SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8TEH3

- DEN1A_HUMAN

UniProt

Q8TEH3 - DEN1A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
DENN domain-containing protein 1A
Gene
DENND1A, FAM31A, KIAA1608
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Guanine nucleotide exchange factor (GEF) regulating clathrin-mediated endocytosis through RAB35 activation. Promotes the exchange of GDP to GTP, converting inactive GDP-bound RAB35 into its active GTP-bound form. Regulates clathrin-mediated endocytosis of synaptic vesicles.2 Publications

GO - Molecular functioni

  1. Rab guanyl-nucleotide exchange factor activity Source: UniProtKB
Complete GO annotation...

GO - Biological processi

  1. endocytosis Source: UniProtKB
  2. protein transport Source: UniProtKB-KW
  3. regulation of Rab GTPase activity Source: GOC
  4. regulation of Rab protein signal transduction Source: FlyBase
  5. synaptic vesicle endocytosis Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Keywords - Biological processi

Protein transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
DENN domain-containing protein 1A
Alternative name(s):
Connecdenn 1
Short name:
Connecdenn
Protein FAM31A
Gene namesi
Name:DENND1A
Synonyms:FAM31A, KIAA1608
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:29324. DENND1A.

Subcellular locationi

Cytoplasmic vesicleclathrin-coated vesicle membrane; Peripheral membrane protein. Cell junctionsynapsepresynaptic cell membrane 1 Publication

GO - Cellular componenti

  1. cell junction Source: UniProtKB-KW
  2. clathrin-coated vesicle Source: UniProtKB
  3. clathrin-coated vesicle membrane Source: UniProtKB-SubCell
  4. dendrite Source: Ensembl
  5. neuronal cell body Source: Ensembl
  6. presynaptic membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasmic vesicle, Membrane, Synapse

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134876117.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10091009DENN domain-containing protein 1A
PRO_0000242680Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei473 – 4731Phosphoserine By similarity
Modified residuei519 – 5191Phosphothreonine1 Publication
Modified residuei520 – 5201Phosphoserine2 Publications
Modified residuei523 – 5231Phosphoserine3 Publications
Modified residuei536 – 5361Phosphoserine1 Publication
Modified residuei538 – 5381Phosphoserine2 Publications
Modified residuei546 – 5461Phosphoserine2 Publications
Modified residuei592 – 5921Phosphoserine4 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8TEH3.
PaxDbiQ8TEH3.
PRIDEiQ8TEH3.

PTM databases

PhosphoSiteiQ8TEH3.

Expressioni

Gene expression databases

BgeeiQ8TEH3.
CleanExiHS_DENND1A.
GenevestigatoriQ8TEH3.

Organism-specific databases

HPAiHPA020481.

Interactioni

Subunit structurei

Interacts with ITSN1 AND SH3GL2 By similarity. Interacts with RAB35. Interacts with clathrin and with the adapter protein complex 2, AP-2.2 Publications

Protein-protein interaction databases

BioGridi121730. 1 interaction.
IntActiQ8TEH3. 1 interaction.
STRINGi9606.ENSP00000362727.

Structurei

3D structure databases

ProteinModelPortaliQ8TEH3.
SMRiQ8TEH3. Positions 1-376.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini24 – 9168UDENN
Add
BLAST
Domaini92 – 273182DENN
Add
BLAST
Domaini304 – 37168dDENN
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi649 – 995347Pro-rich
Add
BLAST

Sequence similaritiesi

Contains 1 dDENN domain.
Contains 1 DENN domain.
Contains 1 uDENN domain.

Phylogenomic databases

eggNOGiNOG316099.
HOVERGENiHBG059210.
OMAiSISSPEX.
OrthoDBiEOG73Z2SH.
PhylomeDBiQ8TEH3.
TreeFamiTF343037.

Family and domain databases

InterProiIPR005112. dDENN_dom.
IPR001194. DENN_dom.
IPR005113. uDENN_dom.
[Graphical view]
PfamiPF03455. dDENN. 1 hit.
PF02141. DENN. 1 hit.
PF03456. uDENN. 1 hit.
[Graphical view]
SMARTiSM00801. dDENN. 1 hit.
SM00799. DENN. 1 hit.
SM00800. uDENN. 1 hit.
[Graphical view]
PROSITEiPS50947. DDENN. 1 hit.
PS50211. DENN. 1 hit.
PS50946. UDENN. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8TEH3-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGSRIKQNPE TTFEVYVEVA YPRTGGTLSD PEVQRQFPED YSDQEVLQTL     50
TKFCFPFYVD SLTVSQVGQN FTFVLTDIDS KQRFGFCRLS SGAKSCFCIL 100
SYLPWFEVFY KLLNILADYT TKRQENQWNE LLETLHKLPI PDPGVSVHLS 150
VHSYFTVPDT RELPSIPENR NLTEYFVAVD VNNMLHLYAS MLYERRILII 200
CSKLSTLTAC IHGSAAMLYP MYWQHVYIPV LPPHLLDYCC APMPYLIGIH 250
LSLMEKVRNM ALDDVVILNV DTNTLETPFD DLQSLPNDVI SSLKNRLKKV 300
STTTGDGVAR AFLKAQAAFF GSYRNALKIE PEEPITFCEE AFVSHYRSGA 350
MRQFLQNATQ LQLFKQFIDG RLDLLNSGEG FSDVFEEEIN MGEYAGSDKL 400
YHQWLSTVRK GSGAILNTVK TKANPAMKTV YKFAKDHAKM GIKEVKNRLK 450
QKDIAENGCA PTPEEQLPKT APSPLVEAKD PKLREDRRPI TVHFGQVRPP 500
RPHVVKRPKS NIAVEGRRTS VPSPEQPQPY RTLRESDSAE GDEAESPEQQ 550
VRKSTGPVPA PPDRAASIDL LEDVFSNLDM EAALQPLGQA KSLEDLRAPK 600
DLREQPGTFD YQRLDLGGSE RSRGVTVALK LTHPYNKLWS LGQDDMAIPS 650
KPPAASPEKP SALLGNSLAL PRRPQNRDSI LNPSDKEEVP TPTLGSITIP 700
RPQGRKTPEL GIVPPPPIPR PAKLQAAGAA LGDVSERLQT DRDRRAALSP 750
GLLPGVVPQG PTELLQPLSP GPGAAGTSSD ALLALLDPLS TAWSGSTLPS 800
RPATPNVATP FTPQFSFPPA GTPTPFPQPP LNPFVPSMPA APPTLPLVST 850
PAGPFGAPPA SLGPAFASGL LLSSAGFCAP HRSQPNLSAL SMPNLFGQMP 900
MGTHTSPLQP LGPPAVAPSR IRTLPLARSS ARAAETKQGL ALRPGDPPLL 950
PPRPPQGLEP TLQPSAPQQA RDPFEDLLQK TKQDVSPSPA LAPAPDSVEQ 1000
LRKQWETFE 1009
Length:1,009
Mass (Da):110,577
Last modified:June 27, 2006 - v2
Checksum:iECEE79CFCD5E2D0C
GO
Isoform 2 (identifier: Q8TEH3-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     527-559: PQPYRTLRESDSAEGDEAESPEQQVRKSTGPVP → NTIATPATLHILQKSITHFAAKFPTRGWTSSSH
     560-1009: Missing.

Show »
Length:559
Mass (Da):63,389
Checksum:i64F3CCFF1755CFF9
GO
Isoform 3 (identifier: Q8TEH3-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     497-498: VR → AL
     499-1009: Missing.

Show »
Length:498
Mass (Da):56,613
Checksum:i143F57353E24EC46
GO
Isoform 4 (identifier: Q8TEH3-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.
     33-60: VQRQFPEDYSDQEVLQTLTKFCFPFYVD → MLKWPIPGQVALFQILRCRGNSRRTTVT
     497-498: VR → AL
     499-1009: Missing.

Show »
Length:466
Mass (Da):52,857
Checksum:i98353ACDF34D2AE5
GO
Isoform 5 (identifier: Q8TEH3-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: Missing.
     31-43: PEVQRQFPEDYSD → MLKWPIPGQVALF
     527-559: PQPYRTLRESDSAEGDEAESPEQQVRKSTGPVP → NTIATPATLHILQKSITHFAAKFPTRGWTSSSH
     560-1009: Missing.

Show »
Length:529
Mass (Da):59,950
Checksum:iC8D1C7E8FDBA6A9A
GO
Isoform 6 (identifier: Q8TEH3-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.
     33-42: VQRQFPEDYS → MRRPGDHGLQ
     526-526: Q → HLVKPLRHYAVFLSEDSSDDECQREEGPSSGFTESFFFSAPFEW

Note: No experimental confirmation available.

Show »
Length:1,020
Mass (Da):111,887
Checksum:i4B5FC1CCC9F465C9
GO
Isoform 7 (identifier: Q8TEH3-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     290-331: Missing.
     526-526: Q → HLVKPLRHYAVFLSEDSSDDECQREEGPSSGFTESFFFSAPFEW

Note: No experimental confirmation available.

Show »
Length:1,010
Mass (Da):111,005
Checksum:i1276C13494EBD925
GO

Sequence cautioni

The sequence AAH09616.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence AAH28061.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence BAH13155.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3232Missing in isoform 4 and isoform 6.
VSP_034509Add
BLAST
Alternative sequencei1 – 3030Missing in isoform 5.
VSP_034510Add
BLAST
Alternative sequencei31 – 4313PEVQR…EDYSD → MLKWPIPGQVALF in isoform 5.
VSP_034511Add
BLAST
Alternative sequencei33 – 6028VQRQF…PFYVD → MLKWPIPGQVALFQILRCRG NSRRTTVT in isoform 4.
VSP_034512Add
BLAST
Alternative sequencei33 – 4210VQRQFPEDYS → MRRPGDHGLQ in isoform 6.
VSP_040666
Alternative sequencei290 – 33142Missing in isoform 7.
VSP_040667Add
BLAST
Alternative sequencei497 – 4982VR → AL in isoform 3 and isoform 4.
VSP_034513
Alternative sequencei499 – 1009511Missing in isoform 3 and isoform 4.
VSP_034514Add
BLAST
Alternative sequencei526 – 5261Q → HLVKPLRHYAVFLSEDSSDD ECQREEGPSSGFTESFFFSA PFEW in isoform 6 and isoform 7.
VSP_040668
Alternative sequencei527 – 55933PQPYR…TGPVP → NTIATPATLHILQKSITHFA AKFPTRGWTSSSH in isoform 2 and isoform 5.
VSP_019464Add
BLAST
Alternative sequencei560 – 1009450Missing in isoform 2 and isoform 5.
VSP_019465Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti456 – 4561E → G in BAB15002. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK024782 mRNA. Translation: BAB15002.1.
AK074151 mRNA. Translation: BAB84977.1.
AK295710 mRNA. Translation: BAH12164.1.
AK299867 mRNA. Translation: BAH13155.1. Different initiation.
AL445489
, AL161790, AL390774, AC006450 Genomic DNA. Translation: CAI39791.1.
AL445489
, AC006450, AL390774, AL161790 Genomic DNA. Translation: CAI39792.1.
AL390774
, AC006450, AL161790, AL445489 Genomic DNA. Translation: CAH73640.1.
AL161790
, AC006450, AL445489, AL390774 Genomic DNA. Translation: CAI15705.1.
AL161790
, AC006450, AL390774, AL445489 Genomic DNA. Translation: CAI15706.1.
AL161790
, AC006450, AL390774, AL445489 Genomic DNA. Translation: CAI15707.1.
AL390774
, AC006450, AL445489, AL161790 Genomic DNA. Translation: CAH73637.1.
AL390774
, AC006450, AL445489, AL161790 Genomic DNA. Translation: CAH73638.1.
AL445489
, AC006450, AL161790, AL390774 Genomic DNA. Translation: CAI39794.1.
CH471090 Genomic DNA. Translation: EAW87571.1.
CH471090 Genomic DNA. Translation: EAW87575.1.
BC009616 mRNA. Translation: AAH09616.1. Different initiation.
BC028061 mRNA. Translation: AAH28061.1. Different initiation.
BC039703 mRNA. Translation: AAH39703.1.
BK006958 mRNA. Translation: DAA12500.1.
CCDSiCCDS35133.1. [Q8TEH3-1]
CCDS35134.1. [Q8TEH3-2]
RefSeqiNP_065997.1. NM_020946.1. [Q8TEH3-1]
NP_079096.2. NM_024820.2. [Q8TEH3-2]
UniGeneiHs.744995.

Genome annotation databases

EnsembliENST00000373618; ENSP00000362720; ENSG00000119522. [Q8TEH3-4]
ENST00000373620; ENSP00000362722; ENSG00000119522. [Q8TEH3-2]
ENST00000373624; ENSP00000362727; ENSG00000119522. [Q8TEH3-1]
ENST00000394215; ENSP00000377763; ENSG00000119522. [Q8TEH3-5]
ENST00000394219; ENSP00000377766; ENSG00000119522. [Q8TEH3-6]
ENST00000542603; ENSP00000437457; ENSG00000119522.
GeneIDi57706.
KEGGihsa:57706.
UCSCiuc004bnz.1. human. [Q8TEH3-1]
uc004boa.1. human. [Q8TEH3-2]
uc004bob.1. human. [Q8TEH3-5]
uc004boc.3. human. [Q8TEH3-4]
uc011lzl.1. human. [Q8TEH3-7]
uc011lzm.1. human. [Q8TEH3-6]

Polymorphism databases

DMDMi109825594.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK024782 mRNA. Translation: BAB15002.1 .
AK074151 mRNA. Translation: BAB84977.1 .
AK295710 mRNA. Translation: BAH12164.1 .
AK299867 mRNA. Translation: BAH13155.1 . Different initiation.
AL445489
, AL161790 , AL390774 , AC006450 Genomic DNA. Translation: CAI39791.1 .
AL445489
, AC006450 , AL390774 , AL161790 Genomic DNA. Translation: CAI39792.1 .
AL390774
, AC006450 , AL161790 , AL445489 Genomic DNA. Translation: CAH73640.1 .
AL161790
, AC006450 , AL445489 , AL390774 Genomic DNA. Translation: CAI15705.1 .
AL161790
, AC006450 , AL390774 , AL445489 Genomic DNA. Translation: CAI15706.1 .
AL161790
, AC006450 , AL390774 , AL445489 Genomic DNA. Translation: CAI15707.1 .
AL390774
, AC006450 , AL445489 , AL161790 Genomic DNA. Translation: CAH73637.1 .
AL390774
, AC006450 , AL445489 , AL161790 Genomic DNA. Translation: CAH73638.1 .
AL445489
, AC006450 , AL161790 , AL390774 Genomic DNA. Translation: CAI39794.1 .
CH471090 Genomic DNA. Translation: EAW87571.1 .
CH471090 Genomic DNA. Translation: EAW87575.1 .
BC009616 mRNA. Translation: AAH09616.1 . Different initiation.
BC028061 mRNA. Translation: AAH28061.1 . Different initiation.
BC039703 mRNA. Translation: AAH39703.1 .
BK006958 mRNA. Translation: DAA12500.1 .
CCDSi CCDS35133.1. [Q8TEH3-1 ]
CCDS35134.1. [Q8TEH3-2 ]
RefSeqi NP_065997.1. NM_020946.1. [Q8TEH3-1 ]
NP_079096.2. NM_024820.2. [Q8TEH3-2 ]
UniGenei Hs.744995.

3D structure databases

ProteinModelPortali Q8TEH3.
SMRi Q8TEH3. Positions 1-376.
ModBasei Search...

Protein-protein interaction databases

BioGridi 121730. 1 interaction.
IntActi Q8TEH3. 1 interaction.
STRINGi 9606.ENSP00000362727.

PTM databases

PhosphoSitei Q8TEH3.

Polymorphism databases

DMDMi 109825594.

Proteomic databases

MaxQBi Q8TEH3.
PaxDbi Q8TEH3.
PRIDEi Q8TEH3.

Protocols and materials databases

DNASUi 57706.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000373618 ; ENSP00000362720 ; ENSG00000119522 . [Q8TEH3-4 ]
ENST00000373620 ; ENSP00000362722 ; ENSG00000119522 . [Q8TEH3-2 ]
ENST00000373624 ; ENSP00000362727 ; ENSG00000119522 . [Q8TEH3-1 ]
ENST00000394215 ; ENSP00000377763 ; ENSG00000119522 . [Q8TEH3-5 ]
ENST00000394219 ; ENSP00000377766 ; ENSG00000119522 . [Q8TEH3-6 ]
ENST00000542603 ; ENSP00000437457 ; ENSG00000119522 .
GeneIDi 57706.
KEGGi hsa:57706.
UCSCi uc004bnz.1. human. [Q8TEH3-1 ]
uc004boa.1. human. [Q8TEH3-2 ]
uc004bob.1. human. [Q8TEH3-5 ]
uc004boc.3. human. [Q8TEH3-4 ]
uc011lzl.1. human. [Q8TEH3-7 ]
uc011lzm.1. human. [Q8TEH3-6 ]

Organism-specific databases

CTDi 57706.
GeneCardsi GC09M126141.
H-InvDB HIX0008366.
HGNCi HGNC:29324. DENND1A.
HPAi HPA020481.
MIMi 613633. gene.
neXtProti NX_Q8TEH3.
PharmGKBi PA134876117.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG316099.
HOVERGENi HBG059210.
OMAi SISSPEX.
OrthoDBi EOG73Z2SH.
PhylomeDBi Q8TEH3.
TreeFami TF343037.

Miscellaneous databases

ChiTaRSi DENND1A. human.
GeneWikii DENND1A.
GenomeRNAii 57706.
NextBioi 64584.
PROi Q8TEH3.
SOURCEi Search...

Gene expression databases

Bgeei Q8TEH3.
CleanExi HS_DENND1A.
Genevestigatori Q8TEH3.

Family and domain databases

InterProi IPR005112. dDENN_dom.
IPR001194. DENN_dom.
IPR005113. uDENN_dom.
[Graphical view ]
Pfami PF03455. dDENN. 1 hit.
PF02141. DENN. 1 hit.
PF03456. uDENN. 1 hit.
[Graphical view ]
SMARTi SM00801. dDENN. 1 hit.
SM00799. DENN. 1 hit.
SM00800. uDENN. 1 hit.
[Graphical view ]
PROSITEi PS50947. DDENN. 1 hit.
PS50211. DENN. 1 hit.
PS50946. UDENN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 114-1009 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 217-1009 (ISOFORM 7).
    Tissue: Artery smooth muscle, Fetal brain, Hippocampus and Spleen.
  2. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 4 AND 5).
    Tissue: Placenta.
  5. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-592, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-523, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-592, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-519; SER-520; SER-523; SER-536; SER-538 AND SER-546, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-538 AND SER-546, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  10. "The connecdenn family, Rab35 guanine nucleotide exchange factors interfacing with the clathrin machinery."
    Marat A.L., McPherson P.S.
    J. Biol. Chem. 285:10627-10637(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION (ISOFORM 1), FUNCTION, INTERACTION WITH AP2A2; CLTC AND RAB35.
  11. "Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors."
    Yoshimura S., Gerondopoulos A., Linford A., Rigden D.J., Barr F.A.
    J. Cell Biol. 191:367-381(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH CLATHRIN AND AP-2, SUBCELLULAR LOCATION.
  12. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-592, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  13. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-520; SER-523 AND SER-592, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiDEN1A_HUMAN
AccessioniPrimary (citable) accession number: Q8TEH3
Secondary accession number(s): A8MZA3
, B1AM80, B7Z3C8, B7Z669, D3PFD3, Q05C88, Q5VWF0, Q6PJZ5, Q8IVD6, Q9H796
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 27, 2006
Last modified: July 9, 2014
This is version 87 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi