Q8TEQ0 (SNX29_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 67.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sorting nexin-29 Alternative name(s): RUN domain-containing protein 2A | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 813 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Sequence similarities | Belongs to the sorting nexin family. Contains 1 PX (phox homology) domain. Contains 1 RUN domain. |
| Sequence caution | The sequence BAB14033.1 differs from that shown. Reason: Probable cloning artifact. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell communication Inferred from electronic annotation. Source: InterPro |
| Molecular_function | phosphatidylinositol binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8TEQ0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8TEQ0-2) The sequence of this isoform differs from the canonical sequence as follows: 775-813: ITPPGEPVNSRPKAASRFPKLSRGQPRETRNVEPQSGDL → WISLFGNGRDSSREEFSSS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 813 | 813 | Sorting nexin-29 | PRO_0000297565 | |||||
Regions | |||||||||
| Domain | 36 – 180 | 145 | RUN | ||||||
| Domain | 656 – 779 | 124 | PX | ||||||
| Coiled coil | 466 – 545 | 80 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 641 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 642 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 775 – 813 | 39 | ITPPG…QSGDL → WISLFGNGRDSSREEFSSS in isoform 2. | VSP_027281 | |||||
Experimental info | |||||||||
| Sequence conflict | 183 | 1 | N → D in BAB14033. Ref.2 | ||||||
| Sequence conflict | 344 | 1 | S → G in BAB14033. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-375 (ISOFORM 1). Tissue: Mammary gland. |
| [3] | "Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones." Jikuya H., Takano J., Kikuno R., Hirosawa M., Nagase T., Nomura N., Ohara O. DNA Res. 10:49-57(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 441-813 (ISOFORM 1). Tissue: Spleen. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 512-813 (ISOFORM 2). Tissue: Brain. |
| [5] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [6] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [7] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [8] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC007216 Genomic DNA. No translation available. AC007598 Genomic DNA. No translation available. AC007601 Genomic DNA. No translation available. AC010333 Genomic DNA. No translation available. AC092365 Genomic DNA. No translation available. AC131391 Genomic DNA. No translation available. AK022425 mRNA. Translation: BAB14033.1. Sequence problems. AK074072 mRNA. Translation: BAB84898.1. BC029857 mRNA. Translation: AAH29857.1. |
| IPI | IPI00166504. IPI00855845. |
| RefSeq | NP_115543.3. NM_032167.3. |
| UniGene | Hs.458401. |
3D structure databases | |
| ProteinModelPortal | Q8TEQ0. |
| SMR | Q8TEQ0. Positions 50-185, 658-772. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8TEQ0. 2 interactions. |
| STRING | 9606.ENSP00000306940. |
PTM databases | |
| PhosphoSite | Q8TEQ0. |
Polymorphism databases | |
| DMDM | 296452885. |
Proteomic databases | |
| PaxDb | Q8TEQ0. |
| PRIDE | Q8TEQ0. |
Protocols and materials databases | |
| DNASU | 92017. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000564791; ENSP00000457017; ENSG00000048471. ENST00000566228; ENSP00000456480; ENSG00000048471. |
| GeneID | 92017. |
| KEGG | hsa:92017. |
| UCSC | uc002dbw.2. human. uc002dby.4. human. |
Organism-specific databases | |
| CTD | 92017. |
| GeneCards | GC16P012146. |
| H-InvDB | HIX0012826. |
| HGNC | HGNC:30542. SNX29. |
| HPA | HPA008889. |
| neXtProt | NX_Q8TEQ0. |
| PharmGKB | PA142670962. PA162404312. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG86473. |
| HOGENOM | HOG000170771. |
| HOVERGEN | HBG108498. |
| InParanoid | Q8TEQ0. |
| OrthoDB | EOG4BK53S. |
Gene expression databases | |
| ArrayExpress | Q8TEQ0. |
| Bgee | Q8TEQ0. |
| CleanEx | HS_RUNDC2A. HS_SNX29. |
| Genevestigator | Q8TEQ0. |
Family and domain databases | |
| Gene3D | 3.30.1520.10. 1 hit. |
| InterPro | IPR001683. Phox. IPR004012. Run. [Graphical view] |
| Pfam | PF00787. PX. 1 hit. PF02759. RUN. 1 hit. [Graphical view] |
| SMART | SM00312. PX. 1 hit. SM00593. RUN. 1 hit. [Graphical view] |
| SUPFAM | SSF64268. PX. 1 hit. |
| PROSITE | PS50195. PX. 1 hit. PS50826. RUN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SNX29. human. |
| GenomeRNAi | 92017. |
| NextBio | 77562. |
Entry information
| Entry name | SNX29_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8TEQ0 Secondary accession number(s): B5MDW2, Q8N2X2, Q9HA26 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
