Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8TEH3

- DEN1A_HUMAN

UniProt

Q8TEH3 - DEN1A_HUMAN

Protein

DENN domain-containing protein 1A

Gene

DENND1A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 88 (01 Oct 2014)
      Sequence version 2 (27 Jun 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Guanine nucleotide exchange factor (GEF) regulating clathrin-mediated endocytosis through RAB35 activation. Promotes the exchange of GDP to GTP, converting inactive GDP-bound RAB35 into its active GTP-bound form. Regulates clathrin-mediated endocytosis of synaptic vesicles.2 Publications

    GO - Molecular functioni

    1. Rab guanyl-nucleotide exchange factor activity Source: UniProtKB

    GO - Biological processi

    1. endocytosis Source: UniProtKB
    2. positive regulation of Rab GTPase activity Source: GOC
    3. protein transport Source: UniProtKB-KW
    4. regulation of Rab protein signal transduction Source: FlyBase
    5. synaptic vesicle endocytosis Source: Ensembl

    Keywords - Molecular functioni

    Guanine-nucleotide releasing factor

    Keywords - Biological processi

    Protein transport, Transport

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    DENN domain-containing protein 1A
    Alternative name(s):
    Connecdenn 1
    Short name:
    Connecdenn
    Protein FAM31A
    Gene namesi
    Name:DENND1A
    Synonyms:FAM31A, KIAA1608
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 9

    Organism-specific databases

    HGNCiHGNC:29324. DENND1A.

    Subcellular locationi

    Cytoplasmic vesicleclathrin-coated vesicle membrane 1 Publication; Peripheral membrane protein 1 Publication. Cell junctionsynapsepresynaptic cell membrane 1 Publication

    GO - Cellular componenti

    1. cell junction Source: UniProtKB-KW
    2. clathrin-coated vesicle Source: UniProtKB
    3. clathrin-coated vesicle membrane Source: UniProtKB-SubCell
    4. dendrite Source: Ensembl
    5. neuronal cell body Source: Ensembl
    6. presynaptic membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Cytoplasmic vesicle, Membrane, Synapse

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134876117.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10091009DENN domain-containing protein 1APRO_0000242680Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei473 – 4731PhosphoserineBy similarity
    Modified residuei519 – 5191Phosphothreonine1 Publication
    Modified residuei520 – 5201Phosphoserine2 Publications
    Modified residuei523 – 5231Phosphoserine3 Publications
    Modified residuei536 – 5361Phosphoserine1 Publication
    Modified residuei538 – 5381Phosphoserine2 Publications
    Modified residuei546 – 5461Phosphoserine2 Publications
    Modified residuei592 – 5921Phosphoserine4 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ8TEH3.
    PaxDbiQ8TEH3.
    PRIDEiQ8TEH3.

    PTM databases

    PhosphoSiteiQ8TEH3.

    Expressioni

    Gene expression databases

    BgeeiQ8TEH3.
    CleanExiHS_DENND1A.
    GenevestigatoriQ8TEH3.

    Organism-specific databases

    HPAiHPA020481.

    Interactioni

    Subunit structurei

    Interacts with ITSN1 AND SH3GL2 By similarity. Interacts with RAB35. Interacts with clathrin and with the adapter protein complex 2, AP-2.By similarity2 Publications

    Protein-protein interaction databases

    BioGridi121730. 1 interaction.
    IntActiQ8TEH3. 1 interaction.
    STRINGi9606.ENSP00000362727.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8TEH3.
    SMRiQ8TEH3. Positions 1-376.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini24 – 9168UDENNAdd
    BLAST
    Domaini92 – 273182DENNPROSITE-ProRule annotationAdd
    BLAST
    Domaini304 – 37168dDENNPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi649 – 995347Pro-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 dDENN domain.PROSITE-ProRule annotation
    Contains 1 DENN domain.PROSITE-ProRule annotation
    Contains 1 uDENN domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG316099.
    HOVERGENiHBG059210.
    OMAiSISSPEX.
    OrthoDBiEOG73Z2SH.
    PhylomeDBiQ8TEH3.
    TreeFamiTF343037.

    Family and domain databases

    InterProiIPR005112. dDENN_dom.
    IPR001194. DENN_dom.
    IPR005113. uDENN_dom.
    [Graphical view]
    PfamiPF03455. dDENN. 1 hit.
    PF02141. DENN. 1 hit.
    PF03456. uDENN. 1 hit.
    [Graphical view]
    SMARTiSM00801. dDENN. 1 hit.
    SM00799. DENN. 1 hit.
    SM00800. uDENN. 1 hit.
    [Graphical view]
    PROSITEiPS50947. DDENN. 1 hit.
    PS50211. DENN. 1 hit.
    PS50946. UDENN. 1 hit.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8TEH3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGSRIKQNPE TTFEVYVEVA YPRTGGTLSD PEVQRQFPED YSDQEVLQTL     50
    TKFCFPFYVD SLTVSQVGQN FTFVLTDIDS KQRFGFCRLS SGAKSCFCIL 100
    SYLPWFEVFY KLLNILADYT TKRQENQWNE LLETLHKLPI PDPGVSVHLS 150
    VHSYFTVPDT RELPSIPENR NLTEYFVAVD VNNMLHLYAS MLYERRILII 200
    CSKLSTLTAC IHGSAAMLYP MYWQHVYIPV LPPHLLDYCC APMPYLIGIH 250
    LSLMEKVRNM ALDDVVILNV DTNTLETPFD DLQSLPNDVI SSLKNRLKKV 300
    STTTGDGVAR AFLKAQAAFF GSYRNALKIE PEEPITFCEE AFVSHYRSGA 350
    MRQFLQNATQ LQLFKQFIDG RLDLLNSGEG FSDVFEEEIN MGEYAGSDKL 400
    YHQWLSTVRK GSGAILNTVK TKANPAMKTV YKFAKDHAKM GIKEVKNRLK 450
    QKDIAENGCA PTPEEQLPKT APSPLVEAKD PKLREDRRPI TVHFGQVRPP 500
    RPHVVKRPKS NIAVEGRRTS VPSPEQPQPY RTLRESDSAE GDEAESPEQQ 550
    VRKSTGPVPA PPDRAASIDL LEDVFSNLDM EAALQPLGQA KSLEDLRAPK 600
    DLREQPGTFD YQRLDLGGSE RSRGVTVALK LTHPYNKLWS LGQDDMAIPS 650
    KPPAASPEKP SALLGNSLAL PRRPQNRDSI LNPSDKEEVP TPTLGSITIP 700
    RPQGRKTPEL GIVPPPPIPR PAKLQAAGAA LGDVSERLQT DRDRRAALSP 750
    GLLPGVVPQG PTELLQPLSP GPGAAGTSSD ALLALLDPLS TAWSGSTLPS 800
    RPATPNVATP FTPQFSFPPA GTPTPFPQPP LNPFVPSMPA APPTLPLVST 850
    PAGPFGAPPA SLGPAFASGL LLSSAGFCAP HRSQPNLSAL SMPNLFGQMP 900
    MGTHTSPLQP LGPPAVAPSR IRTLPLARSS ARAAETKQGL ALRPGDPPLL 950
    PPRPPQGLEP TLQPSAPQQA RDPFEDLLQK TKQDVSPSPA LAPAPDSVEQ 1000
    LRKQWETFE 1009
    Length:1,009
    Mass (Da):110,577
    Last modified:June 27, 2006 - v2
    Checksum:iECEE79CFCD5E2D0C
    GO
    Isoform 2 (identifier: Q8TEH3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         527-559: PQPYRTLRESDSAEGDEAESPEQQVRKSTGPVP → NTIATPATLHILQKSITHFAAKFPTRGWTSSSH
         560-1009: Missing.

    Show »
    Length:559
    Mass (Da):63,389
    Checksum:i64F3CCFF1755CFF9
    GO
    Isoform 3 (identifier: Q8TEH3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         497-498: VR → AL
         499-1009: Missing.

    Show »
    Length:498
    Mass (Da):56,613
    Checksum:i143F57353E24EC46
    GO
    Isoform 4 (identifier: Q8TEH3-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: Missing.
         33-60: VQRQFPEDYSDQEVLQTLTKFCFPFYVD → MLKWPIPGQVALFQILRCRGNSRRTTVT
         497-498: VR → AL
         499-1009: Missing.

    Show »
    Length:466
    Mass (Da):52,857
    Checksum:i98353ACDF34D2AE5
    GO
    Isoform 5 (identifier: Q8TEH3-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-30: Missing.
         31-43: PEVQRQFPEDYSD → MLKWPIPGQVALF
         527-559: PQPYRTLRESDSAEGDEAESPEQQVRKSTGPVP → NTIATPATLHILQKSITHFAAKFPTRGWTSSSH
         560-1009: Missing.

    Show »
    Length:529
    Mass (Da):59,950
    Checksum:iC8D1C7E8FDBA6A9A
    GO
    Isoform 6 (identifier: Q8TEH3-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: Missing.
         33-42: VQRQFPEDYS → MRRPGDHGLQ
         526-526: Q → HLVKPLRHYAVFLSEDSSDDECQREEGPSSGFTESFFFSAPFEW

    Note: No experimental confirmation available.

    Show »
    Length:1,020
    Mass (Da):111,887
    Checksum:i4B5FC1CCC9F465C9
    GO
    Isoform 7 (identifier: Q8TEH3-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         290-331: Missing.
         526-526: Q → HLVKPLRHYAVFLSEDSSDDECQREEGPSSGFTESFFFSAPFEW

    Note: No experimental confirmation available.

    Show »
    Length:1,010
    Mass (Da):111,005
    Checksum:i1276C13494EBD925
    GO

    Sequence cautioni

    The sequence AAH09616.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAH28061.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence BAH13155.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti456 – 4561E → G in BAB15002. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3232Missing in isoform 4 and isoform 6. 2 PublicationsVSP_034509Add
    BLAST
    Alternative sequencei1 – 3030Missing in isoform 5. 1 PublicationVSP_034510Add
    BLAST
    Alternative sequencei31 – 4313PEVQR…EDYSD → MLKWPIPGQVALF in isoform 5. 1 PublicationVSP_034511Add
    BLAST
    Alternative sequencei33 – 6028VQRQF…PFYVD → MLKWPIPGQVALFQILRCRG NSRRTTVT in isoform 4. 1 PublicationVSP_034512Add
    BLAST
    Alternative sequencei33 – 4210VQRQFPEDYS → MRRPGDHGLQ in isoform 6. 1 PublicationVSP_040666
    Alternative sequencei290 – 33142Missing in isoform 7. 1 PublicationVSP_040667Add
    BLAST
    Alternative sequencei497 – 4982VR → AL in isoform 3 and isoform 4. 1 PublicationVSP_034513
    Alternative sequencei499 – 1009511Missing in isoform 3 and isoform 4. 1 PublicationVSP_034514Add
    BLAST
    Alternative sequencei526 – 5261Q → HLVKPLRHYAVFLSEDSSDD ECQREEGPSSGFTESFFFSA PFEW in isoform 6 and isoform 7. 1 PublicationVSP_040668
    Alternative sequencei527 – 55933PQPYR…TGPVP → NTIATPATLHILQKSITHFA AKFPTRGWTSSSH in isoform 2 and isoform 5. 2 PublicationsVSP_019464Add
    BLAST
    Alternative sequencei560 – 1009450Missing in isoform 2 and isoform 5. 2 PublicationsVSP_019465Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK024782 mRNA. Translation: BAB15002.1.
    AK074151 mRNA. Translation: BAB84977.1.
    AK295710 mRNA. Translation: BAH12164.1.
    AK299867 mRNA. Translation: BAH13155.1. Different initiation.
    AL445489
    , AL161790, AL390774, AC006450 Genomic DNA. Translation: CAI39791.1.
    AL445489
    , AC006450, AL390774, AL161790 Genomic DNA. Translation: CAI39792.1.
    AL390774
    , AC006450, AL161790, AL445489 Genomic DNA. Translation: CAH73640.1.
    AL161790
    , AC006450, AL445489, AL390774 Genomic DNA. Translation: CAI15705.1.
    AL161790
    , AC006450, AL390774, AL445489 Genomic DNA. Translation: CAI15706.1.
    AL161790
    , AC006450, AL390774, AL445489 Genomic DNA. Translation: CAI15707.1.
    AL390774
    , AC006450, AL445489, AL161790 Genomic DNA. Translation: CAH73637.1.
    AL390774
    , AC006450, AL445489, AL161790 Genomic DNA. Translation: CAH73638.1.
    AL445489
    , AC006450, AL161790, AL390774 Genomic DNA. Translation: CAI39794.1.
    CH471090 Genomic DNA. Translation: EAW87571.1.
    CH471090 Genomic DNA. Translation: EAW87575.1.
    BC009616 mRNA. Translation: AAH09616.1. Different initiation.
    BC028061 mRNA. Translation: AAH28061.1. Different initiation.
    BC039703 mRNA. Translation: AAH39703.1.
    BK006958 mRNA. Translation: DAA12500.1.
    CCDSiCCDS35133.1. [Q8TEH3-1]
    CCDS35134.1. [Q8TEH3-2]
    RefSeqiNP_065997.1. NM_020946.1. [Q8TEH3-1]
    NP_079096.2. NM_024820.2. [Q8TEH3-2]
    UniGeneiHs.744995.

    Genome annotation databases

    EnsembliENST00000373618; ENSP00000362720; ENSG00000119522. [Q8TEH3-4]
    ENST00000373620; ENSP00000362722; ENSG00000119522. [Q8TEH3-2]
    ENST00000373624; ENSP00000362727; ENSG00000119522. [Q8TEH3-1]
    ENST00000394215; ENSP00000377763; ENSG00000119522. [Q8TEH3-5]
    ENST00000394219; ENSP00000377766; ENSG00000119522. [Q8TEH3-6]
    GeneIDi57706.
    KEGGihsa:57706.
    UCSCiuc004bnz.1. human. [Q8TEH3-1]
    uc004boa.1. human. [Q8TEH3-2]
    uc004bob.1. human. [Q8TEH3-5]
    uc004boc.3. human. [Q8TEH3-4]
    uc011lzl.1. human. [Q8TEH3-7]
    uc011lzm.1. human. [Q8TEH3-6]

    Polymorphism databases

    DMDMi109825594.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK024782 mRNA. Translation: BAB15002.1 .
    AK074151 mRNA. Translation: BAB84977.1 .
    AK295710 mRNA. Translation: BAH12164.1 .
    AK299867 mRNA. Translation: BAH13155.1 . Different initiation.
    AL445489
    , AL161790 , AL390774 , AC006450 Genomic DNA. Translation: CAI39791.1 .
    AL445489
    , AC006450 , AL390774 , AL161790 Genomic DNA. Translation: CAI39792.1 .
    AL390774
    , AC006450 , AL161790 , AL445489 Genomic DNA. Translation: CAH73640.1 .
    AL161790
    , AC006450 , AL445489 , AL390774 Genomic DNA. Translation: CAI15705.1 .
    AL161790
    , AC006450 , AL390774 , AL445489 Genomic DNA. Translation: CAI15706.1 .
    AL161790
    , AC006450 , AL390774 , AL445489 Genomic DNA. Translation: CAI15707.1 .
    AL390774
    , AC006450 , AL445489 , AL161790 Genomic DNA. Translation: CAH73637.1 .
    AL390774
    , AC006450 , AL445489 , AL161790 Genomic DNA. Translation: CAH73638.1 .
    AL445489
    , AC006450 , AL161790 , AL390774 Genomic DNA. Translation: CAI39794.1 .
    CH471090 Genomic DNA. Translation: EAW87571.1 .
    CH471090 Genomic DNA. Translation: EAW87575.1 .
    BC009616 mRNA. Translation: AAH09616.1 . Different initiation.
    BC028061 mRNA. Translation: AAH28061.1 . Different initiation.
    BC039703 mRNA. Translation: AAH39703.1 .
    BK006958 mRNA. Translation: DAA12500.1 .
    CCDSi CCDS35133.1. [Q8TEH3-1 ]
    CCDS35134.1. [Q8TEH3-2 ]
    RefSeqi NP_065997.1. NM_020946.1. [Q8TEH3-1 ]
    NP_079096.2. NM_024820.2. [Q8TEH3-2 ]
    UniGenei Hs.744995.

    3D structure databases

    ProteinModelPortali Q8TEH3.
    SMRi Q8TEH3. Positions 1-376.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121730. 1 interaction.
    IntActi Q8TEH3. 1 interaction.
    STRINGi 9606.ENSP00000362727.

    PTM databases

    PhosphoSitei Q8TEH3.

    Polymorphism databases

    DMDMi 109825594.

    Proteomic databases

    MaxQBi Q8TEH3.
    PaxDbi Q8TEH3.
    PRIDEi Q8TEH3.

    Protocols and materials databases

    DNASUi 57706.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000373618 ; ENSP00000362720 ; ENSG00000119522 . [Q8TEH3-4 ]
    ENST00000373620 ; ENSP00000362722 ; ENSG00000119522 . [Q8TEH3-2 ]
    ENST00000373624 ; ENSP00000362727 ; ENSG00000119522 . [Q8TEH3-1 ]
    ENST00000394215 ; ENSP00000377763 ; ENSG00000119522 . [Q8TEH3-5 ]
    ENST00000394219 ; ENSP00000377766 ; ENSG00000119522 . [Q8TEH3-6 ]
    GeneIDi 57706.
    KEGGi hsa:57706.
    UCSCi uc004bnz.1. human. [Q8TEH3-1 ]
    uc004boa.1. human. [Q8TEH3-2 ]
    uc004bob.1. human. [Q8TEH3-5 ]
    uc004boc.3. human. [Q8TEH3-4 ]
    uc011lzl.1. human. [Q8TEH3-7 ]
    uc011lzm.1. human. [Q8TEH3-6 ]

    Organism-specific databases

    CTDi 57706.
    GeneCardsi GC09M126141.
    H-InvDB HIX0008366.
    HGNCi HGNC:29324. DENND1A.
    HPAi HPA020481.
    MIMi 613633. gene.
    neXtProti NX_Q8TEH3.
    PharmGKBi PA134876117.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG316099.
    HOVERGENi HBG059210.
    OMAi SISSPEX.
    OrthoDBi EOG73Z2SH.
    PhylomeDBi Q8TEH3.
    TreeFami TF343037.

    Miscellaneous databases

    ChiTaRSi DENND1A. human.
    GeneWikii DENND1A.
    GenomeRNAii 57706.
    NextBioi 64584.
    PROi Q8TEH3.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8TEH3.
    CleanExi HS_DENND1A.
    Genevestigatori Q8TEH3.

    Family and domain databases

    InterProi IPR005112. dDENN_dom.
    IPR001194. DENN_dom.
    IPR005113. uDENN_dom.
    [Graphical view ]
    Pfami PF03455. dDENN. 1 hit.
    PF02141. DENN. 1 hit.
    PF03456. uDENN. 1 hit.
    [Graphical view ]
    SMARTi SM00801. dDENN. 1 hit.
    SM00799. DENN. 1 hit.
    SM00800. uDENN. 1 hit.
    [Graphical view ]
    PROSITEi PS50947. DDENN. 1 hit.
    PS50211. DENN. 1 hit.
    PS50946. UDENN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 114-1009 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 217-1009 (ISOFORM 7).
      Tissue: Artery smooth muscle, Fetal brain, Hippocampus and Spleen.
    2. "DNA sequence and analysis of human chromosome 9."
      Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
      , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
      Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 4 AND 5).
      Tissue: Placenta.
    5. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-592, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    6. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
      Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
      J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-523, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    7. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-592, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-519; SER-520; SER-523; SER-536; SER-538 AND SER-546, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-538 AND SER-546, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    10. "The connecdenn family, Rab35 guanine nucleotide exchange factors interfacing with the clathrin machinery."
      Marat A.L., McPherson P.S.
      J. Biol. Chem. 285:10627-10637(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION (ISOFORM 1), FUNCTION, INTERACTION WITH AP2A2; CLTC AND RAB35.
    11. "Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors."
      Yoshimura S., Gerondopoulos A., Linford A., Rigden D.J., Barr F.A.
      J. Cell Biol. 191:367-381(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH CLATHRIN AND AP-2, SUBCELLULAR LOCATION.
    12. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-592, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    13. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-520; SER-523 AND SER-592, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiDEN1A_HUMAN
    AccessioniPrimary (citable) accession number: Q8TEH3
    Secondary accession number(s): A8MZA3
    , B1AM80, B7Z3C8, B7Z669, D3PFD3, Q05C88, Q5VWF0, Q6PJZ5, Q8IVD6, Q9H796
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 27, 2006
    Last sequence update: June 27, 2006
    Last modified: October 1, 2014
    This is version 88 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3