Q8TEH3 (DEN1A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 77.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: DENN domain-containing protein 1A Alternative name(s): Connecdenn 1 Short name=Connecdenn Protein FAM31A | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1009 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Guanine nucleotide exchange factor (GEF) regulating clathrin-mediated endocytosis through RAB35 activation. Promotes the exchange of GDP to GTP, converting inactive GDP-bound RAB35 into its active GTP-bound form. Regulates clathrin-mediated endocytosis of synaptic vesicles. Ref.10 Ref.11 |
| Subunit structure | Interacts with ITSN1 AND SH3GL2 By similarity. Interacts with RAB35. Interacts with clathrin and with the adapter protein complex 2, AP-2. Ref.10 Ref.11 |
| Subcellular location | Cytoplasmic vesicle › clathrin-coated vesicle membrane; Peripheral membrane protein. Cell junction › synapse › presynaptic cell membrane Ref.11. |
| Sequence similarities | Contains 1 dDENN domain. Contains 1 DENN domain. Contains 1 uDENN domain. |
| Sequence caution | The sequence AAH09616.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence AAH28061.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence BAH13155.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8TEH3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8TEH3-2) The sequence of this isoform differs from the canonical sequence as follows: 527-559: PQPYRTLRESDSAEGDEAESPEQQVRKSTGPVP → NTIATPATLHILQKSITHFAAKFPTRGWTSSSH 560-1009: Missing. | ||||||
| Isoform 3 (identifier: Q8TEH3-3) The sequence of this isoform differs from the canonical sequence as follows: 497-498: VR → AL 499-1009: Missing. | ||||||
| Isoform 4 (identifier: Q8TEH3-4) The sequence of this isoform differs from the canonical sequence as follows: 1-32: Missing. 33-60: VQRQFPEDYSDQEVLQTLTKFCFPFYVD → MLKWPIPGQVALFQILRCRGNSRRTTVT 497-498: VR → AL 499-1009: Missing. | ||||||
| Isoform 5 (identifier: Q8TEH3-5) The sequence of this isoform differs from the canonical sequence as follows: 1-30: Missing. 31-43: PEVQRQFPEDYSD → MLKWPIPGQVALF 527-559: PQPYRTLRESDSAEGDEAESPEQQVRKSTGPVP → NTIATPATLHILQKSITHFAAKFPTRGWTSSSH 560-1009: Missing. | ||||||
| Isoform 6 (identifier: Q8TEH3-6) The sequence of this isoform differs from the canonical sequence as follows: 1-32: Missing. 33-42: VQRQFPEDYS → MRRPGDHGLQ 526-526: Q → HLVKPLRHYAVFLSEDSSDDECQREEGPSSGFTESFFFSAPFEW | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: Q8TEH3-7) The sequence of this isoform differs from the canonical sequence as follows: 290-331: Missing. 526-526: Q → HLVKPLRHYAVFLSEDSSDDECQREEGPSSGFTESFFFSAPFEW | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1009 | 1009 | DENN domain-containing protein 1A | PRO_0000242680 | |||||
Regions | |||||||||
| Domain | 24 – 91 | 68 | UDENN | ||||||
| Domain | 92 – 273 | 182 | DENN | ||||||
| Domain | 304 – 371 | 68 | dDENN | ||||||
| Compositional bias | 649 – 995 | 347 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 519 | 1 | Phosphothreonine Ref.8 | ||||||
| Modified residue | 520 | 1 | Phosphoserine Ref.8 Ref.13 | ||||||
| Modified residue | 523 | 1 | Phosphoserine Ref.6 Ref.8 Ref.13 | ||||||
| Modified residue | 536 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 538 | 1 | Phosphoserine Ref.8 Ref.9 | ||||||
| Modified residue | 546 | 1 | Phosphoserine Ref.8 Ref.9 | ||||||
| Modified residue | 592 | 1 | Phosphoserine Ref.5 Ref.7 Ref.12 Ref.13 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 32 | 32 | Missing in isoform 4 and isoform 6. | VSP_034509 | |||||
| Alternative sequence | 1 – 30 | 30 | Missing in isoform 5. | VSP_034510 | |||||
| Alternative sequence | 31 – 43 | 13 | PEVQR…EDYSD → MLKWPIPGQVALF in isoform 5. | VSP_034511 | |||||
| Alternative sequence | 33 – 60 | 28 | VQRQF…PFYVD → MLKWPIPGQVALFQILRCRG NSRRTTVT in isoform 4. | VSP_034512 | |||||
| Alternative sequence | 33 – 42 | 10 | VQRQFPEDYS → MRRPGDHGLQ in isoform 6. | VSP_040666 | |||||
| Alternative sequence | 290 – 331 | 42 | Missing in isoform 7. | VSP_040667 | |||||
| Alternative sequence | 497 – 498 | 2 | VR → AL in isoform 3 and isoform 4. | VSP_034513 | |||||
| Alternative sequence | 499 – 1009 | 511 | Missing in isoform 3 and isoform 4. | VSP_034514 | |||||
| Alternative sequence | 526 | 1 | Q → HLVKPLRHYAVFLSEDSSDD ECQREEGPSSGFTESFFFSA PFEW in isoform 6 and isoform 7. | VSP_040668 | |||||
| Alternative sequence | 527 – 559 | 33 | PQPYR…TGPVP → NTIATPATLHILQKSITHFA AKFPTRGWTSSSH in isoform 2 and isoform 5. | VSP_019464 | |||||
| Alternative sequence | 560 – 1009 | 450 | Missing in isoform 2 and isoform 5. | VSP_019465 | |||||
Experimental info | |||||||||
| Sequence conflict | 456 | 1 | E → G in BAB15002. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 114-1009 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 217-1009 (ISOFORM 7). Tissue: Artery smooth muscle, Fetal brain, Hippocampus and Spleen. |
| [2] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 4 AND 5). Tissue: Placenta. |
| [5] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-592, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [6] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-523, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-592, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-519; SER-520; SER-523; SER-536; SER-538 AND SER-546, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-538 AND SER-546, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [10] | "The connecdenn family, Rab35 guanine nucleotide exchange factors interfacing with the clathrin machinery." Marat A.L., McPherson P.S. J. Biol. Chem. 285:10627-10637(2010) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION (ISOFORM 1), FUNCTION, INTERACTION WITH AP2A2; CLTC AND RAB35. |
| [11] | "Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors." Yoshimura S., Gerondopoulos A., Linford A., Rigden D.J., Barr F.A. J. Cell Biol. 191:367-381(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CLATHRIN AND AP-2, SUBCELLULAR LOCATION. |
| [12] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-592, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-520; SER-523 AND SER-592, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK024782 mRNA. Translation: BAB15002.1. AK074151 mRNA. Translation: BAB84977.1. AK295710 mRNA. Translation: BAH12164.1. AK299867 mRNA. Translation: BAH13155.1. Different initiation. AL445489 AC006450 Genomic DNA. Translation: CAI39791.1.AL445489 AL161790 Genomic DNA. Translation: CAI39792.1.AL390774 AL445489 Genomic DNA. Translation: CAH73640.1.AL161790 AL390774 Genomic DNA. Translation: CAI15705.1.AL161790 AL445489 Genomic DNA. Translation: CAI15706.1.AL161790 AL445489 Genomic DNA. Translation: CAI15707.1.AL390774 AL161790 Genomic DNA. Translation: CAH73637.1.AL390774 AL161790 Genomic DNA. Translation: CAH73638.1.AL445489 AL390774 Genomic DNA. Translation: CAI39794.1.CH471090 Genomic DNA. Translation: EAW87571.1. CH471090 Genomic DNA. Translation: EAW87575.1. BC009616 mRNA. Translation: AAH09616.1. Different initiation. BC028061 mRNA. Translation: AAH28061.1. Different initiation. BC039703 mRNA. Translation: AAH39703.1. BK006958 mRNA. Translation: DAA12500.1. |
| IPI | IPI00170641. IPI00449176. IPI00645340. IPI00872202. IPI00900334. IPI00922655. IPI00983955. |
| RefSeq | NP_065997.1. NM_020946.1. NP_079096.2. NM_024820.2. |
| UniGene | Hs.568340. |
3D structure databases | |
| ProteinModelPortal | Q8TEH3. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000362727. |
PTM databases | |
| PhosphoSite | Q8TEH3. |
Polymorphism databases | |
| DMDM | 109825594. |
Proteomic databases | |
| PaxDb | Q8TEH3. |
| PRIDE | Q8TEH3. |
Protocols and materials databases | |
| DNASU | 57706. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000373618; ENSP00000362720; ENSG00000119522. ENST00000373620; ENSP00000362722; ENSG00000119522. ENST00000373624; ENSP00000362727; ENSG00000119522. ENST00000394215; ENSP00000377763; ENSG00000119522. ENST00000394219; ENSP00000377766; ENSG00000119522. ENST00000542603; ENSP00000437457; ENSG00000119522. |
| GeneID | 57706. |
| KEGG | hsa:57706. |
| UCSC | uc004bnz.1. human. uc004boa.1. human. uc004bob.1. human. uc004boc.3. human. uc011lzl.1. human. uc011lzm.1. human. |
Organism-specific databases | |
| CTD | 57706. |
| GeneCards | GC09M126141. |
| H-InvDB | HIX0008366. |
| HGNC | HGNC:29324. DENND1A. |
| HPA | HPA020481. |
| MIM | 613633. gene. |
| neXtProt | NX_Q8TEH3. |
| PharmGKB | PA134876117. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG316099. |
| HOVERGEN | HBG059210. |
| OMA | FGFCRHT. |
| OrthoDB | EOG4NP72W. |
Gene expression databases | |
| Bgee | Q8TEH3. |
| CleanEx | HS_DENND1A. |
| Genevestigator | Q8TEH3. |
| GermOnline | ENSG00000119522. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR005112. dDENN_dom. IPR001194. DENN_dom. IPR005113. uDENN_dom. [Graphical view] |
| Pfam | PF03455. dDENN. 1 hit. PF02141. DENN. 1 hit. PF03456. uDENN. 1 hit. [Graphical view] |
| SMART | SM00801. dDENN. 1 hit. SM00799. DENN. 1 hit. SM00800. uDENN. 1 hit. [Graphical view] |
| PROSITE | PS50947. DDENN. 1 hit. PS50211. DENN. 1 hit. PS50946. UDENN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | DENND1A. human. |
| GenomeRNAi | 57706. |
| NextBio | 64584. |
| SOURCE | Search... |
Entry information
| Entry name | DEN1A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8TEH3 Secondary accession number(s): A8MZA3 Q9H796 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
