Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8TER0

- SNED1_HUMAN

UniProt

Q8TER0 - SNED1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Sushi, nidogen and EGF-like domain-containing protein 1

Gene

SNED1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

  1. calcium ion binding Source: InterPro

GO - Biological processi

  1. cell-matrix adhesion Source: InterPro
Complete GO annotation...

Keywords - Ligandi

Calcium

Names & Taxonomyi

Protein namesi
Recommended name:
Sushi, nidogen and EGF-like domain-containing protein 1
Alternative name(s):
Insulin-responsive sequence DNA-binding protein 1
Short name:
IRE-BP1
Gene namesi
Name:SNED1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:24696. SNED1.

Subcellular locationi

Secreted Curated

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134946370.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2424Sequence AnalysisAdd
BLAST
Chaini25 – 14131389Sushi, nidogen and EGF-like domain-containing protein 1PRO_0000299554Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi145 – 1451N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi272 ↔ 284By similarity
Disulfide bondi278 ↔ 297By similarity
Disulfide bondi299 ↔ 308By similarity
Disulfide bondi315 ↔ 326By similarity
Disulfide bondi320 ↔ 335By similarity
Disulfide bondi337 ↔ 346By similarity
Disulfide bondi353 ↔ 364By similarity
Disulfide bondi358 ↔ 373By similarity
Disulfide bondi375 ↔ 384By similarity
Disulfide bondi391 ↔ 402By similarity
Disulfide bondi396 ↔ 411By similarity
Glycosylationi408 – 4081N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi413 ↔ 422By similarity
Disulfide bondi433 ↔ 444By similarity
Disulfide bondi438 ↔ 453By similarity
Disulfide bondi455 ↔ 464By similarity
Disulfide bondi472 ↔ 480By similarity
Disulfide bondi474 ↔ 488By similarity
Disulfide bondi490 ↔ 499By similarity
Disulfide bondi545 ↔ 556By similarity
Disulfide bondi550 ↔ 565By similarity
Disulfide bondi567 ↔ 576By similarity
Disulfide bondi584 ↔ 595By similarity
Disulfide bondi589 ↔ 604By similarity
Disulfide bondi606 ↔ 615By similarity
Disulfide bondi623 ↔ 634By similarity
Disulfide bondi628 ↔ 643By similarity
Disulfide bondi645 ↔ 654By similarity
Disulfide bondi661 ↔ 672By similarity
Disulfide bondi666 ↔ 681By similarity
Disulfide bondi683 ↔ 692By similarity
Disulfide bondi698 ↔ 739By similarity
Disulfide bondi724 ↔ 751By similarity
Disulfide bondi757 ↔ 768By similarity
Disulfide bondi762 ↔ 777By similarity
Disulfide bondi779 ↔ 788By similarity
Disulfide bondi795 ↔ 806By similarity
Disulfide bondi800 ↔ 815By similarity
Disulfide bondi817 ↔ 826By similarity
Disulfide bondi833 ↔ 844By similarity
Disulfide bondi838 ↔ 853By similarity
Disulfide bondi855 ↔ 864By similarity
Disulfide bondi871 ↔ 882By similarity
Disulfide bondi876 ↔ 891By similarity
Disulfide bondi893 ↔ 902By similarity
Glycosylationi977 – 9771N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi1311 ↔ 1322By similarity
Disulfide bondi1316 ↔ 1331By similarity
Disulfide bondi1333 ↔ 1342By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ8TER0.
PRIDEiQ8TER0.

PTM databases

PhosphoSiteiQ8TER0.

Expressioni

Gene expression databases

BgeeiQ8TER0.
CleanExiHS_SNED1.
ExpressionAtlasiQ8TER0. baseline and differential.
GenevestigatoriQ8TER0.

Organism-specific databases

HPAiHPA036414.
HPA036415.

Interactioni

Protein-protein interaction databases

BioGridi117471. 2 interactions.
STRINGi9606.ENSP00000308893.

Structurei

3D structure databases

ProteinModelPortaliQ8TER0.
SMRiQ8TER0. Positions 273-1191, 1307-1344.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini103 – 258156NIDOPROSITE-ProRule annotationAdd
BLAST
Domaini268 – 30942EGF-like 1PROSITE-ProRule annotationAdd
BLAST
Domaini311 – 34737EGF-like 2PROSITE-ProRule annotationAdd
BLAST
Domaini349 – 38537EGF-like 3PROSITE-ProRule annotationAdd
BLAST
Domaini352 – 37423Follistatin-like 1Add
BLAST
Domaini387 – 42337EGF-like 4; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini429 – 46537EGF-like 5PROSITE-ProRule annotationAdd
BLAST
Domaini468 – 50033EGF-like 6PROSITE-ProRule annotationAdd
BLAST
Domaini507 – 53024Follistatin-like 2Add
BLAST
Domaini541 – 57737EGF-like 7PROSITE-ProRule annotationAdd
BLAST
Domaini580 – 61637EGF-like 8PROSITE-ProRule annotationAdd
BLAST
Domaini619 – 65537EGF-like 9PROSITE-ProRule annotationAdd
BLAST
Domaini657 – 69337EGF-like 10PROSITE-ProRule annotationAdd
BLAST
Domaini696 – 75358SushiPROSITE-ProRule annotationAdd
BLAST
Domaini753 – 78937EGF-like 11; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini791 – 82737EGF-like 12; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini829 – 86537EGF-like 13PROSITE-ProRule annotationAdd
BLAST
Domaini867 – 90337EGF-like 14PROSITE-ProRule annotationAdd
BLAST
Domaini908 – 100699Fibronectin type-III 1PROSITE-ProRule annotationAdd
BLAST
Domaini1007 – 110599Fibronectin type-III 2PROSITE-ProRule annotationAdd
BLAST
Domaini1106 – 120095Fibronectin type-III 3PROSITE-ProRule annotationAdd
BLAST
Domaini1307 – 134337EGF-like 15PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 15 EGF-like domains.PROSITE-ProRule annotation
Contains 3 fibronectin type-III domains.PROSITE-ProRule annotation
Contains 2 follistatin-like domains.Curated
Contains 1 NIDO domain.PROSITE-ProRule annotation
Contains 1 Sushi (CCP/SCR) domain.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Repeat, Signal, Sushi

Phylogenomic databases

eggNOGiNOG242910.
GeneTreeiENSGT00760000118786.
HOVERGENiHBG108495.
InParanoidiQ8TER0.
OMAiSKTIRRI.
OrthoDBiEOG7F24S0.
PhylomeDBiQ8TER0.
TreeFamiTF335195.

Family and domain databases

Gene3Di2.60.40.10. 3 hits.
InterProiIPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR003961. Fibronectin_type3.
IPR003645. Fol_N.
IPR013783. Ig-like_fold.
IPR003886. Nidogen_extracell_dom.
IPR000436. Sushi_SCR_CCP.
[Graphical view]
PfamiPF00008. EGF. 11 hits.
PF00041. fn3. 3 hits.
PF12661. hEGF. 2 hits.
PF06119. NIDO. 1 hit.
[Graphical view]
SMARTiSM00032. CCP. 1 hit.
SM00181. EGF. 10 hits.
SM00179. EGF_CA. 5 hits.
SM00060. FN3. 3 hits.
SM00274. FOLN. 2 hits.
SM00539. NIDO. 1 hit.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
SSF57535. SSF57535. 1 hit.
PROSITEiPS00010. ASX_HYDROXYL. 5 hits.
PS00022. EGF_1. 15 hits.
PS01186. EGF_2. 13 hits.
PS50026. EGF_3. 15 hits.
PS01187. EGF_CA. 3 hits.
PS50853. FN3. 3 hits.
PS51220. NIDO. 1 hit.
PS50923. SUSHI. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8TER0) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRHGVAWALL VAAALGLGAR GVRGAVALAD FYPFGAERGD AVTPKQDDGG
60 70 80 90 100
SGLRPLSVPF PFFGAEHSGL YVNNNGIISF LKEVSQFTPV AFPIAKDRCV
110 120 130 140 150
VAAFWADVDN RRAGDVYYRE ATDPAMLRRA TEDVRHYFPE LLDFNATWVF
160 170 180 190 200
VATWYRVTFF GGSSSSPVNT FQTVLITDGK LSFTIFNYES IVWTTGTHAS
210 220 230 240 250
SGGNATGLGG IAAQAGFNAG DGQRYFSIPG SRTADMAEVE TTTNVGVPGR
260 270 280 290 300
WAFRIDDAQV RVGGCGHTTS VCLALRPCLN GGKCIDDCVT GNPSYTCSCL
310 320 330 340 350
SGFTGRRCHL DVNECASQPC QNGGTCTHGI NSFRCQCPAG FGGPTCETAQ
360 370 380 390 400
SPCDTKECQH GGQCQVENGS AVCVCQAGYT GAACEMDVDD CSPDPCLNGG
410 420 430 440 450
SCVDLVGNYT CLCAEPFKGL RCETGDHPVP DACLSAPCHN GGTCVDADQG
460 470 480 490 500
YVCECPEGFM GLDCRERVPD DCECRNGGRC LGANTTLCQC PLGFFGLLCE
510 520 530 540 550
FEITAMPCNM NTQCPDGGYC MEHGGSYLCV CHTDHNASHS LPSPCDSDPC
560 570 580 590 600
FNGGSCDAHD DSYTCECPRG FHGKHCEKAR PHLCSSGPCR NGGTCKEAGG
610 620 630 640 650
EYHCSCPYRF TGRHCEIGKP DSCASGPCHN GGTCFHYIGK YKCDCPPGFS
660 670 680 690 700
GRHCEIAPSP CFRSPCVNGG TCEDRDTDFF CHCQAGYMGR RCQAEVDCGP
710 720 730 740 750
PEEVKHATLR FNGTRLGAVA LYACDRGYSL SAPSRIRVCQ PHGVWSEPPQ
760 770 780 790 800
CLEIDECRSQ PCLHGGSCQD RVAGYLCLCS TGYEGAHCEL ERDECRAHPC
810 820 830 840 850
RNGGSCRNLP GAYVCRCPAG FVGVHCETEV DACDSSPCQH GGRCESGGGA
860 870 880 890 900
YLCVCPESFF GYHCETVSDP CFSSPCGGRG YCLASNGSHS CTCKVGYTGE
910 920 930 940 950
DCAKELFPPT ALKMERVEES GVSISWNPPN GPAARQMLDG YAVTYVSSDG
960 970 980 990 1000
SYRRTDFVDR TRSSHQLQAL AAGRAYNISV FSVKRNSNNK NDISRPAVLL
1010 1020 1030 1040 1050
ARTRPRPVEG FEVTNVTAST ISVQWALHRI RHATVSGVRV SIRHPEALRD
1060 1070 1080 1090 1100
QATDVDRSVD RFTFRALLPG KRYTIQLTTL SGLRGEEHPT ESLATAPTHV
1110 1120 1130 1140 1150
WTRPLPPANL TAARVTATSA HVVWDAPTPG SLLEAYVINV TTSQSTKSRY
1160 1170 1180 1190 1200
VPNGKLASYT VRDLLPGRRY QLSVIAVQST ELGPQHSEPA HLYIITSPRD
1210 1220 1230 1240 1250
GADRRWHQGG HHPRVLKNRP PPARLPELRL LNDHSAPETP TQPPRFSELV
1260 1270 1280 1290 1300
DGRGRVSARF GGSPSKAATV RSQPTASAQL ENMEEAPKRV SLALQLPEHG
1310 1320 1330 1340 1350
SKDIGNVPGN CSENPCQNGG TCVPGADAHS CDCGPGFKGR RCELACIKVS
1360 1370 1380 1390 1400
RPCTRLFSET KAFPVWEGGV CHHVYKRVYR VHQDICFKES CESTSLKKTP
1410
NRKQSKSQTL EKS
Length:1,413
Mass (Da):152,204
Last modified:September 11, 2007 - v2
Checksum:i09BC8059234326D9
GO
Isoform 2 (identifier: Q8TER0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1273-1306: QPTASAQLENMEEAPKRVSLALQLPEHGSKDIGN → H
     1375-1402: Missing.

Note: No experimental confirmation available.

Show »
Length:1,352
Mass (Da):145,300
Checksum:iE6063435C0AA1CFD
GO
Isoform 3 (identifier: Q8TER0-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1273-1306: QPTASAQLENMEEAPKRVSLALQLPEHGSKDIGN → H
     1398-1398: K → L
     1399-1413: Missing.

Note: No experimental confirmation available.

Show »
Length:1,365
Mass (Da):146,970
Checksum:i346748DD68531BC3
GO
Isoform 4 (identifier: Q8TER0-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1306-1324: NVPGNCSENPCQNGGTCVP → SESAALVGTLGLTDCSQGP
     1325-1413: Missing.

Note: No experimental confirmation available.

Show »
Length:1,324
Mass (Da):142,073
Checksum:iAA7A732F74E755D6
GO

Sequence cautioni

The sequence AAH27939.1 differs from that shown. Reason: Intron retention. The N-terminal region arises from intron retention.
The sequence AAQ04558.1 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti546 – 5461D → N in AAQ04558. (PubMed:15194686)Curated
Sequence conflicti653 – 6531H → Y in AAQ04558. (PubMed:15194686)Curated
Sequence conflicti719 – 7191V → A in AAQ04558. (PubMed:15194686)Curated
Sequence conflicti858 – 8581S → G in AAQ04558. (PubMed:15194686)Curated
Sequence conflicti1186 – 120621HSEPA…ADRRW → Q in AAQ04558. (PubMed:15194686)CuratedAdd
BLAST

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti1228 – 12281L → P.
Corresponds to variant rs17440466 [ dbSNP | Ensembl ].
VAR_034847
Natural varianti1289 – 12891R → Q.
Corresponds to variant rs6721345 [ dbSNP | Ensembl ].
VAR_034848
Natural varianti1299 – 12991H → R.
Corresponds to variant rs6708120 [ dbSNP | Ensembl ].
VAR_034849
Natural varianti1362 – 13621A → S.1 Publication
Corresponds to variant rs2108485 [ dbSNP | Ensembl ].
VAR_034850

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1273 – 130634QPTAS…KDIGN → H in isoform 2 and isoform 3. 2 PublicationsVSP_027749Add
BLAST
Alternative sequencei1306 – 132419NVPGN…GTCVP → SESAALVGTLGLTDCSQGP in isoform 4. 1 PublicationVSP_027750Add
BLAST
Alternative sequencei1325 – 141389Missing in isoform 4. 1 PublicationVSP_027751Add
BLAST
Alternative sequencei1375 – 140228Missing in isoform 2. 1 PublicationVSP_027752Add
BLAST
Alternative sequencei1398 – 13981K → L in isoform 3. 1 PublicationVSP_027753
Alternative sequencei1399 – 141315Missing in isoform 3. 1 PublicationVSP_027754Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC005237 Genomic DNA. No translation available.
AC093585 Genomic DNA. No translation available.
AC104809 Genomic DNA. No translation available.
AK074062 mRNA. Translation: BAB84888.1.
AK074075 mRNA. Translation: BAB84901.1.
AF439717 mRNA. Translation: AAQ04558.1. Different initiation.
AF439718 mRNA. Translation: AAQ04563.1.
BC027939 mRNA. Translation: AAH27939.1. Sequence problems.
CCDSiCCDS46562.1. [Q8TER0-1]
RefSeqiNP_001073906.1. NM_001080437.1. [Q8TER0-1]
XP_006712468.1. XM_006712405.1. [Q8TER0-1]
UniGeneiHs.471834.

Genome annotation databases

EnsembliENST00000310397; ENSP00000308893; ENSG00000162804. [Q8TER0-1]
ENST00000401884; ENSP00000384871; ENSG00000162804. [Q8TER0-5]
ENST00000405547; ENSP00000386007; ENSG00000162804. [Q8TER0-3]
GeneIDi25992.
KEGGihsa:25992.
UCSCiuc002wah.1. human. [Q8TER0-1]

Polymorphism databases

DMDMi158563933.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC005237 Genomic DNA. No translation available.
AC093585 Genomic DNA. No translation available.
AC104809 Genomic DNA. No translation available.
AK074062 mRNA. Translation: BAB84888.1 .
AK074075 mRNA. Translation: BAB84901.1 .
AF439717 mRNA. Translation: AAQ04558.1 . Different initiation.
AF439718 mRNA. Translation: AAQ04563.1 .
BC027939 mRNA. Translation: AAH27939.1 . Sequence problems.
CCDSi CCDS46562.1. [Q8TER0-1 ]
RefSeqi NP_001073906.1. NM_001080437.1. [Q8TER0-1 ]
XP_006712468.1. XM_006712405.1. [Q8TER0-1 ]
UniGenei Hs.471834.

3D structure databases

ProteinModelPortali Q8TER0.
SMRi Q8TER0. Positions 273-1191, 1307-1344.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 117471. 2 interactions.
STRINGi 9606.ENSP00000308893.

PTM databases

PhosphoSitei Q8TER0.

Polymorphism databases

DMDMi 158563933.

Proteomic databases

PaxDbi Q8TER0.
PRIDEi Q8TER0.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000310397 ; ENSP00000308893 ; ENSG00000162804 . [Q8TER0-1 ]
ENST00000401884 ; ENSP00000384871 ; ENSG00000162804 . [Q8TER0-5 ]
ENST00000405547 ; ENSP00000386007 ; ENSG00000162804 . [Q8TER0-3 ]
GeneIDi 25992.
KEGGi hsa:25992.
UCSCi uc002wah.1. human. [Q8TER0-1 ]

Organism-specific databases

CTDi 25992.
GeneCardsi GC02P241938.
H-InvDB HIX0002988.
HGNCi HGNC:24696. SNED1.
HPAi HPA036414.
HPA036415.
neXtProti NX_Q8TER0.
PharmGKBi PA134946370.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG242910.
GeneTreei ENSGT00760000118786.
HOVERGENi HBG108495.
InParanoidi Q8TER0.
OMAi SKTIRRI.
OrthoDBi EOG7F24S0.
PhylomeDBi Q8TER0.
TreeFami TF335195.

Miscellaneous databases

GenomeRNAii 25992.
NextBioi 47694.
PROi Q8TER0.

Gene expression databases

Bgeei Q8TER0.
CleanExi HS_SNED1.
ExpressionAtlasi Q8TER0. baseline and differential.
Genevestigatori Q8TER0.

Family and domain databases

Gene3Di 2.60.40.10. 3 hits.
InterProi IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR003961. Fibronectin_type3.
IPR003645. Fol_N.
IPR013783. Ig-like_fold.
IPR003886. Nidogen_extracell_dom.
IPR000436. Sushi_SCR_CCP.
[Graphical view ]
Pfami PF00008. EGF. 11 hits.
PF00041. fn3. 3 hits.
PF12661. hEGF. 2 hits.
PF06119. NIDO. 1 hit.
[Graphical view ]
SMARTi SM00032. CCP. 1 hit.
SM00181. EGF. 10 hits.
SM00179. EGF_CA. 5 hits.
SM00060. FN3. 3 hits.
SM00274. FOLN. 2 hits.
SM00539. NIDO. 1 hit.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 2 hits.
SSF57535. SSF57535. 1 hit.
PROSITEi PS00010. ASX_HYDROXYL. 5 hits.
PS00022. EGF_1. 15 hits.
PS01186. EGF_2. 13 hits.
PS50026. EGF_3. 15 hits.
PS01187. EGF_CA. 3 hits.
PS50853. FN3. 3 hits.
PS51220. NIDO. 1 hit.
PS50923. SUSHI. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "The nucleotide sequence of a long cDNA clone isolated from human spleen."
    Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O.
    Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 132-1413 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 831-1413 (ISOFORM 2).
    Tissue: Spleen.
  3. "Insulin-response element-binding protein 1: a novel Akt substrate involved in transcriptional action of insulin."
    Villafuerte B.C., Phillips L.S., Rane M.J., Zhao W.
    J. Biol. Chem. 279:36650-36659(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 367-1413 (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 938-1413 (ISOFORM 4).
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 791-1413 (ISOFORM 3), VARIANT SER-1362.
    Tissue: Lung.

Entry informationi

Entry nameiSNED1_HUMAN
AccessioniPrimary (citable) accession number: Q8TER0
Secondary accession number(s): B5MDC3
, B7WNK6, B7WPM0, Q336F4, Q336F5, Q8N369, Q8TEP7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: October 29, 2014
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3