Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8TEA7 (TBCK_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 97. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
TBC domain-containing protein kinase-like protein
Gene names
Name:TBCK
Synonyms:TBCKL
ORF Names:HSPC302
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length893 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Domain

The protein kinase domain is predicted to be catalytically inactive.

Sequence similarities

Belongs to the protein kinase superfamily.

Contains 1 protein kinase domain.

Contains 1 Rab-GAP TBC domain.

Contains 1 rhodanese domain.

Sequence caution

The sequence AAF28980.1 differs from that shown. Reason: Frameshift at positions 507, 516, 660, 665 and 672.

The sequence BAC05244.1 differs from that shown. Reason: intron retention.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 Ref.2 (identifier: Q8TEA7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 Ref.5 (identifier: Q8TEA7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     161-199: Missing.
Note: No experimental confirmation available.
Isoform 3 Ref.5 (identifier: Q8TEA7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     89-152: SCSTVLCIAFEVLQGLQYMNKHGIVHRALSPHNILLDRKGHIKLAKFGLYHMTAHGDDVDFPIG → R
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 893893TBC domain-containing protein kinase-like protein
PRO_0000273278

Regions

Domain1 – 273273Protein kinase
Domain466 – 651186Rab-GAP TBC
Domain790 – 889100Rhodanese

Natural variations

Alternative sequence89 – 15264SCSTV…DFPIG → R in isoform 3. Ref.5
VSP_052274
Alternative sequence161 – 19939Missing in isoform 2. Ref.5
VSP_052275
Natural variant661R → L. Ref.9
VAR_041380
Natural variant1511I → M. Ref.9
VAR_041381
Natural variant2651D → N. Ref.9
VAR_041382
Natural variant2661Q → E. Ref.1 Ref.2 Ref.3 Ref.6
Corresponds to variant rs3775091 [ dbSNP | Ensembl ].
VAR_030123
Natural variant4251T → M. Ref.9
Corresponds to variant rs34307452 [ dbSNP | Ensembl ].
VAR_041383
Natural variant4711M → I. Ref.9
Corresponds to variant rs34961213 [ dbSNP | Ensembl ].
VAR_041384
Natural variant4891K → N. Ref.9
Corresponds to variant rs2305685 [ dbSNP | Ensembl ].
VAR_030124
Natural variant5031R → I in a colorectal adenocarcinoma sample; somatic mutation. Ref.9
VAR_041385
Natural variant6921R → C. Ref.9
VAR_041386
Natural variant8061I → V in a head & Neck squamous cell carcinoma sample; somatic mutation. Ref.9
VAR_041387

Experimental info

Sequence conflict6011I → N in AAF28980. Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 11, 2011. Version 4.
Checksum: 7B5A11E37A49D03B

FASTA893100,679
        10         20         30         40         50         60 
MFPLKDAEMG AFTFFASALP HDVCGSNGLP LTPNSIKILG RFQILKTITH PRLCQYVDIS 

        70         80         90        100        110        120 
RGKHERLVVV AEHCERSLED LLRERKPVSC STVLCIAFEV LQGLQYMNKH GIVHRALSPH 

       130        140        150        160        170        180 
NILLDRKGHI KLAKFGLYHM TAHGDDVDFP IGYPSYLAPE VIAQGIFKTT DHMPSKKPLP 

       190        200        210        220        230        240 
SGPKSDVWSL GIILFELCVG RKLFQSLDIS ERLKFLLTLD CVDDTLIVLA EEHGCLDIIK 

       250        260        270        280        290        300 
ELPETVIDLL NKCLTFHPSK RPTPDQLMKD KVFSEVSPLY TPFTKPASLF SSSLRCADLT 

       310        320        330        340        350        360 
LPEDISQLCK DINNDYLAER SIEEVYYLWC LAGGDLEKEL VNKEIIRSKP PICTLPNFLF 

       370        380        390        400        410        420 
EDGESFGQGR DRSSLLDDTT VTLSLCQLRN RLKDVGGEAF YPLLEDDQSN LPHSNSNNEL 

       430        440        450        460        470        480 
SAAATLPLII REKDTEYQLN RIILFDRLLK AYPYKKNQIW KEARVDIPPL MRGLTWAALL 

       490        500        510        520        530        540 
GVEGAIHAKY DAIDKDTPIP TDRQIEVDIP RCHQYDELLS SPEGHAKFRR VLKAWVVSHP 

       550        560        570        580        590        600 
DLVYWQGLDS LCAPFLYLNF NNEALAYACM SAFIPKYLYN FFLKDNSHVI QEYLTVFSQM 

       610        620        630        640        650        660 
IAFHDPELSN HLNEIGFIPD LYAIPWFLTM FTHVFPLHKI FHLWDTLLLG NSSFPFCIGV 

       670        680        690        700        710        720 
AILQQLRDRL LANGFNECIL LFSDLPEIDI ERCVRESINL FCWTPKSATY RQHAQPPKPS 

       730        740        750        760        770        780 
SDSSGGRSSA PYFSAECPDP PKTDLSRESI PLNDLKSEVS PRISAEDLID LCELTVTGHF 

       790        800        810        820        830        840 
KTPSKKTKSS KPKLLVVDIR NSEDFIRGHI SGSINIPFSA AFTAEGELTQ GPYTAMLQNF 

       850        860        870        880        890 
KGKVIVIVGH VAKHTAEFAA HLVKMKYPRI CILDGGINKI KPTGLLTIPS PQI 

« Hide

Isoform 2 [UniParc].

Checksum: DBF6940FE6D8D60C
Show »

FASTA85496,443
Isoform 3 [UniParc].

Checksum: 010755C970CC33F1
Show »

FASTA83093,725

References

« Hide 'large scale' references
[1]"Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity."
Ishibashi K., Kanno E., Itoh T., Fukuda M.
Genes Cells 14:41-52(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT GLU-266.
Tissue: Brain.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 261-893 (ISOFORMS 1/2/3), VARIANT GLU-266.
Tissue: Hepatoma and Trachea.
[3]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-266.
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 608-893 (ISOFORMS 1/2/3).
Tissue: Lymph, Placenta and Prostate.
[6]"Human partial CDS from CD34+ stem cells."
Ye M., Zhang Q.-H., Zhou J., Shen Y., Wu X.-Y., Guan Z.Q., Wang L., Fan H.-Y., Mao Y.-F., Dai M., Huang Q.-H., Chen S.-J., Chen Z.
Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 388-893 (ISOFORMS 1/2/3), VARIANT GLU-266.
Tissue: Umbilical cord blood.
[7]"The protein kinase complement of the human genome."
Manning G., Whyte D.B., Martinez R., Hunter T., Sudarsanam S.
Science 298:1912-1934(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NOMENCLATURE.
[8]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[9]"Patterns of somatic mutation in human cancer genomes."
Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. expand/collapse author list , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS [LARGE SCALE ANALYSIS] LEU-66; MET-151; ASN-265; MET-425; ILE-471; ASN-489; ILE-503; CYS-692 AND VAL-806.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB449876 mRNA. Translation: BAH16619.1.
AK074305 mRNA. Translation: BAB85045.1.
AK098157 mRNA. Translation: BAC05244.1. Sequence problems.
AC093680 Genomic DNA. No translation available.
AC107381 Genomic DNA. Translation: AAY40979.1.
AC109361 Genomic DNA. No translation available.
AC114734 Genomic DNA. Translation: AAY41041.1.
AC125469 Genomic DNA. No translation available.
AP001820 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX06201.1.
BC009208 mRNA. Translation: AAH09208.2.
BC020853 mRNA. Translation: AAH20853.2.
BC068496 mRNA. Translation: AAH68496.1.
AF161420 mRNA. Translation: AAF28980.1. Frameshift.
CCDSCCDS3673.1. [Q8TEA7-3]
CCDS54788.1. [Q8TEA7-1]
CCDS54789.1. [Q8TEA7-2]
RefSeqNP_001156907.1. NM_001163435.2.
NP_001156908.1. NM_001163436.2.
NP_001156909.1. NM_001163437.2.
NP_149106.2. NM_033115.4.
UniGeneHs.151498.
Hs.292986.

3D structure databases

ProteinModelPortalQ8TEA7.
SMRQ8TEA7. Positions 1-333, 440-690.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid125042. 2 interactions.

PTM databases

PhosphoSiteQ8TEA7.

Polymorphism databases

DMDM317373548.

Proteomic databases

MaxQBQ8TEA7.
PaxDbQ8TEA7.
PRIDEQ8TEA7.

Protocols and materials databases

DNASU93627.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000273980; ENSP00000273980; ENSG00000145348. [Q8TEA7-1]
ENST00000361687; ENSP00000355338; ENSG00000145348. [Q8TEA7-3]
ENST00000394706; ENSP00000378196; ENSG00000145348. [Q8TEA7-2]
ENST00000394708; ENSP00000378198; ENSG00000145348. [Q8TEA7-1]
ENST00000432496; ENSP00000405847; ENSG00000145348. [Q8TEA7-1]
GeneID93627.
KEGGhsa:93627.
UCSCuc003hyb.2. human. [Q8TEA7-1]
uc003hyc.2. human. [Q8TEA7-3]
uc003hye.2. human. [Q8TEA7-2]

Organism-specific databases

CTD93627.
GeneCardsGC04M106967.
HGNCHGNC:28261. TBCK.
HPAHPA039951.
neXtProtNX_Q8TEA7.
PharmGKBPA165664603.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5210.
HOVERGENHBG055536.
InParanoidQ8TEA7.
KOK17544.
OMAQYVYWQG.
OrthoDBEOG7288QV.
PhylomeDBQ8TEA7.
TreeFamTF106242.

Enzyme and pathway databases

SignaLinkQ8TEA7.

Gene expression databases

ArrayExpressQ8TEA7.
BgeeQ8TEA7.
GenevestigatorQ8TEA7.

Family and domain databases

Gene3D3.40.250.10. 1 hit.
InterProIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR000195. Rab-GTPase-TBC_dom.
IPR001763. Rhodanese-like_dom.
[Graphical view]
PfamPF00069. Pkinase. 1 hit.
PF00566. RabGAP-TBC. 1 hit.
PF00581. Rhodanese. 1 hit.
[Graphical view]
SMARTSM00450. RHOD. 1 hit.
SM00164. TBC. 1 hit.
[Graphical view]
SUPFAMSSF47923. SSF47923. 2 hits.
SSF52821. SSF52821. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEPS50011. PROTEIN_KINASE_DOM. 1 hit.
PS50206. RHODANESE_3. 1 hit.
PS50086. TBC_RABGAP. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi93627.
NextBio78173.
PROQ8TEA7.

Entry information

Entry nameTBCK_HUMAN
AccessionPrimary (citable) accession number: Q8TEA7
Secondary accession number(s): B9A6J1 expand/collapse secondary AC list , Q4W5B3, Q4W5E1, Q6NUP4, Q8N7M8, Q8WW57, Q96GV6, Q9P080
Entry history
Integrated into UniProtKB/Swiss-Prot: January 23, 2007
Last sequence update: January 11, 2011
Last modified: July 9, 2014
This is version 97 of the entry and version 4 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human and mouse protein kinases

Human and mouse protein kinases: classification and index

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 4

Human chromosome 4: entries, gene names and cross-references to MIM