Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Actin filament-associated protein 1-like 1

Gene

AFAP1L1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in podosome and invadosome formation.1 Publication

Names & Taxonomyi

Protein namesi
Recommended name:
Actin filament-associated protein 1-like 1
Short name:
AFAP1-like protein 1
Gene namesi
Name:AFAP1L1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:26714. AFAP1L1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162375772.

Polymorphism and mutation databases

BioMutaiAFAP1L1.
DMDMi156630522.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 768768Actin filament-associated protein 1-like 1PRO_0000295239Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei94 – 941PhosphoserineBy similarity
Modified residuei98 – 981PhosphoserineBy similarity
Modified residuei104 – 1041PhosphoserineBy similarity
Modified residuei153 – 1531PhosphoserineBy similarity
Modified residuei329 – 3291PhosphoserineBy similarity
Modified residuei343 – 3431PhosphoserineBy similarity
Modified residuei557 – 5571PhosphotyrosineBy similarity
Modified residuei747 – 7471PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8TED9.
MaxQBiQ8TED9.
PaxDbiQ8TED9.
PRIDEiQ8TED9.

PTM databases

PhosphoSiteiQ8TED9.

Expressioni

Tissue specificityi

Expressed in breast, colon and brain. In all 3 tissues, expressed in the microvasculature (at protein level). In addition, in the breast, found in the contractile myoepithelial cell layer which surrounds the breast ducts (at protein level). In the colon, expressed in the mucous membrane and colonic crypts and in the smooth muscle cell layer which provide movement of the colon (at protein level). In the cerebellum, localized around the Purkinje neurons and the granule cells of the granular layer, but not inside cell bodies (at protein level). Outside of the cerebellar cortex, expressed in glial cells (at protein level). Highly expressed away from the cell bodies within the dentate nucleus (at protein level).1 Publication

Gene expression databases

BgeeiQ8TED9.
CleanExiHS_AFAP1L1.
GenevisibleiQ8TED9. HS.

Organism-specific databases

HPAiHPA007329.
HPA012099.

Interactioni

Subunit structurei

Interacts with CTTN.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
GADD45GO952573EBI-1053644,EBI-448202

Protein-protein interaction databases

BioGridi126390. 2 interactions.
IntActiQ8TED9. 2 interactions.
STRINGi9606.ENSP00000296721.

Structurei

3D structure databases

ProteinModelPortaliQ8TED9.
SMRiQ8TED9. Positions 413-508.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini220 – 31697PH 1PROSITE-ProRule annotationAdd
BLAST
Domaini418 – 51295PH 2PROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili611 – 70090Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi194 – 1985Poly-Glu

Sequence similaritiesi

Contains 2 PH domains.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiENOG410IEU6. Eukaryota.
ENOG4111CMN. LUCA.
GeneTreeiENSGT00390000003998.
HOGENOMiHOG000033832.
HOVERGENiHBG106875.
InParanoidiQ8TED9.
OMAiGRRETCD.
OrthoDBiEOG7KQ217.
PhylomeDBiQ8TED9.
TreeFamiTF332622.

Family and domain databases

Gene3Di2.30.29.30. 2 hits.
InterProiIPR030113. AFAP.
IPR030112. AFAP1L1.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PANTHERiPTHR14338. PTHR14338. 1 hit.
PTHR14338:SF1. PTHR14338:SF1. 1 hit.
PfamiPF00169. PH. 2 hits.
[Graphical view]
SMARTiSM00233. PH. 2 hits.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 3 hits.
PROSITEiPS50003. PH_DOMAIN. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TED9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDRGQVLEQL LPELTGLLSL LDHEYLSDTT LEKKMAVASI LQSLQPLPAK
60 70 80 90 100
EVSYLYVNTA DLHSGPSFVE SLFEEFDCDL SDLRDMPEDD GEPSKGASPE
110 120 130 140 150
LAKSPRLRNA ADLPPPLPNK PPPEDYYEEA LPLGPGKSPE YISSHNGCSP
160 170 180 190 200
SHSIVDGYYE DADSSYPATR VNGELKSSYN DSDAMSSSYE SYDEEEEEGK
210 220 230 240 250
SPQPRHQWPS EEASMHLVRE CRICAFLLRK KRFGQWAKQL TVIREDQLLC
260 270 280 290 300
YKSSKDRQPH LRLALDTCSI IYVPKDSRHK RHELRFTQGA TEVLVLALQS
310 320 330 340 350
REQAEEWLKV IREVSKPVGG AEGVEVPRSP VLLCKLDLDK RLSQEKQTSD
360 370 380 390 400
SDSVGVGDNC STLGRRETCD HGKGKKSSLA ELKGSMSRAA GRKITRIIGF
410 420 430 440 450
SKKKTLADDL QTSSTEEEVP CCGYLNVLVN QGWKERWCRL KCNTLYFHKD
460 470 480 490 500
HMDLRTHVNA IALQGCEVAP GFGPRHPFAF RILRNRQEVA ILEASCSEDM
510 520 530 540 550
GRWLGLLLVE MGSRVTPEAL HYDYVDVETL TSIVSAGRNS FLYARSCQNQ
560 570 580 590 600
WPEPRVYDDV PYEKMQDEEP ERPTGAQVKR HASSCSEKSH RVDPQVKVKR
610 620 630 640 650
HASSANQYKY GKNRAEEDAR RYLVEKEKLE KEKETIRTEL IALRQEKREL
660 670 680 690 700
KEAIRSSPGA KLKALEEAVA TLEAQCRAKE ERRIDLELKL VAVKERLQQS
710 720 730 740 750
LAGGPALGLS VSSKPKSGET ANKPQNSVPE QPLPVNCVSE LRKRSPSIVA
760
SNQGRVLQKA KEWEMKKT
Length:768
Mass (Da):86,432
Last modified:July 24, 2007 - v2
Checksum:i5DC1B952E797110F
GO
Isoform 2 (identifier: Q8TED9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     719-761: Missing.

Note: No experimental confirmation available.
Show »
Length:725
Mass (Da):81,750
Checksum:i1C33F71C6CF15D8E
GO
Isoform 3 (identifier: Q8TED9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     341-377: RLSQEKQTSDSDSVGVGDNCSTLGRRETCDHGKGKKS → VYLSPLSLPQARQWPLNTGSTPGELTGWGESQATAKL
     378-768: Missing.

Note: No experimental confirmation available.
Show »
Length:377
Mass (Da):42,197
Checksum:i402A45C59307C01D
GO
Isoform 4 (identifier: Q8TED9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-385: Missing.

Note: No experimental confirmation available.
Show »
Length:383
Mass (Da):43,455
Checksum:iA1040C7B5A813B1E
GO

Sequence cautioni

The sequence BAB85011.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti84 – 841R → Q in BAC04664 (PubMed:14702039).Curated
Sequence conflicti106 – 1061R → C in BAC04664 (PubMed:14702039).Curated
Sequence conflicti325 – 3251E → G in BAC04664 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 385385Missing in isoform 4. 1 PublicationVSP_026856Add
BLAST
Alternative sequencei341 – 37737RLSQE…KGKKS → VYLSPLSLPQARQWPLNTGS TPGELTGWGESQATAKL in isoform 3. 1 PublicationVSP_026857Add
BLAST
Alternative sequencei378 – 768391Missing in isoform 3. 1 PublicationVSP_026858Add
BLAST
Alternative sequencei719 – 76143Missing in isoform 2. 1 PublicationVSP_026859Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK074185 mRNA. Translation: BAB85011.1. Different initiation.
AK094067 mRNA. Translation: BAC04277.1.
AK095980 mRNA. Translation: BAC04664.1.
BC040723 mRNA. Translation: AAH40723.1.
BC125093 mRNA. Translation: AAI25094.1.
BC125094 mRNA. Translation: AAI25095.1.
CCDSiCCDS34274.1. [Q8TED9-1]
CCDS54932.1. [Q8TED9-2]
RefSeqiNP_001139809.1. NM_001146337.1. [Q8TED9-2]
NP_689619.1. NM_152406.2. [Q8TED9-1]
UniGeneiHs.483793.

Genome annotation databases

EnsembliENST00000296721; ENSP00000296721; ENSG00000157510. [Q8TED9-1]
ENST00000515000; ENSP00000424427; ENSG00000157510. [Q8TED9-2]
GeneIDi134265.
KEGGihsa:134265.
UCSCiuc003lqh.4. human. [Q8TED9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK074185 mRNA. Translation: BAB85011.1. Different initiation.
AK094067 mRNA. Translation: BAC04277.1.
AK095980 mRNA. Translation: BAC04664.1.
BC040723 mRNA. Translation: AAH40723.1.
BC125093 mRNA. Translation: AAI25094.1.
BC125094 mRNA. Translation: AAI25095.1.
CCDSiCCDS34274.1. [Q8TED9-1]
CCDS54932.1. [Q8TED9-2]
RefSeqiNP_001139809.1. NM_001146337.1. [Q8TED9-2]
NP_689619.1. NM_152406.2. [Q8TED9-1]
UniGeneiHs.483793.

3D structure databases

ProteinModelPortaliQ8TED9.
SMRiQ8TED9. Positions 413-508.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126390. 2 interactions.
IntActiQ8TED9. 2 interactions.
STRINGi9606.ENSP00000296721.

PTM databases

PhosphoSiteiQ8TED9.

Polymorphism and mutation databases

BioMutaiAFAP1L1.
DMDMi156630522.

Proteomic databases

EPDiQ8TED9.
MaxQBiQ8TED9.
PaxDbiQ8TED9.
PRIDEiQ8TED9.

Protocols and materials databases

DNASUi134265.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000296721; ENSP00000296721; ENSG00000157510. [Q8TED9-1]
ENST00000515000; ENSP00000424427; ENSG00000157510. [Q8TED9-2]
GeneIDi134265.
KEGGihsa:134265.
UCSCiuc003lqh.4. human. [Q8TED9-1]

Organism-specific databases

CTDi134265.
GeneCardsiAFAP1L1.
HGNCiHGNC:26714. AFAP1L1.
HPAiHPA007329.
HPA012099.
MIMi614410. gene.
neXtProtiNX_Q8TED9.
PharmGKBiPA162375772.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEU6. Eukaryota.
ENOG4111CMN. LUCA.
GeneTreeiENSGT00390000003998.
HOGENOMiHOG000033832.
HOVERGENiHBG106875.
InParanoidiQ8TED9.
OMAiGRRETCD.
OrthoDBiEOG7KQ217.
PhylomeDBiQ8TED9.
TreeFamiTF332622.

Miscellaneous databases

ChiTaRSiAFAP1L1. human.
GenomeRNAii134265.
NextBioi83341.
PROiQ8TED9.
SOURCEiSearch...

Gene expression databases

BgeeiQ8TED9.
CleanExiHS_AFAP1L1.
GenevisibleiQ8TED9. HS.

Family and domain databases

Gene3Di2.30.29.30. 2 hits.
InterProiIPR030113. AFAP.
IPR030112. AFAP1L1.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PANTHERiPTHR14338. PTHR14338. 1 hit.
PTHR14338:SF1. PTHR14338:SF1. 1 hit.
PfamiPF00169. PH. 2 hits.
[Graphical view]
SMARTiSM00233. PH. 2 hits.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 3 hits.
PROSITEiPS50003. PH_DOMAIN. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones."
    Jikuya H., Takano J., Kikuno R., Hirosawa M., Nagase T., Nomura N., Ohara O.
    DNA Res. 10:49-57(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Spleen.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Lung and Uterus.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Skin.
  4. "AFAP1L1 is a novel adaptor protein of the AFAP family that interacts with cortactin and localizes to invadosomes."
    Snyder B.N., Cho Y., Qian Y., Coad J.E., Flynn D.C., Cunnick J.M.
    Eur. J. Cell Biol. 90:376-389(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH CTTN, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiAF1L1_HUMAN
AccessioniPrimary (citable) accession number: Q8TED9
Secondary accession number(s): Q08AN4
, Q08AN5, Q8IW82, Q8N8Z5, Q8N9Q4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: July 24, 2007
Last modified: May 11, 2016
This is version 100 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.