Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8TER0 (SNED1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 100. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Sushi, nidogen and EGF-like domain-containing protein 1
Alternative name(s):
Insulin-responsive sequence DNA-binding protein 1
Short name=IRE-BP1
Gene names
Name:SNED1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1413 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Subcellular location

Secreted Potential.

Sequence similarities

Contains 15 EGF-like domains.

Contains 3 fibronectin type-III domains.

Contains 2 follistatin-like domains.

Contains 1 NIDO domain.

Contains 1 Sushi (CCP/SCR) domain.

Sequence caution

The sequence AAH27939.1 differs from that shown. Reason: Intron retention. The N-terminal region arises from intron retention.

The sequence AAQ04558.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Cellular componentSecreted
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainEGF-like domain
Repeat
Signal
Sushi
   LigandCalcium
   PTMDisulfide bond
Glycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcell-matrix adhesion

Inferred from electronic annotation. Source: InterPro

   Cellular_componentextracellular region

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functioncalcium ion binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8TER0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8TER0-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1273-1306: QPTASAQLENMEEAPKRVSLALQLPEHGSKDIGN → H
     1375-1402: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q8TER0-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1273-1306: QPTASAQLENMEEAPKRVSLALQLPEHGSKDIGN → H
     1398-1398: K → L
     1399-1413: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q8TER0-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1306-1324: NVPGNCSENPCQNGGTCVP → SESAALVGTLGLTDCSQGP
     1325-1413: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2424 Potential
Chain25 – 14131389Sushi, nidogen and EGF-like domain-containing protein 1
PRO_0000299554

Regions

Domain103 – 258156NIDO
Domain268 – 30942EGF-like 1
Domain311 – 34737EGF-like 2
Domain349 – 38537EGF-like 3
Domain352 – 37423Follistatin-like 1
Domain387 – 42337EGF-like 4; calcium-binding Potential
Domain429 – 46537EGF-like 5
Domain468 – 50033EGF-like 6
Domain507 – 53024Follistatin-like 2
Domain541 – 57737EGF-like 7
Domain580 – 61637EGF-like 8
Domain619 – 65537EGF-like 9
Domain657 – 69337EGF-like 10
Domain696 – 75358Sushi
Domain753 – 78937EGF-like 11; calcium-binding Potential
Domain791 – 82737EGF-like 12; calcium-binding Potential
Domain829 – 86537EGF-like 13
Domain867 – 90337EGF-like 14
Domain908 – 100699Fibronectin type-III 1
Domain1007 – 110599Fibronectin type-III 2
Domain1106 – 120095Fibronectin type-III 3
Domain1307 – 134337EGF-like 15

Amino acid modifications

Glycosylation1451N-linked (GlcNAc...) Potential
Glycosylation4081N-linked (GlcNAc...) Potential
Glycosylation9771N-linked (GlcNAc...) Potential
Disulfide bond272 ↔ 284 By similarity
Disulfide bond278 ↔ 297 By similarity
Disulfide bond299 ↔ 308 By similarity
Disulfide bond315 ↔ 326 By similarity
Disulfide bond320 ↔ 335 By similarity
Disulfide bond337 ↔ 346 By similarity
Disulfide bond353 ↔ 364 By similarity
Disulfide bond358 ↔ 373 By similarity
Disulfide bond375 ↔ 384 By similarity
Disulfide bond391 ↔ 402 By similarity
Disulfide bond396 ↔ 411 By similarity
Disulfide bond413 ↔ 422 By similarity
Disulfide bond433 ↔ 444 By similarity
Disulfide bond438 ↔ 453 By similarity
Disulfide bond455 ↔ 464 By similarity
Disulfide bond472 ↔ 480 By similarity
Disulfide bond474 ↔ 488 By similarity
Disulfide bond490 ↔ 499 By similarity
Disulfide bond545 ↔ 556 By similarity
Disulfide bond550 ↔ 565 By similarity
Disulfide bond567 ↔ 576 By similarity
Disulfide bond584 ↔ 595 By similarity
Disulfide bond589 ↔ 604 By similarity
Disulfide bond606 ↔ 615 By similarity
Disulfide bond623 ↔ 634 By similarity
Disulfide bond628 ↔ 643 By similarity
Disulfide bond645 ↔ 654 By similarity
Disulfide bond661 ↔ 672 By similarity
Disulfide bond666 ↔ 681 By similarity
Disulfide bond683 ↔ 692 By similarity
Disulfide bond698 ↔ 739 By similarity
Disulfide bond724 ↔ 751 By similarity
Disulfide bond757 ↔ 768 By similarity
Disulfide bond762 ↔ 777 By similarity
Disulfide bond779 ↔ 788 By similarity
Disulfide bond795 ↔ 806 By similarity
Disulfide bond800 ↔ 815 By similarity
Disulfide bond817 ↔ 826 By similarity
Disulfide bond833 ↔ 844 By similarity
Disulfide bond838 ↔ 853 By similarity
Disulfide bond855 ↔ 864 By similarity
Disulfide bond871 ↔ 882 By similarity
Disulfide bond876 ↔ 891 By similarity
Disulfide bond893 ↔ 902 By similarity
Disulfide bond1311 ↔ 1322 By similarity
Disulfide bond1316 ↔ 1331 By similarity
Disulfide bond1333 ↔ 1342 By similarity

Natural variations

Alternative sequence1273 – 130634QPTAS…KDIGN → H in isoform 2 and isoform 3.
VSP_027749
Alternative sequence1306 – 132419NVPGN…GTCVP → SESAALVGTLGLTDCSQGP in isoform 4.
VSP_027750
Alternative sequence1325 – 141389Missing in isoform 4.
VSP_027751
Alternative sequence1375 – 140228Missing in isoform 2.
VSP_027752
Alternative sequence13981K → L in isoform 3.
VSP_027753
Alternative sequence1399 – 141315Missing in isoform 3.
VSP_027754
Natural variant12281L → P.
Corresponds to variant rs17440466 [ dbSNP | Ensembl ].
VAR_034847
Natural variant12891R → Q.
Corresponds to variant rs6721345 [ dbSNP | Ensembl ].
VAR_034848
Natural variant12991H → R.
Corresponds to variant rs6708120 [ dbSNP | Ensembl ].
VAR_034849
Natural variant13621A → S. Ref.4
Corresponds to variant rs2108485 [ dbSNP | Ensembl ].
VAR_034850

Experimental info

Sequence conflict5461D → N in AAQ04558. Ref.3
Sequence conflict6531H → Y in AAQ04558. Ref.3
Sequence conflict7191V → A in AAQ04558. Ref.3
Sequence conflict8581S → G in AAQ04558. Ref.3
Sequence conflict1186 – 120621HSEPA…ADRRW → Q in AAQ04558. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified September 11, 2007. Version 2.
Checksum: 09BC8059234326D9

FASTA1,413152,204
        10         20         30         40         50         60 
MRHGVAWALL VAAALGLGAR GVRGAVALAD FYPFGAERGD AVTPKQDDGG SGLRPLSVPF 

        70         80         90        100        110        120 
PFFGAEHSGL YVNNNGIISF LKEVSQFTPV AFPIAKDRCV VAAFWADVDN RRAGDVYYRE 

       130        140        150        160        170        180 
ATDPAMLRRA TEDVRHYFPE LLDFNATWVF VATWYRVTFF GGSSSSPVNT FQTVLITDGK 

       190        200        210        220        230        240 
LSFTIFNYES IVWTTGTHAS SGGNATGLGG IAAQAGFNAG DGQRYFSIPG SRTADMAEVE 

       250        260        270        280        290        300 
TTTNVGVPGR WAFRIDDAQV RVGGCGHTTS VCLALRPCLN GGKCIDDCVT GNPSYTCSCL 

       310        320        330        340        350        360 
SGFTGRRCHL DVNECASQPC QNGGTCTHGI NSFRCQCPAG FGGPTCETAQ SPCDTKECQH 

       370        380        390        400        410        420 
GGQCQVENGS AVCVCQAGYT GAACEMDVDD CSPDPCLNGG SCVDLVGNYT CLCAEPFKGL 

       430        440        450        460        470        480 
RCETGDHPVP DACLSAPCHN GGTCVDADQG YVCECPEGFM GLDCRERVPD DCECRNGGRC 

       490        500        510        520        530        540 
LGANTTLCQC PLGFFGLLCE FEITAMPCNM NTQCPDGGYC MEHGGSYLCV CHTDHNASHS 

       550        560        570        580        590        600 
LPSPCDSDPC FNGGSCDAHD DSYTCECPRG FHGKHCEKAR PHLCSSGPCR NGGTCKEAGG 

       610        620        630        640        650        660 
EYHCSCPYRF TGRHCEIGKP DSCASGPCHN GGTCFHYIGK YKCDCPPGFS GRHCEIAPSP 

       670        680        690        700        710        720 
CFRSPCVNGG TCEDRDTDFF CHCQAGYMGR RCQAEVDCGP PEEVKHATLR FNGTRLGAVA 

       730        740        750        760        770        780 
LYACDRGYSL SAPSRIRVCQ PHGVWSEPPQ CLEIDECRSQ PCLHGGSCQD RVAGYLCLCS 

       790        800        810        820        830        840 
TGYEGAHCEL ERDECRAHPC RNGGSCRNLP GAYVCRCPAG FVGVHCETEV DACDSSPCQH 

       850        860        870        880        890        900 
GGRCESGGGA YLCVCPESFF GYHCETVSDP CFSSPCGGRG YCLASNGSHS CTCKVGYTGE 

       910        920        930        940        950        960 
DCAKELFPPT ALKMERVEES GVSISWNPPN GPAARQMLDG YAVTYVSSDG SYRRTDFVDR 

       970        980        990       1000       1010       1020 
TRSSHQLQAL AAGRAYNISV FSVKRNSNNK NDISRPAVLL ARTRPRPVEG FEVTNVTAST 

      1030       1040       1050       1060       1070       1080 
ISVQWALHRI RHATVSGVRV SIRHPEALRD QATDVDRSVD RFTFRALLPG KRYTIQLTTL 

      1090       1100       1110       1120       1130       1140 
SGLRGEEHPT ESLATAPTHV WTRPLPPANL TAARVTATSA HVVWDAPTPG SLLEAYVINV 

      1150       1160       1170       1180       1190       1200 
TTSQSTKSRY VPNGKLASYT VRDLLPGRRY QLSVIAVQST ELGPQHSEPA HLYIITSPRD 

      1210       1220       1230       1240       1250       1260 
GADRRWHQGG HHPRVLKNRP PPARLPELRL LNDHSAPETP TQPPRFSELV DGRGRVSARF 

      1270       1280       1290       1300       1310       1320 
GGSPSKAATV RSQPTASAQL ENMEEAPKRV SLALQLPEHG SKDIGNVPGN CSENPCQNGG 

      1330       1340       1350       1360       1370       1380 
TCVPGADAHS CDCGPGFKGR RCELACIKVS RPCTRLFSET KAFPVWEGGV CHHVYKRVYR 

      1390       1400       1410 
VHQDICFKES CESTSLKKTP NRKQSKSQTL EKS 

« Hide

Isoform 2 [UniParc].

Checksum: E6063435C0AA1CFD
Show »

FASTA1,352145,300
Isoform 3 [UniParc].

Checksum: 346748DD68531BC3
Show »

FASTA1,365146,970
Isoform 4 [UniParc].

Checksum: AA7A732F74E755D6
Show »

FASTA1,324142,073

References

« Hide 'large scale' references
[1]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[2]"The nucleotide sequence of a long cDNA clone isolated from human spleen."
Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O.
Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 132-1413 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 831-1413 (ISOFORM 2).
Tissue: Spleen.
[3]"Insulin-response element-binding protein 1: a novel Akt substrate involved in transcriptional action of insulin."
Villafuerte B.C., Phillips L.S., Rane M.J., Zhao W.
J. Biol. Chem. 279:36650-36659(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 367-1413 (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 938-1413 (ISOFORM 4).
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 791-1413 (ISOFORM 3), VARIANT SER-1362.
Tissue: Lung.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AC005237 Genomic DNA. No translation available.
AC093585 Genomic DNA. No translation available.
AC104809 Genomic DNA. No translation available.
AK074062 mRNA. Translation: BAB84888.1.
AK074075 mRNA. Translation: BAB84901.1.
AF439717 mRNA. Translation: AAQ04558.1. Different initiation.
AF439718 mRNA. Translation: AAQ04563.1.
BC027939 mRNA. Translation: AAH27939.1. Sequence problems.
CCDSCCDS46562.1. [Q8TER0-1]
RefSeqNP_001073906.1. NM_001080437.1. [Q8TER0-1]
XP_006712468.1. XM_006712405.1. [Q8TER0-1]
UniGeneHs.471834.

3D structure databases

ProteinModelPortalQ8TER0.
SMRQ8TER0. Positions 273-696, 753-1191, 1309-1343.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid117471. 2 interactions.
STRING9606.ENSP00000308893.

PTM databases

PhosphoSiteQ8TER0.

Polymorphism databases

DMDM158563933.

Proteomic databases

PaxDbQ8TER0.
PRIDEQ8TER0.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000310397; ENSP00000308893; ENSG00000162804. [Q8TER0-1]
ENST00000401884; ENSP00000384871; ENSG00000162804. [Q8TER0-5]
ENST00000405547; ENSP00000386007; ENSG00000162804. [Q8TER0-3]
GeneID25992.
KEGGhsa:25992.
UCSCuc002wah.1. human. [Q8TER0-1]

Organism-specific databases

CTD25992.
GeneCardsGC02P241938.
H-InvDBHIX0002988.
HGNCHGNC:24696. SNED1.
HPAHPA036414.
HPA036415.
neXtProtNX_Q8TER0.
PharmGKBPA134946370.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG242910.
HOVERGENHBG108495.
InParanoidQ8TER0.
OMASKTIRRI.
OrthoDBEOG7F24S0.
PhylomeDBQ8TER0.
TreeFamTF335195.

Gene expression databases

ArrayExpressQ8TER0.
BgeeQ8TER0.
CleanExHS_SNED1.
GenevestigatorQ8TER0.

Family and domain databases

Gene3D2.60.40.10. 3 hits.
InterProIPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR003961. Fibronectin_type3.
IPR003645. Fol_N.
IPR013783. Ig-like_fold.
IPR003886. Nidogen_extracell_dom.
IPR000436. Sushi_SCR_CCP.
[Graphical view]
PfamPF00008. EGF. 11 hits.
PF00041. fn3. 3 hits.
PF12661. hEGF. 2 hits.
PF06119. NIDO. 1 hit.
[Graphical view]
SMARTSM00032. CCP. 1 hit.
SM00181. EGF. 10 hits.
SM00179. EGF_CA. 5 hits.
SM00060. FN3. 3 hits.
SM00274. FOLN. 2 hits.
SM00539. NIDO. 1 hit.
[Graphical view]
SUPFAMSSF49265. SSF49265. 2 hits.
SSF57535. SSF57535. 1 hit.
PROSITEPS00010. ASX_HYDROXYL. 5 hits.
PS00022. EGF_1. 15 hits.
PS01186. EGF_2. 13 hits.
PS50026. EGF_3. 15 hits.
PS01187. EGF_CA. 3 hits.
PS50853. FN3. 3 hits.
PS51220. NIDO. 1 hit.
PS50923. SUSHI. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi25992.
NextBio47694.
PROQ8TER0.

Entry information

Entry nameSNED1_HUMAN
AccessionPrimary (citable) accession number: Q8TER0
Secondary accession number(s): B5MDC3 expand/collapse secondary AC list , B7WNK6, B7WPM0, Q336F4, Q336F5, Q8N369, Q8TEP7
Entry history
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: July 9, 2014
This is version 100 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM