Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8TEH3 (DEN1A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 85. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
DENN domain-containing protein 1A
Alternative name(s):
Connecdenn 1
Short name=Connecdenn
Protein FAM31A
Gene names
Name:DENND1A
Synonyms:FAM31A, KIAA1608
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1009 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Guanine nucleotide exchange factor (GEF) regulating clathrin-mediated endocytosis through RAB35 activation. Promotes the exchange of GDP to GTP, converting inactive GDP-bound RAB35 into its active GTP-bound form. Regulates clathrin-mediated endocytosis of synaptic vesicles. Ref.10 Ref.11

Subunit structure

Interacts with ITSN1 AND SH3GL2 By similarity. Interacts with RAB35. Interacts with clathrin and with the adapter protein complex 2, AP-2. Ref.10 Ref.11

Subcellular location

Cytoplasmic vesicleclathrin-coated vesicle membrane; Peripheral membrane protein. Cell junctionsynapsepresynaptic cell membrane Ref.11.

Sequence similarities

Contains 1 dDENN domain.

Contains 1 DENN domain.

Contains 1 uDENN domain.

Sequence caution

The sequence AAH09616.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence AAH28061.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence BAH13155.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8TEH3-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8TEH3-2)

The sequence of this isoform differs from the canonical sequence as follows:
     527-559: PQPYRTLRESDSAEGDEAESPEQQVRKSTGPVP → NTIATPATLHILQKSITHFAAKFPTRGWTSSSH
     560-1009: Missing.
Isoform 3 (identifier: Q8TEH3-3)

The sequence of this isoform differs from the canonical sequence as follows:
     497-498: VR → AL
     499-1009: Missing.
Isoform 4 (identifier: Q8TEH3-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.
     33-60: VQRQFPEDYSDQEVLQTLTKFCFPFYVD → MLKWPIPGQVALFQILRCRGNSRRTTVT
     497-498: VR → AL
     499-1009: Missing.
Isoform 5 (identifier: Q8TEH3-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: Missing.
     31-43: PEVQRQFPEDYSD → MLKWPIPGQVALF
     527-559: PQPYRTLRESDSAEGDEAESPEQQVRKSTGPVP → NTIATPATLHILQKSITHFAAKFPTRGWTSSSH
     560-1009: Missing.
Isoform 6 (identifier: Q8TEH3-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.
     33-42: VQRQFPEDYS → MRRPGDHGLQ
     526-526: Q → HLVKPLRHYAVFLSEDSSDDECQREEGPSSGFTESFFFSAPFEW
Note: No experimental confirmation available.
Isoform 7 (identifier: Q8TEH3-7)

The sequence of this isoform differs from the canonical sequence as follows:
     290-331: Missing.
     526-526: Q → HLVKPLRHYAVFLSEDSSDDECQREEGPSSGFTESFFFSAPFEW
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10091009DENN domain-containing protein 1A
PRO_0000242680

Regions

Domain24 – 9168UDENN
Domain92 – 273182DENN
Domain304 – 37168dDENN
Compositional bias649 – 995347Pro-rich

Amino acid modifications

Modified residue4731Phosphoserine By similarity
Modified residue5191Phosphothreonine Ref.8
Modified residue5201Phosphoserine Ref.8 Ref.13
Modified residue5231Phosphoserine Ref.6 Ref.8 Ref.13
Modified residue5361Phosphoserine Ref.8
Modified residue5381Phosphoserine Ref.8 Ref.9
Modified residue5461Phosphoserine Ref.8 Ref.9
Modified residue5921Phosphoserine Ref.5 Ref.7 Ref.12 Ref.13

Natural variations

Alternative sequence1 – 3232Missing in isoform 4 and isoform 6.
VSP_034509
Alternative sequence1 – 3030Missing in isoform 5.
VSP_034510
Alternative sequence31 – 4313PEVQR…EDYSD → MLKWPIPGQVALF in isoform 5.
VSP_034511
Alternative sequence33 – 6028VQRQF…PFYVD → MLKWPIPGQVALFQILRCRG NSRRTTVT in isoform 4.
VSP_034512
Alternative sequence33 – 4210VQRQFPEDYS → MRRPGDHGLQ in isoform 6.
VSP_040666
Alternative sequence290 – 33142Missing in isoform 7.
VSP_040667
Alternative sequence497 – 4982VR → AL in isoform 3 and isoform 4.
VSP_034513
Alternative sequence499 – 1009511Missing in isoform 3 and isoform 4.
VSP_034514
Alternative sequence5261Q → HLVKPLRHYAVFLSEDSSDD ECQREEGPSSGFTESFFFSA PFEW in isoform 6 and isoform 7.
VSP_040668
Alternative sequence527 – 55933PQPYR…TGPVP → NTIATPATLHILQKSITHFA AKFPTRGWTSSSH in isoform 2 and isoform 5.
VSP_019464
Alternative sequence560 – 1009450Missing in isoform 2 and isoform 5.
VSP_019465

Experimental info

Sequence conflict4561E → G in BAB15002. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 27, 2006. Version 2.
Checksum: ECEE79CFCD5E2D0C

FASTA1,009110,577
        10         20         30         40         50         60 
MGSRIKQNPE TTFEVYVEVA YPRTGGTLSD PEVQRQFPED YSDQEVLQTL TKFCFPFYVD 

        70         80         90        100        110        120 
SLTVSQVGQN FTFVLTDIDS KQRFGFCRLS SGAKSCFCIL SYLPWFEVFY KLLNILADYT 

       130        140        150        160        170        180 
TKRQENQWNE LLETLHKLPI PDPGVSVHLS VHSYFTVPDT RELPSIPENR NLTEYFVAVD 

       190        200        210        220        230        240 
VNNMLHLYAS MLYERRILII CSKLSTLTAC IHGSAAMLYP MYWQHVYIPV LPPHLLDYCC 

       250        260        270        280        290        300 
APMPYLIGIH LSLMEKVRNM ALDDVVILNV DTNTLETPFD DLQSLPNDVI SSLKNRLKKV 

       310        320        330        340        350        360 
STTTGDGVAR AFLKAQAAFF GSYRNALKIE PEEPITFCEE AFVSHYRSGA MRQFLQNATQ 

       370        380        390        400        410        420 
LQLFKQFIDG RLDLLNSGEG FSDVFEEEIN MGEYAGSDKL YHQWLSTVRK GSGAILNTVK 

       430        440        450        460        470        480 
TKANPAMKTV YKFAKDHAKM GIKEVKNRLK QKDIAENGCA PTPEEQLPKT APSPLVEAKD 

       490        500        510        520        530        540 
PKLREDRRPI TVHFGQVRPP RPHVVKRPKS NIAVEGRRTS VPSPEQPQPY RTLRESDSAE 

       550        560        570        580        590        600 
GDEAESPEQQ VRKSTGPVPA PPDRAASIDL LEDVFSNLDM EAALQPLGQA KSLEDLRAPK 

       610        620        630        640        650        660 
DLREQPGTFD YQRLDLGGSE RSRGVTVALK LTHPYNKLWS LGQDDMAIPS KPPAASPEKP 

       670        680        690        700        710        720 
SALLGNSLAL PRRPQNRDSI LNPSDKEEVP TPTLGSITIP RPQGRKTPEL GIVPPPPIPR 

       730        740        750        760        770        780 
PAKLQAAGAA LGDVSERLQT DRDRRAALSP GLLPGVVPQG PTELLQPLSP GPGAAGTSSD 

       790        800        810        820        830        840 
ALLALLDPLS TAWSGSTLPS RPATPNVATP FTPQFSFPPA GTPTPFPQPP LNPFVPSMPA 

       850        860        870        880        890        900 
APPTLPLVST PAGPFGAPPA SLGPAFASGL LLSSAGFCAP HRSQPNLSAL SMPNLFGQMP 

       910        920        930        940        950        960 
MGTHTSPLQP LGPPAVAPSR IRTLPLARSS ARAAETKQGL ALRPGDPPLL PPRPPQGLEP 

       970        980        990       1000 
TLQPSAPQQA RDPFEDLLQK TKQDVSPSPA LAPAPDSVEQ LRKQWETFE 

« Hide

Isoform 2 [UniParc].

Checksum: 64F3CCFF1755CFF9
Show »

FASTA55963,389
Isoform 3 [UniParc].

Checksum: 143F57353E24EC46
Show »

FASTA49856,613
Isoform 4 [UniParc].

Checksum: 98353ACDF34D2AE5
Show »

FASTA46652,857
Isoform 5 [UniParc].

Checksum: C8D1C7E8FDBA6A9A
Show »

FASTA52959,950
Isoform 6 [UniParc].

Checksum: 4B5FC1CCC9F465C9
Show »

FASTA1,020111,887
Isoform 7 [UniParc].

Checksum: 1276C13494EBD925
Show »

FASTA1,010111,005

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 114-1009 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 217-1009 (ISOFORM 7).
Tissue: Artery smooth muscle, Fetal brain, Hippocampus and Spleen.
[2]"DNA sequence and analysis of human chromosome 9."
Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. expand/collapse author list , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 4 AND 5).
Tissue: Placenta.
[5]"Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-592, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[6]"Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-523, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[7]"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-592, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-519; SER-520; SER-523; SER-536; SER-538 AND SER-546, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-538 AND SER-546, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[10]"The connecdenn family, Rab35 guanine nucleotide exchange factors interfacing with the clathrin machinery."
Marat A.L., McPherson P.S.
J. Biol. Chem. 285:10627-10637(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION (ISOFORM 1), FUNCTION, INTERACTION WITH AP2A2; CLTC AND RAB35.
[11]"Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors."
Yoshimura S., Gerondopoulos A., Linford A., Rigden D.J., Barr F.A.
J. Cell Biol. 191:367-381(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH CLATHRIN AND AP-2, SUBCELLULAR LOCATION.
[12]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-592, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[13]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-520; SER-523 AND SER-592, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK024782 mRNA. Translation: BAB15002.1.
AK074151 mRNA. Translation: BAB84977.1.
AK295710 mRNA. Translation: BAH12164.1.
AK299867 mRNA. Translation: BAH13155.1. Different initiation.
AL445489 expand/collapse EMBL AC list , AL161790, AL390774, AC006450 Genomic DNA. Translation: CAI39791.1.
AL445489 expand/collapse EMBL AC list , AC006450, AL390774, AL161790 Genomic DNA. Translation: CAI39792.1.
AL390774 expand/collapse EMBL AC list , AC006450, AL161790, AL445489 Genomic DNA. Translation: CAH73640.1.
AL161790 expand/collapse EMBL AC list , AC006450, AL445489, AL390774 Genomic DNA. Translation: CAI15705.1.
AL161790 expand/collapse EMBL AC list , AC006450, AL390774, AL445489 Genomic DNA. Translation: CAI15706.1.
AL161790 expand/collapse EMBL AC list , AC006450, AL390774, AL445489 Genomic DNA. Translation: CAI15707.1.
AL390774 expand/collapse EMBL AC list , AC006450, AL445489, AL161790 Genomic DNA. Translation: CAH73637.1.
AL390774 expand/collapse EMBL AC list , AC006450, AL445489, AL161790 Genomic DNA. Translation: CAH73638.1.
AL445489 expand/collapse EMBL AC list , AC006450, AL161790, AL390774 Genomic DNA. Translation: CAI39794.1.
CH471090 Genomic DNA. Translation: EAW87571.1.
CH471090 Genomic DNA. Translation: EAW87575.1.
BC009616 mRNA. Translation: AAH09616.1. Different initiation.
BC028061 mRNA. Translation: AAH28061.1. Different initiation.
BC039703 mRNA. Translation: AAH39703.1.
BK006958 mRNA. Translation: DAA12500.1.
RefSeqNP_065997.1. NM_020946.1.
NP_079096.2. NM_024820.2.
UniGeneHs.744995.

3D structure databases

ProteinModelPortalQ8TEH3.
SMRQ8TEH3. Positions 1-376.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid121730. 1 interaction.
IntActQ8TEH3. 1 interaction.
STRING9606.ENSP00000362727.

PTM databases

PhosphoSiteQ8TEH3.

Polymorphism databases

DMDM109825594.

Proteomic databases

PaxDbQ8TEH3.
PRIDEQ8TEH3.

Protocols and materials databases

DNASU57706.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000373618; ENSP00000362720; ENSG00000119522. [Q8TEH3-4]
ENST00000373620; ENSP00000362722; ENSG00000119522. [Q8TEH3-2]
ENST00000373624; ENSP00000362727; ENSG00000119522. [Q8TEH3-1]
ENST00000394215; ENSP00000377763; ENSG00000119522. [Q8TEH3-5]
ENST00000394219; ENSP00000377766; ENSG00000119522. [Q8TEH3-6]
ENST00000542603; ENSP00000437457; ENSG00000119522.
GeneID57706.
KEGGhsa:57706.
UCSCuc004bnz.1. human. [Q8TEH3-1]
uc004boa.1. human. [Q8TEH3-2]
uc004bob.1. human. [Q8TEH3-5]
uc004boc.3. human. [Q8TEH3-4]
uc011lzl.1. human. [Q8TEH3-7]
uc011lzm.1. human. [Q8TEH3-6]

Organism-specific databases

CTD57706.
GeneCardsGC09M126141.
H-InvDBHIX0008366.
HGNCHGNC:29324. DENND1A.
HPAHPA020481.
MIM613633. gene.
neXtProtNX_Q8TEH3.
PharmGKBPA134876117.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG316099.
HOVERGENHBG059210.
OMASISSPEX.
OrthoDBEOG73Z2SH.
PhylomeDBQ8TEH3.
TreeFamTF343037.

Gene expression databases

BgeeQ8TEH3.
CleanExHS_DENND1A.
GenevestigatorQ8TEH3.

Family and domain databases

InterProIPR005112. dDENN_dom.
IPR001194. DENN_dom.
IPR005113. uDENN_dom.
[Graphical view]
PfamPF03455. dDENN. 1 hit.
PF02141. DENN. 1 hit.
PF03456. uDENN. 1 hit.
[Graphical view]
SMARTSM00801. dDENN. 1 hit.
SM00799. DENN. 1 hit.
SM00800. uDENN. 1 hit.
[Graphical view]
PROSITEPS50947. DDENN. 1 hit.
PS50211. DENN. 1 hit.
PS50946. UDENN. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSDENND1A. human.
GeneWikiDENND1A.
GenomeRNAi57706.
NextBio64584.
PROQ8TEH3.
SOURCESearch...

Entry information

Entry nameDEN1A_HUMAN
AccessionPrimary (citable) accession number: Q8TEH3
Secondary accession number(s): A8MZA3 expand/collapse secondary AC list , B1AM80, B7Z3C8, B7Z669, D3PFD3, Q05C88, Q5VWF0, Q6PJZ5, Q8IVD6, Q9H796
Entry history
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 27, 2006
Last modified: April 16, 2014
This is version 85 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 9

Human chromosome 9: entries, gene names and cross-references to MIM