Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8TEQ0

- SNX29_HUMAN

UniProt

Q8TEQ0 - SNX29_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Sorting nexin-29

Gene

SNX29

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. phosphatidylinositol binding Source: InterPro
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Sorting nexin-29
Alternative name(s):
RUN domain-containing protein 2A
Gene namesi
Name:SNX29
Synonyms:RUNDC2A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:30542. SNX29.

Subcellular locationi

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProt
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142670962.
PA162404312.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 813813Sorting nexin-29PRO_0000297565Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei268 – 2681PhosphoserineBy similarity
Modified residuei344 – 3441PhosphoserineBy similarity
Modified residuei445 – 4451PhosphoserineBy similarity
Modified residuei450 – 4501PhosphoserineBy similarity
Modified residuei641 – 6411PhosphothreonineBy similarity
Modified residuei642 – 6421PhosphoserineBy similarity
Modified residuei646 – 6461PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8TEQ0.
PaxDbiQ8TEQ0.
PRIDEiQ8TEQ0.

PTM databases

PhosphoSiteiQ8TEQ0.

Expressioni

Gene expression databases

BgeeiQ8TEQ0.
CleanExiHS_RUNDC2A.
HS_SNX29.
ExpressionAtlasiQ8TEQ0. baseline and differential.
GenevestigatoriQ8TEQ0.

Organism-specific databases

HPAiHPA008889.
HPA045269.

Interactioni

Protein-protein interaction databases

BioGridi124903. 2 interactions.
IntActiQ8TEQ0. 2 interactions.
STRINGi9606.ENSP00000306940.

Structurei

3D structure databases

ProteinModelPortaliQ8TEQ0.
SMRiQ8TEQ0. Positions 50-185, 658-772.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini36 – 180145RUNPROSITE-ProRule annotationAdd
BLAST
Domaini656 – 779124PXPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili466 – 54580Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Belongs to the sorting nexin family.Curated
Contains 1 PX (phox homology) domain.PROSITE-ProRule annotation
Contains 1 RUN domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG86473.
GeneTreeiENSGT00730000110975.
HOGENOMiHOG000170771.
HOVERGENiHBG108498.
InParanoidiQ8TEQ0.
KOiK17935.
OMAiEKPLDGN.
OrthoDBiEOG7G1V60.

Family and domain databases

Gene3Di3.30.1520.10. 1 hit.
InterProiIPR001683. Phox.
IPR004012. Run.
[Graphical view]
PfamiPF00787. PX. 1 hit.
PF02759. RUN. 1 hit.
[Graphical view]
SMARTiSM00312. PX. 1 hit.
SM00593. RUN. 1 hit.
[Graphical view]
SUPFAMiSSF64268. SSF64268. 1 hit.
PROSITEiPS50195. PX. 1 hit.
PS50826. RUN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8TEQ0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSGSQNNDKR QFLLERLLDA VKQCQIRFGG RKEIASDSDS RVTCLCAQFE
60 70 80 90 100
AVLQHGLKRS RGLALTAAAI KQAAGFASKT ETEPVFWYYV KEVLNKHELQ
110 120 130 140 150
RFYSLRHIAS DVGRGRAWLR CALNEHSLER YLHMLLADRC RLSTFYEDWS
160 170 180 190 200
FVMDEERSSM LPTMAAGLNS ILFAINIDNK DLNGQSKFAP TVSDLLKEST
210 220 230 240 250
QNVTSLLKES TQGVSSLFRE ITASSAVSIL IKPEQETDPL PVVSRNVSAD
260 270 280 290 300
AKCKKERKKK KKVTNIISFD DEEDEQNSGD VFKKTPGAGE SSEDNSDRSS
310 320 330 340 350
VNIMSAFESP FGPNSNGSQS SNSWKIDSLS LNGEFGYQKL DVKSIDDEDV
360 370 380 390 400
DENEDDVYGN SSGRKHRGHS ESPEKPLEGN TCLSQMHSWA PLKVLHNDSD
410 420 430 440 450
ILFPVSGVGS YSPADAPLGS LENGTGPEDH VLPDPGLRYS VEASSPGHGS
460 470 480 490 500
PLSSLLPSAS VPESMTISEL RQATVAMMNR KDELEEENRS LRNLLDGEME
510 520 530 540 550
HSAALRQEVD TLKRKVAEQE ERQGMKVQAL ARENEVLKVQ LKKYVGAVQM
560 570 580 590 600
LKREGQTAEV PNLWSVDGEV TVAEQKPGEI AEELASSYER KLIEVAEMHG
610 620 630 640 650
ELIEFNERLH RALVAKEALV SQMRQELIDL RGPVPGDLSQ TSEDQSLSDF
660 670 680 690 700
EISNRALINV WIPSVFLRGK AANAFHVYQV YIRIKDDEWN IYRRYTEFRS
710 720 730 740 750
LHHKLQNKYP QVRAYNFPPK KAIGNKDAKF VEERRKQLQN YLRSVMNKVI
760 770 780 790 800
QMVPEFAASP KKETLIQLMP FFVDITPPGE PVNSRPKAAS RFPKLSRGQP
810
RETRNVEPQS GDL
Length:813
Mass (Da):91,254
Last modified:October 19, 2011 - v3
Checksum:iA1868A682CCFBE0C
GO
Isoform 2 (identifier: Q8TEQ0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     775-813: ITPPGEPVNSRPKAASRFPKLSRGQPRETRNVEPQSGDL → WISLFGNGRDSSREEFSSS

Note: No experimental confirmation available.

Show »
Length:793
Mass (Da):89,144
Checksum:iD6EA31956390331B
GO

Sequence cautioni

The sequence BAB14033.1 differs from that shown. Reason: Probable cloning artifact.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti183 – 1831N → D in BAB14033. (PubMed:14702039)Curated
Sequence conflicti344 – 3441S → G in BAB14033. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei775 – 81339ITPPG…QSGDL → WISLFGNGRDSSREEFSSS in isoform 2. 1 PublicationVSP_027281Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC007216 Genomic DNA. No translation available.
AC007598 Genomic DNA. No translation available.
AC007601 Genomic DNA. No translation available.
AC010333 Genomic DNA. No translation available.
AC092365 Genomic DNA. No translation available.
AC131391 Genomic DNA. No translation available.
AK022425 mRNA. Translation: BAB14033.1. Sequence problems.
AK074072 mRNA. Translation: BAB84898.1.
BC029857 mRNA. Translation: AAH29857.1.
CCDSiCCDS10553.2. [Q8TEQ0-1]
RefSeqiNP_115543.3. NM_032167.4. [Q8TEQ0-1]
UniGeneiHs.458401.

Genome annotation databases

EnsembliENST00000564791; ENSP00000457017; ENSG00000048471.
ENST00000566228; ENSP00000456480; ENSG00000048471. [Q8TEQ0-1]
GeneIDi92017.
KEGGihsa:92017.
UCSCiuc002dby.5. human. [Q8TEQ0-1]

Polymorphism databases

DMDMi353526314.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC007216 Genomic DNA. No translation available.
AC007598 Genomic DNA. No translation available.
AC007601 Genomic DNA. No translation available.
AC010333 Genomic DNA. No translation available.
AC092365 Genomic DNA. No translation available.
AC131391 Genomic DNA. No translation available.
AK022425 mRNA. Translation: BAB14033.1 . Sequence problems.
AK074072 mRNA. Translation: BAB84898.1 .
BC029857 mRNA. Translation: AAH29857.1 .
CCDSi CCDS10553.2. [Q8TEQ0-1 ]
RefSeqi NP_115543.3. NM_032167.4. [Q8TEQ0-1 ]
UniGenei Hs.458401.

3D structure databases

ProteinModelPortali Q8TEQ0.
SMRi Q8TEQ0. Positions 50-185, 658-772.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124903. 2 interactions.
IntActi Q8TEQ0. 2 interactions.
STRINGi 9606.ENSP00000306940.

PTM databases

PhosphoSitei Q8TEQ0.

Polymorphism databases

DMDMi 353526314.

Proteomic databases

MaxQBi Q8TEQ0.
PaxDbi Q8TEQ0.
PRIDEi Q8TEQ0.

Protocols and materials databases

DNASUi 92017.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000564791 ; ENSP00000457017 ; ENSG00000048471 .
ENST00000566228 ; ENSP00000456480 ; ENSG00000048471 . [Q8TEQ0-1 ]
GeneIDi 92017.
KEGGi hsa:92017.
UCSCi uc002dby.5. human. [Q8TEQ0-1 ]

Organism-specific databases

CTDi 92017.
GeneCardsi GC16P012071.
H-InvDB HIX0012826.
HGNCi HGNC:30542. SNX29.
HPAi HPA008889.
HPA045269.
neXtProti NX_Q8TEQ0.
PharmGKBi PA142670962.
PA162404312.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG86473.
GeneTreei ENSGT00730000110975.
HOGENOMi HOG000170771.
HOVERGENi HBG108498.
InParanoidi Q8TEQ0.
KOi K17935.
OMAi EKPLDGN.
OrthoDBi EOG7G1V60.

Miscellaneous databases

ChiTaRSi SNX29. human.
GenomeRNAii 92017.
NextBioi 77562.
PROi Q8TEQ0.

Gene expression databases

Bgeei Q8TEQ0.
CleanExi HS_RUNDC2A.
HS_SNX29.
ExpressionAtlasi Q8TEQ0. baseline and differential.
Genevestigatori Q8TEQ0.

Family and domain databases

Gene3Di 3.30.1520.10. 1 hit.
InterProi IPR001683. Phox.
IPR004012. Run.
[Graphical view ]
Pfami PF00787. PX. 1 hit.
PF02759. RUN. 1 hit.
[Graphical view ]
SMARTi SM00312. PX. 1 hit.
SM00593. RUN. 1 hit.
[Graphical view ]
SUPFAMi SSF64268. SSF64268. 1 hit.
PROSITEi PS50195. PX. 1 hit.
PS50826. RUN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-375 (ISOFORM 1).
    Tissue: Mammary gland.
  3. "Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones."
    Jikuya H., Takano J., Kikuno R., Hirosawa M., Nagase T., Nomura N., Ohara O.
    DNA Res. 10:49-57(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 441-813 (ISOFORM 1).
    Tissue: Spleen.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 512-813 (ISOFORM 2).
    Tissue: Brain.
  5. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiSNX29_HUMAN
AccessioniPrimary (citable) accession number: Q8TEQ0
Secondary accession number(s): B5MDW2, Q8N2X2, Q9HA26
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: October 19, 2011
Last modified: October 29, 2014
This is version 81 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3