.
NextBio64290.
PROQ8TF72.
SOURCESearch...

Entry information

Entry nameSHRM3_HUMAN
AccessionPrimary (citable) accession number: Q8TF72
Secondary accession number(s): Q5QTQ3 expand/collapse secondary AC list , Q6ZRW3, Q96IR9, Q9P247
Entry history
Integrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: July 13, 2010
Last modified: July 9, 2014
This is version 92 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 4

Human chromosome 4: entries, gene names and cross-references to MIM