Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8TEQ0 (SNX29_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 78. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Sorting nexin-29
Alternative name(s):
RUN domain-containing protein 2A
Gene names
Name:SNX29
Synonyms:RUNDC2A
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length813 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Sequence similarities

Belongs to the sorting nexin family.

Contains 1 PX (phox homology) domain.

Contains 1 RUN domain.

Sequence caution

The sequence BAB14033.1 differs from that shown. Reason: Probable cloning artifact.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   DomainCoiled coil
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Molecular_functionphosphatidylinositol binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8TEQ0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8TEQ0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     775-813: ITPPGEPVNSRPKAASRFPKLSRGQPRETRNVEPQSGDL → WISLFGNGRDSSREEFSSS
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 813813Sorting nexin-29
PRO_0000297565

Regions

Domain36 – 180145RUN
Domain656 – 779124PX
Coiled coil466 – 54580 Potential

Amino acid modifications

Modified residue2681Phosphoserine By similarity
Modified residue3441Phosphoserine By similarity
Modified residue4451Phosphoserine By similarity
Modified residue4501Phosphoserine By similarity
Modified residue6411Phosphothreonine By similarity
Modified residue6421Phosphoserine By similarity
Modified residue6461Phosphoserine By similarity

Natural variations

Alternative sequence775 – 81339ITPPG…QSGDL → WISLFGNGRDSSREEFSSS in isoform 2.
VSP_027281

Experimental info

Sequence conflict1831N → D in BAB14033. Ref.2
Sequence conflict3441S → G in BAB14033. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 19, 2011. Version 3.
Checksum: A1868A682CCFBE0C

FASTA81391,254
        10         20         30         40         50         60 
MSGSQNNDKR QFLLERLLDA VKQCQIRFGG RKEIASDSDS RVTCLCAQFE AVLQHGLKRS 

        70         80         90        100        110        120 
RGLALTAAAI KQAAGFASKT ETEPVFWYYV KEVLNKHELQ RFYSLRHIAS DVGRGRAWLR 

       130        140        150        160        170        180 
CALNEHSLER YLHMLLADRC RLSTFYEDWS FVMDEERSSM LPTMAAGLNS ILFAINIDNK 

       190        200        210        220        230        240 
DLNGQSKFAP TVSDLLKEST QNVTSLLKES TQGVSSLFRE ITASSAVSIL IKPEQETDPL 

       250        260        270        280        290        300 
PVVSRNVSAD AKCKKERKKK KKVTNIISFD DEEDEQNSGD VFKKTPGAGE SSEDNSDRSS 

       310        320        330        340        350        360 
VNIMSAFESP FGPNSNGSQS SNSWKIDSLS LNGEFGYQKL DVKSIDDEDV DENEDDVYGN 

       370        380        390        400        410        420 
SSGRKHRGHS ESPEKPLEGN TCLSQMHSWA PLKVLHNDSD ILFPVSGVGS YSPADAPLGS 

       430        440        450        460        470        480 
LENGTGPEDH VLPDPGLRYS VEASSPGHGS PLSSLLPSAS VPESMTISEL RQATVAMMNR 

       490        500        510        520        530        540 
KDELEEENRS LRNLLDGEME HSAALRQEVD TLKRKVAEQE ERQGMKVQAL ARENEVLKVQ 

       550        560        570        580        590        600 
LKKYVGAVQM LKREGQTAEV PNLWSVDGEV TVAEQKPGEI AEELASSYER KLIEVAEMHG 

       610        620        630        640        650        660 
ELIEFNERLH RALVAKEALV SQMRQELIDL RGPVPGDLSQ TSEDQSLSDF EISNRALINV 

       670        680        690        700        710        720 
WIPSVFLRGK AANAFHVYQV YIRIKDDEWN IYRRYTEFRS LHHKLQNKYP QVRAYNFPPK 

       730        740        750        760        770        780 
KAIGNKDAKF VEERRKQLQN YLRSVMNKVI QMVPEFAASP KKETLIQLMP FFVDITPPGE 

       790        800        810 
PVNSRPKAAS RFPKLSRGQP RETRNVEPQS GDL 

« Hide

Isoform 2 [UniParc].

Checksum: D6EA31956390331B
Show »

FASTA79389,144

References

[1]"The sequence and analysis of duplication-rich human chromosome 16."
Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. expand/collapse author list , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-375 (ISOFORM 1).
Tissue: Mammary gland.
[3]"Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones."
Jikuya H., Takano J., Kikuno R., Hirosawa M., Nagase T., Nomura N., Ohara O.
DNA Res. 10:49-57(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 441-813 (ISOFORM 1).
Tissue: Spleen.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 512-813 (ISOFORM 2).
Tissue: Brain.
[5]"Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[6]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[7]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[8]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AC007216 Genomic DNA. No translation available.
AC007598 Genomic DNA. No translation available.
AC007601 Genomic DNA. No translation available.
AC010333 Genomic DNA. No translation available.
AC092365 Genomic DNA. No translation available.
AC131391 Genomic DNA. No translation available.
AK022425 mRNA. Translation: BAB14033.1. Sequence problems.
AK074072 mRNA. Translation: BAB84898.1.
BC029857 mRNA. Translation: AAH29857.1.
CCDSCCDS10553.2. [Q8TEQ0-1]
RefSeqNP_115543.3. NM_032167.3. [Q8TEQ0-1]
UniGeneHs.458401.

3D structure databases

ProteinModelPortalQ8TEQ0.
SMRQ8TEQ0. Positions 50-185, 658-772.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid124903. 1 interaction.
IntActQ8TEQ0. 2 interactions.
STRING9606.ENSP00000306940.

PTM databases

PhosphoSiteQ8TEQ0.

Polymorphism databases

DMDM353526314.

Proteomic databases

MaxQBQ8TEQ0.
PaxDbQ8TEQ0.
PRIDEQ8TEQ0.

Protocols and materials databases

DNASU92017.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000564791; ENSP00000457017; ENSG00000048471.
ENST00000566228; ENSP00000456480; ENSG00000048471. [Q8TEQ0-1]
GeneID92017.
KEGGhsa:92017.
UCSCuc002dby.5. human. [Q8TEQ0-1]

Organism-specific databases

CTD92017.
GeneCardsGC16P012146.
H-InvDBHIX0012826.
HGNCHGNC:30542. SNX29.
HPAHPA008889.
HPA045269.
neXtProtNX_Q8TEQ0.
PharmGKBPA142670962.
PA162404312.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG86473.
HOGENOMHOG000170771.
HOVERGENHBG108498.
InParanoidQ8TEQ0.
KOK17935.
OMAEKPLDGN.
OrthoDBEOG7G1V60.

Gene expression databases

ArrayExpressQ8TEQ0.
BgeeQ8TEQ0.
CleanExHS_RUNDC2A.
HS_SNX29.
GenevestigatorQ8TEQ0.

Family and domain databases

Gene3D3.30.1520.10. 1 hit.
InterProIPR001683. Phox.
IPR004012. Run.
[Graphical view]
PfamPF00787. PX. 1 hit.
PF02759. RUN. 1 hit.
[Graphical view]
SMARTSM00312. PX. 1 hit.
SM00593. RUN. 1 hit.
[Graphical view]
SUPFAMSSF64268. SSF64268. 1 hit.
PROSITEPS50195. PX. 1 hit.
PS50826. RUN. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSSNX29. human.
GenomeRNAi92017.
NextBio77562.
PROQ8TEQ0.

Entry information

Entry nameSNX29_HUMAN
AccessionPrimary (citable) accession number: Q8TEQ0
Secondary accession number(s): B5MDW2, Q8N2X2, Q9HA26
Entry history
Integrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: October 19, 2011
Last modified: July 9, 2014
This is version 78 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 16

Human chromosome 16: entries, gene names and cross-references to MIM