Q8TER0 (SNED1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 87.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sushi, nidogen and EGF-like domain-containing protein 1 Alternative name(s): Insulin-responsive sequence DNA-binding protein 1 Short name=IRE-BP1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1413 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Secreted Potential. |
| Sequence similarities | Contains 15 EGF-like domains. Contains 3 fibronectin type-III domains. Contains 2 follistatin-like domains. Contains 1 NIDO domain. Contains 1 Sushi (CCP/SCR) domain. |
| Sequence caution | The sequence AAH27939.1 differs from that shown. Reason: Intron retention. The N-terminal region arises from intron retention. The sequence AAQ04558.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | EGF-like domain Repeat Signal Sushi |
| Ligand | Calcium |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell-matrix adhesion Inferred from electronic annotation. Source: InterPro |
| Cellular_component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | calcium ion binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8TER0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8TER0-3) The sequence of this isoform differs from the canonical sequence as follows: 1273-1306: QPTASAQLENMEEAPKRVSLALQLPEHGSKDIGN → H 1375-1402: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8TER0-4) The sequence of this isoform differs from the canonical sequence as follows: 1273-1306: QPTASAQLENMEEAPKRVSLALQLPEHGSKDIGN → H 1398-1398: K → L 1399-1413: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q8TER0-5) The sequence of this isoform differs from the canonical sequence as follows: 1306-1324: NVPGNCSENPCQNGGTCVP → SESAALVGTLGLTDCSQGP 1325-1413: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 24 | 24 | Potential | ||||||||
| Chain | 25 – 1413 | 1389 | Sushi, nidogen and EGF-like domain-containing protein 1 | PRO_0000299554 | |||||||
Regions | |||||||||||
| Domain | 103 – 258 | 156 | NIDO | ||||||||
| Domain | 268 – 309 | 42 | EGF-like 1 | ||||||||
| Domain | 311 – 347 | 37 | EGF-like 2 | ||||||||
| Domain | 349 – 385 | 37 | EGF-like 3 | ||||||||
| Domain | 352 – 374 | 23 | Follistatin-like 1 | ||||||||
| Domain | 387 – 423 | 37 | EGF-like 4; calcium-binding Potential | ||||||||
| Domain | 429 – 465 | 37 | EGF-like 5 | ||||||||
| Domain | 468 – 500 | 33 | EGF-like 6 | ||||||||
| Domain | 507 – 530 | 24 | Follistatin-like 2 | ||||||||
| Domain | 541 – 577 | 37 | EGF-like 7 | ||||||||
| Domain | 580 – 616 | 37 | EGF-like 8 | ||||||||
| Domain | 619 – 655 | 37 | EGF-like 9 | ||||||||
| Domain | 657 – 693 | 37 | EGF-like 10 | ||||||||
| Domain | 696 – 753 | 58 | Sushi | ||||||||
| Domain | 753 – 789 | 37 | EGF-like 11; calcium-binding Potential | ||||||||
| Domain | 791 – 827 | 37 | EGF-like 12; calcium-binding Potential | ||||||||
| Domain | 829 – 865 | 37 | EGF-like 13 | ||||||||
| Domain | 867 – 903 | 37 | EGF-like 14 | ||||||||
| Domain | 905 – 1003 | 99 | Fibronectin type-III 1 | ||||||||
| Domain | 1005 – 1096 | 92 | Fibronectin type-III 2 | ||||||||
| Domain | 1104 – 1196 | 93 | Fibronectin type-III 3 | ||||||||
| Domain | 1307 – 1343 | 37 | EGF-like 15 | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 145 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 408 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 977 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 272 ↔ 284 | By similarity | |||||||||
| Disulfide bond | 278 ↔ 297 | By similarity | |||||||||
| Disulfide bond | 299 ↔ 308 | By similarity | |||||||||
| Disulfide bond | 315 ↔ 326 | By similarity | |||||||||
| Disulfide bond | 320 ↔ 335 | By similarity | |||||||||
| Disulfide bond | 337 ↔ 346 | By similarity | |||||||||
| Disulfide bond | 353 ↔ 364 | By similarity | |||||||||
| Disulfide bond | 358 ↔ 373 | By similarity | |||||||||
| Disulfide bond | 375 ↔ 384 | By similarity | |||||||||
| Disulfide bond | 391 ↔ 402 | By similarity | |||||||||
| Disulfide bond | 396 ↔ 411 | By similarity | |||||||||
| Disulfide bond | 413 ↔ 422 | By similarity | |||||||||
| Disulfide bond | 433 ↔ 444 | By similarity | |||||||||
| Disulfide bond | 438 ↔ 453 | By similarity | |||||||||
| Disulfide bond | 455 ↔ 464 | By similarity | |||||||||
| Disulfide bond | 472 ↔ 480 | By similarity | |||||||||
| Disulfide bond | 474 ↔ 488 | By similarity | |||||||||
| Disulfide bond | 490 ↔ 499 | By similarity | |||||||||
| Disulfide bond | 545 ↔ 556 | By similarity | |||||||||
| Disulfide bond | 550 ↔ 565 | By similarity | |||||||||
| Disulfide bond | 567 ↔ 576 | By similarity | |||||||||
| Disulfide bond | 584 ↔ 595 | By similarity | |||||||||
| Disulfide bond | 589 ↔ 604 | By similarity | |||||||||
| Disulfide bond | 606 ↔ 615 | By similarity | |||||||||
| Disulfide bond | 623 ↔ 634 | By similarity | |||||||||
| Disulfide bond | 628 ↔ 643 | By similarity | |||||||||
| Disulfide bond | 645 ↔ 654 | By similarity | |||||||||
| Disulfide bond | 661 ↔ 672 | By similarity | |||||||||
| Disulfide bond | 666 ↔ 681 | By similarity | |||||||||
| Disulfide bond | 683 ↔ 692 | By similarity | |||||||||
| Disulfide bond | 698 ↔ 739 | By similarity | |||||||||
| Disulfide bond | 724 ↔ 751 | By similarity | |||||||||
| Disulfide bond | 757 ↔ 768 | By similarity | |||||||||
| Disulfide bond | 762 ↔ 777 | By similarity | |||||||||
| Disulfide bond | 779 ↔ 788 | By similarity | |||||||||
| Disulfide bond | 795 ↔ 806 | By similarity | |||||||||
| Disulfide bond | 800 ↔ 815 | By similarity | |||||||||
| Disulfide bond | 817 ↔ 826 | By similarity | |||||||||
| Disulfide bond | 833 ↔ 844 | By similarity | |||||||||
| Disulfide bond | 838 ↔ 853 | By similarity | |||||||||
| Disulfide bond | 855 ↔ 864 | By similarity | |||||||||
| Disulfide bond | 871 ↔ 882 | By similarity | |||||||||
| Disulfide bond | 876 ↔ 891 | By similarity | |||||||||
| Disulfide bond | 893 ↔ 902 | By similarity | |||||||||
| Disulfide bond | 1311 ↔ 1322 | By similarity | |||||||||
| Disulfide bond | 1316 ↔ 1331 | By similarity | |||||||||
| Disulfide bond | 1333 ↔ 1342 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1273 – 1306 | 34 | QPTAS…KDIGN → H in isoform 2 and isoform 3. | VSP_027749 | |||||||
| Alternative sequence | 1306 – 1324 | 19 | NVPGN…GTCVP → SESAALVGTLGLTDCSQGP in isoform 4. | VSP_027750 | |||||||
| Alternative sequence | 1325 – 1413 | 89 | Missing in isoform 4. | VSP_027751 | |||||||
| Alternative sequence | 1375 – 1402 | 28 | Missing in isoform 2. | VSP_027752 | |||||||
| Alternative sequence | 1398 | 1 | K → L in isoform 3. | VSP_027753 | |||||||
| Alternative sequence | 1399 – 1413 | 15 | Missing in isoform 3. | VSP_027754 | |||||||
| Natural variant | 1228 | 1 | L → P. Corresponds to variant rs17440466 [ dbSNP | Ensembl ]. | VAR_034847 | |||||||
| Natural variant | 1289 | 1 | R → Q. Corresponds to variant rs6721345 [ dbSNP | Ensembl ]. | VAR_034848 | |||||||
| Natural variant | 1299 | 1 | H → R. Corresponds to variant rs6708120 [ dbSNP | Ensembl ]. | VAR_034849 | |||||||
| Natural variant | 1362 | 1 | A → S. Ref.4 Corresponds to variant rs2108485 [ dbSNP | Ensembl ]. | VAR_034850 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 546 | 1 | D → N in AAQ04558. Ref.3 | ||||||||
| Sequence conflict | 653 | 1 | H → Y in AAQ04558. Ref.3 | ||||||||
| Sequence conflict | 719 | 1 | V → A in AAQ04558. Ref.3 | ||||||||
| Sequence conflict | 858 | 1 | S → G in AAQ04558. Ref.3 | ||||||||
| Sequence conflict | 1186 – 1206 | 21 | HSEPA…ADRRW → Q in AAQ04558. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | "The nucleotide sequence of a long cDNA clone isolated from human spleen." Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O. Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 132-1413 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 831-1413 (ISOFORM 2). Tissue: Spleen. |
| [3] | "Insulin-response element-binding protein 1: a novel Akt substrate involved in transcriptional action of insulin." Villafuerte B.C., Phillips L.S., Rane M.J., Zhao W. J. Biol. Chem. 279:36650-36659(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 367-1413 (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 938-1413 (ISOFORM 4). |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 791-1413 (ISOFORM 3), VARIANT SER-1362. Tissue: Lung. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC005237 Genomic DNA. No translation available. AC093585 Genomic DNA. No translation available. AC104809 Genomic DNA. No translation available. AK074062 mRNA. Translation: BAB84888.1. AK074075 mRNA. Translation: BAB84901.1. AF439717 mRNA. Translation: AAQ04558.1. Different initiation. AF439718 mRNA. Translation: AAQ04563.1. BC027939 mRNA. Translation: AAH27939.1. Sequence problems. |
| IPI | IPI00152789. IPI00827714. IPI00855880. IPI00856022. |
| RefSeq | NP_001073906.1. NM_001080437.1. |
| UniGene | Hs.471834. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1EDM based on UniProtKB P00740. |
| ProteinModelPortal | Q8TER0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000308893. |
PTM databases | |
| PhosphoSite | Q8TER0. |
Polymorphism databases | |
| DMDM | 158563933. |
Proteomic databases | |
| PaxDb | Q8TER0. |
| PRIDE | Q8TER0. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000310397; ENSP00000308893; ENSG00000162804. ENST00000401884; ENSP00000384871; ENSG00000162804. ENST00000405547; ENSP00000386007; ENSG00000162804. |
| GeneID | 25992. |
| KEGG | hsa:25992. |
| UCSC | uc002wah.1. human. |
Organism-specific databases | |
| CTD | 25992. |
| GeneCards | GC02P241938. |
| H-InvDB | HIX0002988. |
| HGNC | HGNC:24696. SNED1. |
| HPA | HPA036414. HPA036415. |
| neXtProt | NX_Q8TER0. |
| PharmGKB | PA134946370. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG242910. |
| HOVERGEN | HBG108495. |
| InParanoid | Q8TER0. |
| OrthoDB | EOG4K0QMM. |
Gene expression databases | |
| ArrayExpress | Q8TER0. |
| Bgee | Q8TER0. |
| CleanEx | HS_SNED1. |
| Genevestigator | Q8TER0. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 3 hits. |
| InterPro | IPR000742. EG-like_dom. IPR001881. EGF-like_Ca-bd. IPR013032. EGF-like_CS. IPR000152. EGF-type_Asp/Asn_hydroxyl_site. IPR018097. EGF_Ca-bd_CS. IPR003961. Fibronectin_type3. IPR003645. Fol_N. IPR013783. Ig-like_fold. IPR003886. Nidogen_extracell_dom. IPR000436. Sushi_SCR_CCP. [Graphical view] |
| Pfam | PF00008. EGF. 10 hits. PF00041. fn3. 3 hits. PF12661. hEGF. 2 hits. PF06119. NIDO. 1 hit. [Graphical view] |
| SMART | SM00032. CCP. 1 hit. SM00181. EGF. 10 hits. SM00179. EGF_CA. 5 hits. SM00060. FN3. 3 hits. SM00274. FOLN. 2 hits. SM00539. NIDO. 1 hit. [Graphical view] |
| SUPFAM | SSF57535. Complement_control_module. 1 hit. SSF49265. FN_III-like. 3 hits. |
| PROSITE | PS00010. ASX_HYDROXYL. 5 hits. PS00022. EGF_1. 15 hits. PS01186. EGF_2. 13 hits. PS50026. EGF_3. 15 hits. PS01187. EGF_CA. 3 hits. PS50853. FN3. 3 hits. PS51220. NIDO. 1 hit. PS50923. SUSHI. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 25992. |
| NextBio | 47694. |
Entry information
| Entry name | SNED1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8TER0 Secondary accession number(s): B5MDC3 Q8TEP7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
