Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8TEQ0

- SNX29_HUMAN

UniProt

Q8TEQ0 - SNX29_HUMAN

Protein

Sorting nexin-29

Gene

SNX29

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 80 (01 Oct 2014)
      Sequence version 3 (19 Oct 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. phosphatidylinositol binding Source: InterPro

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sorting nexin-29
    Alternative name(s):
    RUN domain-containing protein 2A
    Gene namesi
    Name:SNX29
    Synonyms:RUNDC2A
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:30542. SNX29.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular vesicular exosome Source: UniProt

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142670962.
    PA162404312.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 813813Sorting nexin-29PRO_0000297565Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei268 – 2681PhosphoserineBy similarity
    Modified residuei344 – 3441PhosphoserineBy similarity
    Modified residuei445 – 4451PhosphoserineBy similarity
    Modified residuei450 – 4501PhosphoserineBy similarity
    Modified residuei641 – 6411PhosphothreonineBy similarity
    Modified residuei642 – 6421PhosphoserineBy similarity
    Modified residuei646 – 6461PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ8TEQ0.
    PaxDbiQ8TEQ0.
    PRIDEiQ8TEQ0.

    PTM databases

    PhosphoSiteiQ8TEQ0.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8TEQ0.
    BgeeiQ8TEQ0.
    CleanExiHS_RUNDC2A.
    HS_SNX29.
    GenevestigatoriQ8TEQ0.

    Organism-specific databases

    HPAiHPA008889.
    HPA045269.

    Interactioni

    Protein-protein interaction databases

    BioGridi124903. 1 interaction.
    IntActiQ8TEQ0. 2 interactions.
    STRINGi9606.ENSP00000306940.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8TEQ0.
    SMRiQ8TEQ0. Positions 50-185, 658-772.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini36 – 180145RUNPROSITE-ProRule annotationAdd
    BLAST
    Domaini656 – 779124PXPROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili466 – 54580Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the sorting nexin family.Curated
    Contains 1 PX (phox homology) domain.PROSITE-ProRule annotation
    Contains 1 RUN domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG86473.
    HOGENOMiHOG000170771.
    HOVERGENiHBG108498.
    InParanoidiQ8TEQ0.
    KOiK17935.
    OMAiEKPLDGN.
    OrthoDBiEOG7G1V60.

    Family and domain databases

    Gene3Di3.30.1520.10. 1 hit.
    InterProiIPR001683. Phox.
    IPR004012. Run.
    [Graphical view]
    PfamiPF00787. PX. 1 hit.
    PF02759. RUN. 1 hit.
    [Graphical view]
    SMARTiSM00312. PX. 1 hit.
    SM00593. RUN. 1 hit.
    [Graphical view]
    SUPFAMiSSF64268. SSF64268. 1 hit.
    PROSITEiPS50195. PX. 1 hit.
    PS50826. RUN. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8TEQ0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSGSQNNDKR QFLLERLLDA VKQCQIRFGG RKEIASDSDS RVTCLCAQFE    50
    AVLQHGLKRS RGLALTAAAI KQAAGFASKT ETEPVFWYYV KEVLNKHELQ 100
    RFYSLRHIAS DVGRGRAWLR CALNEHSLER YLHMLLADRC RLSTFYEDWS 150
    FVMDEERSSM LPTMAAGLNS ILFAINIDNK DLNGQSKFAP TVSDLLKEST 200
    QNVTSLLKES TQGVSSLFRE ITASSAVSIL IKPEQETDPL PVVSRNVSAD 250
    AKCKKERKKK KKVTNIISFD DEEDEQNSGD VFKKTPGAGE SSEDNSDRSS 300
    VNIMSAFESP FGPNSNGSQS SNSWKIDSLS LNGEFGYQKL DVKSIDDEDV 350
    DENEDDVYGN SSGRKHRGHS ESPEKPLEGN TCLSQMHSWA PLKVLHNDSD 400
    ILFPVSGVGS YSPADAPLGS LENGTGPEDH VLPDPGLRYS VEASSPGHGS 450
    PLSSLLPSAS VPESMTISEL RQATVAMMNR KDELEEENRS LRNLLDGEME 500
    HSAALRQEVD TLKRKVAEQE ERQGMKVQAL ARENEVLKVQ LKKYVGAVQM 550
    LKREGQTAEV PNLWSVDGEV TVAEQKPGEI AEELASSYER KLIEVAEMHG 600
    ELIEFNERLH RALVAKEALV SQMRQELIDL RGPVPGDLSQ TSEDQSLSDF 650
    EISNRALINV WIPSVFLRGK AANAFHVYQV YIRIKDDEWN IYRRYTEFRS 700
    LHHKLQNKYP QVRAYNFPPK KAIGNKDAKF VEERRKQLQN YLRSVMNKVI 750
    QMVPEFAASP KKETLIQLMP FFVDITPPGE PVNSRPKAAS RFPKLSRGQP 800
    RETRNVEPQS GDL 813
    Length:813
    Mass (Da):91,254
    Last modified:October 19, 2011 - v3
    Checksum:iA1868A682CCFBE0C
    GO
    Isoform 2 (identifier: Q8TEQ0-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         775-813: ITPPGEPVNSRPKAASRFPKLSRGQPRETRNVEPQSGDL → WISLFGNGRDSSREEFSSS

    Note: No experimental confirmation available.

    Show »
    Length:793
    Mass (Da):89,144
    Checksum:iD6EA31956390331B
    GO

    Sequence cautioni

    The sequence BAB14033.1 differs from that shown. Reason: Probable cloning artifact.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti183 – 1831N → D in BAB14033. (PubMed:14702039)Curated
    Sequence conflicti344 – 3441S → G in BAB14033. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei775 – 81339ITPPG…QSGDL → WISLFGNGRDSSREEFSSS in isoform 2. 1 PublicationVSP_027281Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC007216 Genomic DNA. No translation available.
    AC007598 Genomic DNA. No translation available.
    AC007601 Genomic DNA. No translation available.
    AC010333 Genomic DNA. No translation available.
    AC092365 Genomic DNA. No translation available.
    AC131391 Genomic DNA. No translation available.
    AK022425 mRNA. Translation: BAB14033.1. Sequence problems.
    AK074072 mRNA. Translation: BAB84898.1.
    BC029857 mRNA. Translation: AAH29857.1.
    CCDSiCCDS10553.2. [Q8TEQ0-1]
    RefSeqiNP_115543.3. NM_032167.3. [Q8TEQ0-1]
    UniGeneiHs.458401.

    Genome annotation databases

    EnsembliENST00000564791; ENSP00000457017; ENSG00000048471.
    ENST00000566228; ENSP00000456480; ENSG00000048471. [Q8TEQ0-1]
    GeneIDi92017.
    KEGGihsa:92017.
    UCSCiuc002dby.5. human. [Q8TEQ0-1]

    Polymorphism databases

    DMDMi353526314.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC007216 Genomic DNA. No translation available.
    AC007598 Genomic DNA. No translation available.
    AC007601 Genomic DNA. No translation available.
    AC010333 Genomic DNA. No translation available.
    AC092365 Genomic DNA. No translation available.
    AC131391 Genomic DNA. No translation available.
    AK022425 mRNA. Translation: BAB14033.1 . Sequence problems.
    AK074072 mRNA. Translation: BAB84898.1 .
    BC029857 mRNA. Translation: AAH29857.1 .
    CCDSi CCDS10553.2. [Q8TEQ0-1 ]
    RefSeqi NP_115543.3. NM_032167.3. [Q8TEQ0-1 ]
    UniGenei Hs.458401.

    3D structure databases

    ProteinModelPortali Q8TEQ0.
    SMRi Q8TEQ0. Positions 50-185, 658-772.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124903. 1 interaction.
    IntActi Q8TEQ0. 2 interactions.
    STRINGi 9606.ENSP00000306940.

    PTM databases

    PhosphoSitei Q8TEQ0.

    Polymorphism databases

    DMDMi 353526314.

    Proteomic databases

    MaxQBi Q8TEQ0.
    PaxDbi Q8TEQ0.
    PRIDEi Q8TEQ0.

    Protocols and materials databases

    DNASUi 92017.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000564791 ; ENSP00000457017 ; ENSG00000048471 .
    ENST00000566228 ; ENSP00000456480 ; ENSG00000048471 . [Q8TEQ0-1 ]
    GeneIDi 92017.
    KEGGi hsa:92017.
    UCSCi uc002dby.5. human. [Q8TEQ0-1 ]

    Organism-specific databases

    CTDi 92017.
    GeneCardsi GC16P012146.
    H-InvDB HIX0012826.
    HGNCi HGNC:30542. SNX29.
    HPAi HPA008889.
    HPA045269.
    neXtProti NX_Q8TEQ0.
    PharmGKBi PA142670962.
    PA162404312.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG86473.
    HOGENOMi HOG000170771.
    HOVERGENi HBG108498.
    InParanoidi Q8TEQ0.
    KOi K17935.
    OMAi EKPLDGN.
    OrthoDBi EOG7G1V60.

    Miscellaneous databases

    ChiTaRSi SNX29. human.
    GenomeRNAii 92017.
    NextBioi 77562.
    PROi Q8TEQ0.

    Gene expression databases

    ArrayExpressi Q8TEQ0.
    Bgeei Q8TEQ0.
    CleanExi HS_RUNDC2A.
    HS_SNX29.
    Genevestigatori Q8TEQ0.

    Family and domain databases

    Gene3Di 3.30.1520.10. 1 hit.
    InterProi IPR001683. Phox.
    IPR004012. Run.
    [Graphical view ]
    Pfami PF00787. PX. 1 hit.
    PF02759. RUN. 1 hit.
    [Graphical view ]
    SMARTi SM00312. PX. 1 hit.
    SM00593. RUN. 1 hit.
    [Graphical view ]
    SUPFAMi SSF64268. SSF64268. 1 hit.
    PROSITEi PS50195. PX. 1 hit.
    PS50826. RUN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The sequence and analysis of duplication-rich human chromosome 16."
      Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
      , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
      Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-375 (ISOFORM 1).
      Tissue: Mammary gland.
    3. "Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones."
      Jikuya H., Takano J., Kikuno R., Hirosawa M., Nagase T., Nomura N., Ohara O.
      DNA Res. 10:49-57(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 441-813 (ISOFORM 1).
      Tissue: Spleen.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 512-813 (ISOFORM 2).
      Tissue: Brain.
    5. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiSNX29_HUMAN
    AccessioniPrimary (citable) accession number: Q8TEQ0
    Secondary accession number(s): B5MDW2, Q8N2X2, Q9HA26
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 21, 2007
    Last sequence update: October 19, 2011
    Last modified: October 1, 2014
    This is version 80 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3