Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8TER0

- SNED1_HUMAN

UniProt

Q8TER0 - SNED1_HUMAN

Protein

Sushi, nidogen and EGF-like domain-containing protein 1

Gene

SNED1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 102 (01 Oct 2014)
      Sequence version 2 (11 Sep 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro

    GO - Biological processi

    1. cell-matrix adhesion Source: InterPro

    Keywords - Ligandi

    Calcium

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sushi, nidogen and EGF-like domain-containing protein 1
    Alternative name(s):
    Insulin-responsive sequence DNA-binding protein 1
    Short name:
    IRE-BP1
    Gene namesi
    Name:SNED1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:24696. SNED1.

    Subcellular locationi

    Secreted Curated

    GO - Cellular componenti

    1. extracellular vesicular exosome Source: UniProt

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134946370.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2424Sequence AnalysisAdd
    BLAST
    Chaini25 – 14131389Sushi, nidogen and EGF-like domain-containing protein 1PRO_0000299554Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi145 – 1451N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi272 ↔ 284By similarity
    Disulfide bondi278 ↔ 297By similarity
    Disulfide bondi299 ↔ 308By similarity
    Disulfide bondi315 ↔ 326By similarity
    Disulfide bondi320 ↔ 335By similarity
    Disulfide bondi337 ↔ 346By similarity
    Disulfide bondi353 ↔ 364By similarity
    Disulfide bondi358 ↔ 373By similarity
    Disulfide bondi375 ↔ 384By similarity
    Disulfide bondi391 ↔ 402By similarity
    Disulfide bondi396 ↔ 411By similarity
    Glycosylationi408 – 4081N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi413 ↔ 422By similarity
    Disulfide bondi433 ↔ 444By similarity
    Disulfide bondi438 ↔ 453By similarity
    Disulfide bondi455 ↔ 464By similarity
    Disulfide bondi472 ↔ 480By similarity
    Disulfide bondi474 ↔ 488By similarity
    Disulfide bondi490 ↔ 499By similarity
    Disulfide bondi545 ↔ 556By similarity
    Disulfide bondi550 ↔ 565By similarity
    Disulfide bondi567 ↔ 576By similarity
    Disulfide bondi584 ↔ 595By similarity
    Disulfide bondi589 ↔ 604By similarity
    Disulfide bondi606 ↔ 615By similarity
    Disulfide bondi623 ↔ 634By similarity
    Disulfide bondi628 ↔ 643By similarity
    Disulfide bondi645 ↔ 654By similarity
    Disulfide bondi661 ↔ 672By similarity
    Disulfide bondi666 ↔ 681By similarity
    Disulfide bondi683 ↔ 692By similarity
    Disulfide bondi698 ↔ 739By similarity
    Disulfide bondi724 ↔ 751By similarity
    Disulfide bondi757 ↔ 768By similarity
    Disulfide bondi762 ↔ 777By similarity
    Disulfide bondi779 ↔ 788By similarity
    Disulfide bondi795 ↔ 806By similarity
    Disulfide bondi800 ↔ 815By similarity
    Disulfide bondi817 ↔ 826By similarity
    Disulfide bondi833 ↔ 844By similarity
    Disulfide bondi838 ↔ 853By similarity
    Disulfide bondi855 ↔ 864By similarity
    Disulfide bondi871 ↔ 882By similarity
    Disulfide bondi876 ↔ 891By similarity
    Disulfide bondi893 ↔ 902By similarity
    Glycosylationi977 – 9771N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi1311 ↔ 1322By similarity
    Disulfide bondi1316 ↔ 1331By similarity
    Disulfide bondi1333 ↔ 1342By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ8TER0.
    PRIDEiQ8TER0.

    PTM databases

    PhosphoSiteiQ8TER0.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8TER0.
    BgeeiQ8TER0.
    CleanExiHS_SNED1.
    GenevestigatoriQ8TER0.

    Organism-specific databases

    HPAiHPA036414.
    HPA036415.

    Interactioni

    Protein-protein interaction databases

    BioGridi117471. 2 interactions.
    STRINGi9606.ENSP00000308893.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8TER0.
    SMRiQ8TER0. Positions 273-696, 753-1191, 1309-1343.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini103 – 258156NIDOPROSITE-ProRule annotationAdd
    BLAST
    Domaini268 – 30942EGF-like 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini311 – 34737EGF-like 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini349 – 38537EGF-like 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini352 – 37423Follistatin-like 1Add
    BLAST
    Domaini387 – 42337EGF-like 4; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini429 – 46537EGF-like 5PROSITE-ProRule annotationAdd
    BLAST
    Domaini468 – 50033EGF-like 6PROSITE-ProRule annotationAdd
    BLAST
    Domaini507 – 53024Follistatin-like 2Add
    BLAST
    Domaini541 – 57737EGF-like 7PROSITE-ProRule annotationAdd
    BLAST
    Domaini580 – 61637EGF-like 8PROSITE-ProRule annotationAdd
    BLAST
    Domaini619 – 65537EGF-like 9PROSITE-ProRule annotationAdd
    BLAST
    Domaini657 – 69337EGF-like 10PROSITE-ProRule annotationAdd
    BLAST
    Domaini696 – 75358SushiPROSITE-ProRule annotationAdd
    BLAST
    Domaini753 – 78937EGF-like 11; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini791 – 82737EGF-like 12; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini829 – 86537EGF-like 13PROSITE-ProRule annotationAdd
    BLAST
    Domaini867 – 90337EGF-like 14PROSITE-ProRule annotationAdd
    BLAST
    Domaini908 – 100699Fibronectin type-III 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini1007 – 110599Fibronectin type-III 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini1106 – 120095Fibronectin type-III 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini1307 – 134337EGF-like 15PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 15 EGF-like domains.PROSITE-ProRule annotation
    Contains 3 fibronectin type-III domains.PROSITE-ProRule annotation
    Contains 2 follistatin-like domains.Curated
    Contains 1 NIDO domain.PROSITE-ProRule annotation
    Contains 1 Sushi (CCP/SCR) domain.PROSITE-ProRule annotation

    Keywords - Domaini

    EGF-like domain, Repeat, Signal, Sushi

    Phylogenomic databases

    eggNOGiNOG242910.
    HOVERGENiHBG108495.
    InParanoidiQ8TER0.
    OMAiSKTIRRI.
    OrthoDBiEOG7F24S0.
    PhylomeDBiQ8TER0.
    TreeFamiTF335195.

    Family and domain databases

    Gene3Di2.60.40.10. 3 hits.
    InterProiIPR000742. EG-like_dom.
    IPR001881. EGF-like_Ca-bd_dom.
    IPR013032. EGF-like_CS.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR018097. EGF_Ca-bd_CS.
    IPR003961. Fibronectin_type3.
    IPR003645. Fol_N.
    IPR013783. Ig-like_fold.
    IPR003886. Nidogen_extracell_dom.
    IPR000436. Sushi_SCR_CCP.
    [Graphical view]
    PfamiPF00008. EGF. 11 hits.
    PF00041. fn3. 3 hits.
    PF12661. hEGF. 2 hits.
    PF06119. NIDO. 1 hit.
    [Graphical view]
    SMARTiSM00032. CCP. 1 hit.
    SM00181. EGF. 10 hits.
    SM00179. EGF_CA. 5 hits.
    SM00060. FN3. 3 hits.
    SM00274. FOLN. 2 hits.
    SM00539. NIDO. 1 hit.
    [Graphical view]
    SUPFAMiSSF49265. SSF49265. 2 hits.
    SSF57535. SSF57535. 1 hit.
    PROSITEiPS00010. ASX_HYDROXYL. 5 hits.
    PS00022. EGF_1. 15 hits.
    PS01186. EGF_2. 13 hits.
    PS50026. EGF_3. 15 hits.
    PS01187. EGF_CA. 3 hits.
    PS50853. FN3. 3 hits.
    PS51220. NIDO. 1 hit.
    PS50923. SUSHI. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8TER0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRHGVAWALL VAAALGLGAR GVRGAVALAD FYPFGAERGD AVTPKQDDGG     50
    SGLRPLSVPF PFFGAEHSGL YVNNNGIISF LKEVSQFTPV AFPIAKDRCV 100
    VAAFWADVDN RRAGDVYYRE ATDPAMLRRA TEDVRHYFPE LLDFNATWVF 150
    VATWYRVTFF GGSSSSPVNT FQTVLITDGK LSFTIFNYES IVWTTGTHAS 200
    SGGNATGLGG IAAQAGFNAG DGQRYFSIPG SRTADMAEVE TTTNVGVPGR 250
    WAFRIDDAQV RVGGCGHTTS VCLALRPCLN GGKCIDDCVT GNPSYTCSCL 300
    SGFTGRRCHL DVNECASQPC QNGGTCTHGI NSFRCQCPAG FGGPTCETAQ 350
    SPCDTKECQH GGQCQVENGS AVCVCQAGYT GAACEMDVDD CSPDPCLNGG 400
    SCVDLVGNYT CLCAEPFKGL RCETGDHPVP DACLSAPCHN GGTCVDADQG 450
    YVCECPEGFM GLDCRERVPD DCECRNGGRC LGANTTLCQC PLGFFGLLCE 500
    FEITAMPCNM NTQCPDGGYC MEHGGSYLCV CHTDHNASHS LPSPCDSDPC 550
    FNGGSCDAHD DSYTCECPRG FHGKHCEKAR PHLCSSGPCR NGGTCKEAGG 600
    EYHCSCPYRF TGRHCEIGKP DSCASGPCHN GGTCFHYIGK YKCDCPPGFS 650
    GRHCEIAPSP CFRSPCVNGG TCEDRDTDFF CHCQAGYMGR RCQAEVDCGP 700
    PEEVKHATLR FNGTRLGAVA LYACDRGYSL SAPSRIRVCQ PHGVWSEPPQ 750
    CLEIDECRSQ PCLHGGSCQD RVAGYLCLCS TGYEGAHCEL ERDECRAHPC 800
    RNGGSCRNLP GAYVCRCPAG FVGVHCETEV DACDSSPCQH GGRCESGGGA 850
    YLCVCPESFF GYHCETVSDP CFSSPCGGRG YCLASNGSHS CTCKVGYTGE 900
    DCAKELFPPT ALKMERVEES GVSISWNPPN GPAARQMLDG YAVTYVSSDG 950
    SYRRTDFVDR TRSSHQLQAL AAGRAYNISV FSVKRNSNNK NDISRPAVLL 1000
    ARTRPRPVEG FEVTNVTAST ISVQWALHRI RHATVSGVRV SIRHPEALRD 1050
    QATDVDRSVD RFTFRALLPG KRYTIQLTTL SGLRGEEHPT ESLATAPTHV 1100
    WTRPLPPANL TAARVTATSA HVVWDAPTPG SLLEAYVINV TTSQSTKSRY 1150
    VPNGKLASYT VRDLLPGRRY QLSVIAVQST ELGPQHSEPA HLYIITSPRD 1200
    GADRRWHQGG HHPRVLKNRP PPARLPELRL LNDHSAPETP TQPPRFSELV 1250
    DGRGRVSARF GGSPSKAATV RSQPTASAQL ENMEEAPKRV SLALQLPEHG 1300
    SKDIGNVPGN CSENPCQNGG TCVPGADAHS CDCGPGFKGR RCELACIKVS 1350
    RPCTRLFSET KAFPVWEGGV CHHVYKRVYR VHQDICFKES CESTSLKKTP 1400
    NRKQSKSQTL EKS 1413
    Length:1,413
    Mass (Da):152,204
    Last modified:September 11, 2007 - v2
    Checksum:i09BC8059234326D9
    GO
    Isoform 2 (identifier: Q8TER0-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1273-1306: QPTASAQLENMEEAPKRVSLALQLPEHGSKDIGN → H
         1375-1402: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,352
    Mass (Da):145,300
    Checksum:iE6063435C0AA1CFD
    GO
    Isoform 3 (identifier: Q8TER0-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1273-1306: QPTASAQLENMEEAPKRVSLALQLPEHGSKDIGN → H
         1398-1398: K → L
         1399-1413: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,365
    Mass (Da):146,970
    Checksum:i346748DD68531BC3
    GO
    Isoform 4 (identifier: Q8TER0-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1306-1324: NVPGNCSENPCQNGGTCVP → SESAALVGTLGLTDCSQGP
         1325-1413: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,324
    Mass (Da):142,073
    Checksum:iAA7A732F74E755D6
    GO

    Sequence cautioni

    The sequence AAH27939.1 differs from that shown. Reason: Intron retention. The N-terminal region arises from intron retention.
    The sequence AAQ04558.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti546 – 5461D → N in AAQ04558. (PubMed:15194686)Curated
    Sequence conflicti653 – 6531H → Y in AAQ04558. (PubMed:15194686)Curated
    Sequence conflicti719 – 7191V → A in AAQ04558. (PubMed:15194686)Curated
    Sequence conflicti858 – 8581S → G in AAQ04558. (PubMed:15194686)Curated
    Sequence conflicti1186 – 120621HSEPA…ADRRW → Q in AAQ04558. (PubMed:15194686)CuratedAdd
    BLAST

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti1228 – 12281L → P.
    Corresponds to variant rs17440466 [ dbSNP | Ensembl ].
    VAR_034847
    Natural varianti1289 – 12891R → Q.
    Corresponds to variant rs6721345 [ dbSNP | Ensembl ].
    VAR_034848
    Natural varianti1299 – 12991H → R.
    Corresponds to variant rs6708120 [ dbSNP | Ensembl ].
    VAR_034849
    Natural varianti1362 – 13621A → S.1 Publication
    Corresponds to variant rs2108485 [ dbSNP | Ensembl ].
    VAR_034850

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1273 – 130634QPTAS…KDIGN → H in isoform 2 and isoform 3. 2 PublicationsVSP_027749Add
    BLAST
    Alternative sequencei1306 – 132419NVPGN…GTCVP → SESAALVGTLGLTDCSQGP in isoform 4. 1 PublicationVSP_027750Add
    BLAST
    Alternative sequencei1325 – 141389Missing in isoform 4. 1 PublicationVSP_027751Add
    BLAST
    Alternative sequencei1375 – 140228Missing in isoform 2. 1 PublicationVSP_027752Add
    BLAST
    Alternative sequencei1398 – 13981K → L in isoform 3. 1 PublicationVSP_027753
    Alternative sequencei1399 – 141315Missing in isoform 3. 1 PublicationVSP_027754Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC005237 Genomic DNA. No translation available.
    AC093585 Genomic DNA. No translation available.
    AC104809 Genomic DNA. No translation available.
    AK074062 mRNA. Translation: BAB84888.1.
    AK074075 mRNA. Translation: BAB84901.1.
    AF439717 mRNA. Translation: AAQ04558.1. Different initiation.
    AF439718 mRNA. Translation: AAQ04563.1.
    BC027939 mRNA. Translation: AAH27939.1. Sequence problems.
    CCDSiCCDS46562.1. [Q8TER0-1]
    RefSeqiNP_001073906.1. NM_001080437.1. [Q8TER0-1]
    XP_006712468.1. XM_006712405.1. [Q8TER0-1]
    UniGeneiHs.471834.

    Genome annotation databases

    EnsembliENST00000310397; ENSP00000308893; ENSG00000162804. [Q8TER0-1]
    ENST00000401884; ENSP00000384871; ENSG00000162804. [Q8TER0-5]
    ENST00000405547; ENSP00000386007; ENSG00000162804. [Q8TER0-3]
    GeneIDi25992.
    KEGGihsa:25992.
    UCSCiuc002wah.1. human. [Q8TER0-1]

    Polymorphism databases

    DMDMi158563933.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC005237 Genomic DNA. No translation available.
    AC093585 Genomic DNA. No translation available.
    AC104809 Genomic DNA. No translation available.
    AK074062 mRNA. Translation: BAB84888.1 .
    AK074075 mRNA. Translation: BAB84901.1 .
    AF439717 mRNA. Translation: AAQ04558.1 . Different initiation.
    AF439718 mRNA. Translation: AAQ04563.1 .
    BC027939 mRNA. Translation: AAH27939.1 . Sequence problems.
    CCDSi CCDS46562.1. [Q8TER0-1 ]
    RefSeqi NP_001073906.1. NM_001080437.1. [Q8TER0-1 ]
    XP_006712468.1. XM_006712405.1. [Q8TER0-1 ]
    UniGenei Hs.471834.

    3D structure databases

    ProteinModelPortali Q8TER0.
    SMRi Q8TER0. Positions 273-696, 753-1191, 1309-1343.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 117471. 2 interactions.
    STRINGi 9606.ENSP00000308893.

    PTM databases

    PhosphoSitei Q8TER0.

    Polymorphism databases

    DMDMi 158563933.

    Proteomic databases

    PaxDbi Q8TER0.
    PRIDEi Q8TER0.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000310397 ; ENSP00000308893 ; ENSG00000162804 . [Q8TER0-1 ]
    ENST00000401884 ; ENSP00000384871 ; ENSG00000162804 . [Q8TER0-5 ]
    ENST00000405547 ; ENSP00000386007 ; ENSG00000162804 . [Q8TER0-3 ]
    GeneIDi 25992.
    KEGGi hsa:25992.
    UCSCi uc002wah.1. human. [Q8TER0-1 ]

    Organism-specific databases

    CTDi 25992.
    GeneCardsi GC02P241938.
    H-InvDB HIX0002988.
    HGNCi HGNC:24696. SNED1.
    HPAi HPA036414.
    HPA036415.
    neXtProti NX_Q8TER0.
    PharmGKBi PA134946370.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG242910.
    HOVERGENi HBG108495.
    InParanoidi Q8TER0.
    OMAi SKTIRRI.
    OrthoDBi EOG7F24S0.
    PhylomeDBi Q8TER0.
    TreeFami TF335195.

    Miscellaneous databases

    GenomeRNAii 25992.
    NextBioi 47694.
    PROi Q8TER0.

    Gene expression databases

    ArrayExpressi Q8TER0.
    Bgeei Q8TER0.
    CleanExi HS_SNED1.
    Genevestigatori Q8TER0.

    Family and domain databases

    Gene3Di 2.60.40.10. 3 hits.
    InterProi IPR000742. EG-like_dom.
    IPR001881. EGF-like_Ca-bd_dom.
    IPR013032. EGF-like_CS.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR018097. EGF_Ca-bd_CS.
    IPR003961. Fibronectin_type3.
    IPR003645. Fol_N.
    IPR013783. Ig-like_fold.
    IPR003886. Nidogen_extracell_dom.
    IPR000436. Sushi_SCR_CCP.
    [Graphical view ]
    Pfami PF00008. EGF. 11 hits.
    PF00041. fn3. 3 hits.
    PF12661. hEGF. 2 hits.
    PF06119. NIDO. 1 hit.
    [Graphical view ]
    SMARTi SM00032. CCP. 1 hit.
    SM00181. EGF. 10 hits.
    SM00179. EGF_CA. 5 hits.
    SM00060. FN3. 3 hits.
    SM00274. FOLN. 2 hits.
    SM00539. NIDO. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49265. SSF49265. 2 hits.
    SSF57535. SSF57535. 1 hit.
    PROSITEi PS00010. ASX_HYDROXYL. 5 hits.
    PS00022. EGF_1. 15 hits.
    PS01186. EGF_2. 13 hits.
    PS50026. EGF_3. 15 hits.
    PS01187. EGF_CA. 3 hits.
    PS50853. FN3. 3 hits.
    PS51220. NIDO. 1 hit.
    PS50923. SUSHI. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    2. "The nucleotide sequence of a long cDNA clone isolated from human spleen."
      Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O.
      Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 132-1413 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 831-1413 (ISOFORM 2).
      Tissue: Spleen.
    3. "Insulin-response element-binding protein 1: a novel Akt substrate involved in transcriptional action of insulin."
      Villafuerte B.C., Phillips L.S., Rane M.J., Zhao W.
      J. Biol. Chem. 279:36650-36659(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 367-1413 (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 938-1413 (ISOFORM 4).
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 791-1413 (ISOFORM 3), VARIANT SER-1362.
      Tissue: Lung.

    Entry informationi

    Entry nameiSNED1_HUMAN
    AccessioniPrimary (citable) accession number: Q8TER0
    Secondary accession number(s): B5MDC3
    , B7WNK6, B7WPM0, Q336F4, Q336F5, Q8N369, Q8TEP7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 11, 2007
    Last sequence update: September 11, 2007
    Last modified: October 1, 2014
    This is version 102 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3