Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DENN domain-containing protein 1A

Gene

DENND1A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Guanine nucleotide exchange factor (GEF) regulating clathrin-mediated endocytosis through RAB35 activation. Promotes the exchange of GDP to GTP, converting inactive GDP-bound RAB35 into its active GTP-bound form. Regulates clathrin-mediated endocytosis of synaptic vesicles and mediates exit from early endosomes (PubMed:20154091, PubMed:20937701). Binds phosphatidylinositol-phosphates (PtdInsPs), with some preference for PtdIns3P (By similarity).By similarity2 Publications

Enzyme regulationi

The guanine nucleotide exchange factor (GEF) activity is autoinhibited. Autoinhibition may be the result of intramolecular interaction between the DENN domain and the C-terminus, which is disrupted upon phosphorylation. Activation is regulated by Akt activation.1 Publication

GO - Molecular functioni

GO - Biological processi

  • endocytic recycling Source: UniProtKB
  • endocytosis Source: UniProtKB
  • protein transport Source: UniProtKB-KW
  • regulation of Rab protein signal transduction Source: FlyBase
  • synaptic vesicle endocytosis Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Keywords - Biological processi

Protein transport, Transport

Keywords - Ligandi

Lipid-binding

Enzyme and pathway databases

ReactomeiR-HSA-8876198. RAB GEFs exchange GTP for GDP on RABs.

Names & Taxonomyi

Protein namesi
Recommended name:
DENN domain-containing protein 1AImported
Alternative name(s):
Connecdenn 11 Publication
Short name:
Connecdenn1 Publication
Protein FAM31A
Gene namesi
Name:DENND1AImported
Synonyms:FAM31AImported, KIAA1608
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:29324. DENND1A.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasmic vesicle, Membrane, Synapse

Pathology & Biotechi

Involvement in diseasei

Genetic variants in DENND1A may play a role in susceptibility to polycystic ovary syndrome (PCOS), the most common endocrine disease among premenopausal women. PCOS is a complex disorder characterized by infertility, hirsutism, obesity, various menstrual disturbances, and enlarged ovaries studded with atretic follicles.

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi536 – 538SDS → EDE: Phosphomimetic mutant; abolishes the intramolecular interaction between the DENN domain and the C-terminus of the protein. 1 Publication3

Organism-specific databases

DisGeNETi57706.
OpenTargetsiENSG00000119522.
PharmGKBiPA134876117.

Polymorphism and mutation databases

BioMutaiDENND1A.
DMDMi109825594.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002426801 – 1009DENN domain-containing protein 1AAdd BLAST1009

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei473PhosphoserineCombined sources1
Modified residuei519PhosphothreonineCombined sources1
Modified residuei520PhosphoserineCombined sources1
Modified residuei523PhosphoserineCombined sources1
Modified residuei536PhosphoserineCombined sources1 Publication1
Modified residuei538PhosphoserineCombined sources1 Publication1
Modified residuei546PhosphoserineCombined sources1
Modified residuei592PhosphoserineCombined sources1
Modified residuei749PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated on serine and/or threonine in an Akt-dependent manner. Phosphorylation probably regulates the guanine nucleotide exchange factor (GEF) activity, possibly by disrupting an intramolecular interaction between the DENN domain and the C-terminus of the protein, thereby relieving the autoinhibition.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8TEH3.
MaxQBiQ8TEH3.
PaxDbiQ8TEH3.
PeptideAtlasiQ8TEH3.
PRIDEiQ8TEH3.

PTM databases

iPTMnetiQ8TEH3.
PhosphoSitePlusiQ8TEH3.

Expressioni

Gene expression databases

BgeeiENSG00000119522.
CleanExiHS_DENND1A.
ExpressionAtlasiQ8TEH3. baseline and differential.
GenevisibleiQ8TEH3. HS.

Organism-specific databases

HPAiHPA020481.

Interactioni

Subunit structurei

Interacts with RAB35 (PubMed:20154091). Interacts with clathrin and with the adapter protein complex 2, AP-2 (PubMed:20154091, PubMed:20937701). Interacts with ITSN1 AND SH3GL2 (By similarity). Interacts (when phosphorylated) with YWHAE (PubMed:26055712).By similarity3 Publications

Protein-protein interaction databases

BioGridi121730. 13 interactors.
IntActiQ8TEH3. 13 interactors.
STRINGi9606.ENSP00000362727.

Structurei

3D structure databases

ProteinModelPortaliQ8TEH3.
SMRiQ8TEH3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini24 – 91UDENNAdd BLAST68
Domaini92 – 273DENNPROSITE-ProRule annotationAdd BLAST182
Domaini304 – 371dDENNPROSITE-ProRule annotationAdd BLAST68

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi381 – 385FXDXF motif1 Publication5
Motifi569 – 578Clathrin box1 Publication10

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi649 – 995Pro-richAdd BLAST347

Sequence similaritiesi

Contains 1 dDENN domain.PROSITE-ProRule annotation
Contains 1 DENN domain.PROSITE-ProRule annotation
Contains 1 uDENN domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3569. Eukaryota.
ENOG410XT3N. LUCA.
GeneTreeiENSGT00760000118819.
HOVERGENiHBG059210.
InParanoidiQ8TEH3.
KOiK20160.
OMAiRPKSNIA.
OrthoDBiEOG091G083L.
PhylomeDBiQ8TEH3.
TreeFamiTF343037.

Family and domain databases

InterProiIPR005112. dDENN_dom.
IPR001194. DENN_dom.
IPR005113. uDENN_dom.
[Graphical view]
PfamiPF03455. dDENN. 1 hit.
PF02141. DENN. 1 hit.
PF03456. uDENN. 1 hit.
[Graphical view]
SMARTiSM00801. dDENN. 1 hit.
SM00799. DENN. 1 hit.
SM00800. uDENN. 1 hit.
[Graphical view]
PROSITEiPS50947. DDENN. 1 hit.
PS50211. DENN. 1 hit.
PS50946. UDENN. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TEH3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGSRIKQNPE TTFEVYVEVA YPRTGGTLSD PEVQRQFPED YSDQEVLQTL
60 70 80 90 100
TKFCFPFYVD SLTVSQVGQN FTFVLTDIDS KQRFGFCRLS SGAKSCFCIL
110 120 130 140 150
SYLPWFEVFY KLLNILADYT TKRQENQWNE LLETLHKLPI PDPGVSVHLS
160 170 180 190 200
VHSYFTVPDT RELPSIPENR NLTEYFVAVD VNNMLHLYAS MLYERRILII
210 220 230 240 250
CSKLSTLTAC IHGSAAMLYP MYWQHVYIPV LPPHLLDYCC APMPYLIGIH
260 270 280 290 300
LSLMEKVRNM ALDDVVILNV DTNTLETPFD DLQSLPNDVI SSLKNRLKKV
310 320 330 340 350
STTTGDGVAR AFLKAQAAFF GSYRNALKIE PEEPITFCEE AFVSHYRSGA
360 370 380 390 400
MRQFLQNATQ LQLFKQFIDG RLDLLNSGEG FSDVFEEEIN MGEYAGSDKL
410 420 430 440 450
YHQWLSTVRK GSGAILNTVK TKANPAMKTV YKFAKDHAKM GIKEVKNRLK
460 470 480 490 500
QKDIAENGCA PTPEEQLPKT APSPLVEAKD PKLREDRRPI TVHFGQVRPP
510 520 530 540 550
RPHVVKRPKS NIAVEGRRTS VPSPEQPQPY RTLRESDSAE GDEAESPEQQ
560 570 580 590 600
VRKSTGPVPA PPDRAASIDL LEDVFSNLDM EAALQPLGQA KSLEDLRAPK
610 620 630 640 650
DLREQPGTFD YQRLDLGGSE RSRGVTVALK LTHPYNKLWS LGQDDMAIPS
660 670 680 690 700
KPPAASPEKP SALLGNSLAL PRRPQNRDSI LNPSDKEEVP TPTLGSITIP
710 720 730 740 750
RPQGRKTPEL GIVPPPPIPR PAKLQAAGAA LGDVSERLQT DRDRRAALSP
760 770 780 790 800
GLLPGVVPQG PTELLQPLSP GPGAAGTSSD ALLALLDPLS TAWSGSTLPS
810 820 830 840 850
RPATPNVATP FTPQFSFPPA GTPTPFPQPP LNPFVPSMPA APPTLPLVST
860 870 880 890 900
PAGPFGAPPA SLGPAFASGL LLSSAGFCAP HRSQPNLSAL SMPNLFGQMP
910 920 930 940 950
MGTHTSPLQP LGPPAVAPSR IRTLPLARSS ARAAETKQGL ALRPGDPPLL
960 970 980 990 1000
PPRPPQGLEP TLQPSAPQQA RDPFEDLLQK TKQDVSPSPA LAPAPDSVEQ

LRKQWETFE
Length:1,009
Mass (Da):110,577
Last modified:June 27, 2006 - v2
Checksum:iECEE79CFCD5E2D0C
GO
Isoform 2 (identifier: Q8TEH3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     527-559: PQPYRTLRESDSAEGDEAESPEQQVRKSTGPVP → NTIATPATLHILQKSITHFAAKFPTRGWTSSSH
     560-1009: Missing.

Show »
Length:559
Mass (Da):63,389
Checksum:i64F3CCFF1755CFF9
GO
Isoform 3 (identifier: Q8TEH3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     497-498: VR → AL
     499-1009: Missing.

Show »
Length:498
Mass (Da):56,613
Checksum:i143F57353E24EC46
GO
Isoform 4 (identifier: Q8TEH3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.
     33-60: VQRQFPEDYSDQEVLQTLTKFCFPFYVD → MLKWPIPGQVALFQILRCRGNSRRTTVT
     497-498: VR → AL
     499-1009: Missing.

Show »
Length:466
Mass (Da):52,857
Checksum:i98353ACDF34D2AE5
GO
Isoform 5 (identifier: Q8TEH3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: Missing.
     31-43: PEVQRQFPEDYSD → MLKWPIPGQVALF
     527-559: PQPYRTLRESDSAEGDEAESPEQQVRKSTGPVP → NTIATPATLHILQKSITHFAAKFPTRGWTSSSH
     560-1009: Missing.

Show »
Length:529
Mass (Da):59,950
Checksum:iC8D1C7E8FDBA6A9A
GO
Isoform 6 (identifier: Q8TEH3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.
     33-42: VQRQFPEDYS → MRRPGDHGLQ
     526-526: Q → HLVKPLRHYAVFLSEDSSDDECQREEGPSSGFTESFFFSAPFEW

Note: No experimental confirmation available.
Show »
Length:1,020
Mass (Da):111,887
Checksum:i4B5FC1CCC9F465C9
GO
Isoform 7 (identifier: Q8TEH3-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     290-331: Missing.
     526-526: Q → HLVKPLRHYAVFLSEDSSDDECQREEGPSSGFTESFFFSAPFEW

Note: No experimental confirmation available.
Show »
Length:1,010
Mass (Da):111,005
Checksum:i1276C13494EBD925
GO

Sequence cautioni

The sequence AAH09616 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAH28061 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAH13155 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti456E → G in BAB15002 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0345091 – 32Missing in isoform 4 and isoform 6. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_0345101 – 30Missing in isoform 5. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_03451131 – 43PEVQR…EDYSD → MLKWPIPGQVALF in isoform 5. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_03451233 – 60VQRQF…PFYVD → MLKWPIPGQVALFQILRCRG NSRRTTVT in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_04066633 – 42VQRQFPEDYS → MRRPGDHGLQ in isoform 6. 1 Publication10
Alternative sequenceiVSP_040667290 – 331Missing in isoform 7. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_034513497 – 498VR → AL in isoform 3 and isoform 4. 1 Publication2
Alternative sequenceiVSP_034514499 – 1009Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST511
Alternative sequenceiVSP_040668526Q → HLVKPLRHYAVFLSEDSSDD ECQREEGPSSGFTESFFFSA PFEW in isoform 6 and isoform 7. 1 Publication1
Alternative sequenceiVSP_019464527 – 559PQPYR…TGPVP → NTIATPATLHILQKSITHFA AKFPTRGWTSSSH in isoform 2 and isoform 5. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_019465560 – 1009Missing in isoform 2 and isoform 5. 2 PublicationsAdd BLAST450

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024782 mRNA. Translation: BAB15002.1.
AK074151 mRNA. Translation: BAB84977.1.
AK295710 mRNA. Translation: BAH12164.1.
AK299867 mRNA. Translation: BAH13155.1. Different initiation.
AL445489
, AL161790, AL390774, AC006450 Genomic DNA. Translation: CAI39791.1.
AL445489
, AC006450, AL390774, AL161790 Genomic DNA. Translation: CAI39792.1.
AL390774
, AC006450, AL161790, AL445489 Genomic DNA. Translation: CAH73640.1.
AL161790
, AC006450, AL445489, AL390774 Genomic DNA. Translation: CAI15705.1.
AL161790
, AC006450, AL390774, AL445489 Genomic DNA. Translation: CAI15706.1.
AL161790
, AC006450, AL390774, AL445489 Genomic DNA. Translation: CAI15707.1.
AL390774
, AC006450, AL445489, AL161790 Genomic DNA. Translation: CAH73637.1.
AL390774
, AC006450, AL445489, AL161790 Genomic DNA. Translation: CAH73638.1.
AL445489
, AC006450, AL161790, AL390774 Genomic DNA. Translation: CAI39794.1.
CH471090 Genomic DNA. Translation: EAW87571.1.
CH471090 Genomic DNA. Translation: EAW87575.1.
BC009616 mRNA. Translation: AAH09616.1. Different initiation.
BC028061 mRNA. Translation: AAH28061.1. Different initiation.
BC039703 mRNA. Translation: AAH39703.1.
BK006958 mRNA. Translation: DAA12500.1.
CCDSiCCDS35133.1. [Q8TEH3-1]
CCDS35134.1. [Q8TEH3-2]
RefSeqiNP_065997.1. NM_020946.1. [Q8TEH3-1]
NP_079096.2. NM_024820.2. [Q8TEH3-2]
UniGeneiHs.744995.

Genome annotation databases

EnsembliENST00000373618; ENSP00000362720; ENSG00000119522. [Q8TEH3-4]
ENST00000373620; ENSP00000362722; ENSG00000119522. [Q8TEH3-2]
ENST00000373624; ENSP00000362727; ENSG00000119522. [Q8TEH3-1]
GeneIDi57706.
KEGGihsa:57706.
UCSCiuc004bnz.2. human. [Q8TEH3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024782 mRNA. Translation: BAB15002.1.
AK074151 mRNA. Translation: BAB84977.1.
AK295710 mRNA. Translation: BAH12164.1.
AK299867 mRNA. Translation: BAH13155.1. Different initiation.
AL445489
, AL161790, AL390774, AC006450 Genomic DNA. Translation: CAI39791.1.
AL445489
, AC006450, AL390774, AL161790 Genomic DNA. Translation: CAI39792.1.
AL390774
, AC006450, AL161790, AL445489 Genomic DNA. Translation: CAH73640.1.
AL161790
, AC006450, AL445489, AL390774 Genomic DNA. Translation: CAI15705.1.
AL161790
, AC006450, AL390774, AL445489 Genomic DNA. Translation: CAI15706.1.
AL161790
, AC006450, AL390774, AL445489 Genomic DNA. Translation: CAI15707.1.
AL390774
, AC006450, AL445489, AL161790 Genomic DNA. Translation: CAH73637.1.
AL390774
, AC006450, AL445489, AL161790 Genomic DNA. Translation: CAH73638.1.
AL445489
, AC006450, AL161790, AL390774 Genomic DNA. Translation: CAI39794.1.
CH471090 Genomic DNA. Translation: EAW87571.1.
CH471090 Genomic DNA. Translation: EAW87575.1.
BC009616 mRNA. Translation: AAH09616.1. Different initiation.
BC028061 mRNA. Translation: AAH28061.1. Different initiation.
BC039703 mRNA. Translation: AAH39703.1.
BK006958 mRNA. Translation: DAA12500.1.
CCDSiCCDS35133.1. [Q8TEH3-1]
CCDS35134.1. [Q8TEH3-2]
RefSeqiNP_065997.1. NM_020946.1. [Q8TEH3-1]
NP_079096.2. NM_024820.2. [Q8TEH3-2]
UniGeneiHs.744995.

3D structure databases

ProteinModelPortaliQ8TEH3.
SMRiQ8TEH3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121730. 13 interactors.
IntActiQ8TEH3. 13 interactors.
STRINGi9606.ENSP00000362727.

PTM databases

iPTMnetiQ8TEH3.
PhosphoSitePlusiQ8TEH3.

Polymorphism and mutation databases

BioMutaiDENND1A.
DMDMi109825594.

Proteomic databases

EPDiQ8TEH3.
MaxQBiQ8TEH3.
PaxDbiQ8TEH3.
PeptideAtlasiQ8TEH3.
PRIDEiQ8TEH3.

Protocols and materials databases

DNASUi57706.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000373618; ENSP00000362720; ENSG00000119522. [Q8TEH3-4]
ENST00000373620; ENSP00000362722; ENSG00000119522. [Q8TEH3-2]
ENST00000373624; ENSP00000362727; ENSG00000119522. [Q8TEH3-1]
GeneIDi57706.
KEGGihsa:57706.
UCSCiuc004bnz.2. human. [Q8TEH3-1]

Organism-specific databases

CTDi57706.
DisGeNETi57706.
GeneCardsiDENND1A.
H-InvDBHIX0008366.
HGNCiHGNC:29324. DENND1A.
HPAiHPA020481.
MIMi613633. gene.
neXtProtiNX_Q8TEH3.
OpenTargetsiENSG00000119522.
PharmGKBiPA134876117.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3569. Eukaryota.
ENOG410XT3N. LUCA.
GeneTreeiENSGT00760000118819.
HOVERGENiHBG059210.
InParanoidiQ8TEH3.
KOiK20160.
OMAiRPKSNIA.
OrthoDBiEOG091G083L.
PhylomeDBiQ8TEH3.
TreeFamiTF343037.

Enzyme and pathway databases

ReactomeiR-HSA-8876198. RAB GEFs exchange GTP for GDP on RABs.

Miscellaneous databases

ChiTaRSiDENND1A. human.
GeneWikiiDENND1A.
GenomeRNAii57706.
PROiQ8TEH3.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000119522.
CleanExiHS_DENND1A.
ExpressionAtlasiQ8TEH3. baseline and differential.
GenevisibleiQ8TEH3. HS.

Family and domain databases

InterProiIPR005112. dDENN_dom.
IPR001194. DENN_dom.
IPR005113. uDENN_dom.
[Graphical view]
PfamiPF03455. dDENN. 1 hit.
PF02141. DENN. 1 hit.
PF03456. uDENN. 1 hit.
[Graphical view]
SMARTiSM00801. dDENN. 1 hit.
SM00799. DENN. 1 hit.
SM00800. uDENN. 1 hit.
[Graphical view]
PROSITEiPS50947. DDENN. 1 hit.
PS50211. DENN. 1 hit.
PS50946. UDENN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDEN1A_HUMAN
AccessioniPrimary (citable) accession number: Q8TEH3
Secondary accession number(s): A8MZA3
, B1AM80, B7Z3C8, B7Z669, D3PFD3, Q05C88, Q5VWF0, Q6PJZ5, Q8IVD6, Q9H796
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 27, 2006
Last modified: November 30, 2016
This is version 109 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.