Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8TEA7

- TBCK_HUMAN

UniProt

Q8TEA7 - TBCK_HUMAN

Protein

TBC domain-containing protein kinase-like protein

Gene

TBCK

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 98 (01 Oct 2014)
      Sequence version 4 (11 Jan 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. ATP binding Source: InterPro
    2. Rab GTPase activator activity Source: InterPro
    3. transferase activity, transferring phosphorus-containing groups Source: InterPro

    Enzyme and pathway databases

    SignaLinkiQ8TEA7.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    TBC domain-containing protein kinase-like protein
    Gene namesi
    Name:TBCK1 Publication
    Synonyms:TBCKL
    ORF Names:HSPC302
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:28261. TBCK.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA165664603.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 893893TBC domain-containing protein kinase-like proteinPRO_0000273278Add
    BLAST

    Proteomic databases

    MaxQBiQ8TEA7.
    PaxDbiQ8TEA7.
    PRIDEiQ8TEA7.

    PTM databases

    PhosphoSiteiQ8TEA7.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8TEA7.
    BgeeiQ8TEA7.
    GenevestigatoriQ8TEA7.

    Organism-specific databases

    HPAiHPA039951.

    Interactioni

    Protein-protein interaction databases

    BioGridi125042. 2 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8TEA7.
    SMRiQ8TEA7. Positions 1-333, 440-690.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini1 – 273273Protein kinasePROSITE-ProRule annotationAdd
    BLAST
    Domaini466 – 651186Rab-GAP TBCPROSITE-ProRule annotationAdd
    BLAST
    Domaini790 – 889100RhodanesePROSITE-ProRule annotationAdd
    BLAST

    Domaini

    The protein kinase domain is predicted to be catalytically inactive.Sequence Analysis

    Sequence similaritiesi

    Belongs to the protein kinase superfamily.Curated
    Contains 1 protein kinase domain.PROSITE-ProRule annotation
    Contains 1 Rab-GAP TBC domain.PROSITE-ProRule annotation
    Contains 1 rhodanese domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG5210.
    HOVERGENiHBG055536.
    InParanoidiQ8TEA7.
    KOiK17544.
    OMAiQYVYWQG.
    OrthoDBiEOG7288QV.
    PhylomeDBiQ8TEA7.
    TreeFamiTF106242.

    Family and domain databases

    Gene3Di3.40.250.10. 1 hit.
    InterProiIPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR000195. Rab-GTPase-TBC_dom.
    IPR001763. Rhodanese-like_dom.
    [Graphical view]
    PfamiPF00069. Pkinase. 1 hit.
    PF00566. RabGAP-TBC. 1 hit.
    PF00581. Rhodanese. 1 hit.
    [Graphical view]
    SMARTiSM00450. RHOD. 1 hit.
    SM00164. TBC. 1 hit.
    [Graphical view]
    SUPFAMiSSF47923. SSF47923. 2 hits.
    SSF52821. SSF52821. 1 hit.
    SSF56112. SSF56112. 1 hit.
    PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS50206. RHODANESE_3. 1 hit.
    PS50086. TBC_RABGAP. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 11 Publication (identifier: Q8TEA7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MFPLKDAEMG AFTFFASALP HDVCGSNGLP LTPNSIKILG RFQILKTITH    50
    PRLCQYVDIS RGKHERLVVV AEHCERSLED LLRERKPVSC STVLCIAFEV 100
    LQGLQYMNKH GIVHRALSPH NILLDRKGHI KLAKFGLYHM TAHGDDVDFP 150
    IGYPSYLAPE VIAQGIFKTT DHMPSKKPLP SGPKSDVWSL GIILFELCVG 200
    RKLFQSLDIS ERLKFLLTLD CVDDTLIVLA EEHGCLDIIK ELPETVIDLL 250
    NKCLTFHPSK RPTPDQLMKD KVFSEVSPLY TPFTKPASLF SSSLRCADLT 300
    LPEDISQLCK DINNDYLAER SIEEVYYLWC LAGGDLEKEL VNKEIIRSKP 350
    PICTLPNFLF EDGESFGQGR DRSSLLDDTT VTLSLCQLRN RLKDVGGEAF 400
    YPLLEDDQSN LPHSNSNNEL SAAATLPLII REKDTEYQLN RIILFDRLLK 450
    AYPYKKNQIW KEARVDIPPL MRGLTWAALL GVEGAIHAKY DAIDKDTPIP 500
    TDRQIEVDIP RCHQYDELLS SPEGHAKFRR VLKAWVVSHP DLVYWQGLDS 550
    LCAPFLYLNF NNEALAYACM SAFIPKYLYN FFLKDNSHVI QEYLTVFSQM 600
    IAFHDPELSN HLNEIGFIPD LYAIPWFLTM FTHVFPLHKI FHLWDTLLLG 650
    NSSFPFCIGV AILQQLRDRL LANGFNECIL LFSDLPEIDI ERCVRESINL 700
    FCWTPKSATY RQHAQPPKPS SDSSGGRSSA PYFSAECPDP PKTDLSRESI 750
    PLNDLKSEVS PRISAEDLID LCELTVTGHF KTPSKKTKSS KPKLLVVDIR 800
    NSEDFIRGHI SGSINIPFSA AFTAEGELTQ GPYTAMLQNF KGKVIVIVGH 850
    VAKHTAEFAA HLVKMKYPRI CILDGGINKI KPTGLLTIPS PQI 893
    Length:893
    Mass (Da):100,679
    Last modified:January 11, 2011 - v4
    Checksum:i7B5A11E37A49D03B
    GO
    Isoform 21 Publication (identifier: Q8TEA7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         161-199: Missing.

    Note: No experimental confirmation available.Curated

    Show »
    Length:854
    Mass (Da):96,443
    Checksum:iDBF6940FE6D8D60C
    GO
    Isoform 31 Publication (identifier: Q8TEA7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         89-152: SCSTVLCIAFEVLQGLQYMNKHGIVHRALSPHNILLDRKGHIKLAKFGLYHMTAHGDDVDFPIG → R

    Note: No experimental confirmation available.Curated

    Show »
    Length:830
    Mass (Da):93,725
    Checksum:i010755C970CC33F1
    GO

    Sequence cautioni

    The sequence BAC05244.1 differs from that shown. Reason: intron retention.
    The sequence AAF28980.1 differs from that shown. Reason: Frameshift at positions 507, 516, 660, 665 and 672.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti601 – 6011I → N in AAF28980. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti66 – 661R → L.1 Publication
    VAR_041380
    Natural varianti151 – 1511I → M.1 Publication
    VAR_041381
    Natural varianti265 – 2651D → N.1 Publication
    VAR_041382
    Natural varianti266 – 2661Q → E.4 Publications
    Corresponds to variant rs3775091 [ dbSNP | Ensembl ].
    VAR_030123
    Natural varianti425 – 4251T → M.1 Publication
    Corresponds to variant rs34307452 [ dbSNP | Ensembl ].
    VAR_041383
    Natural varianti471 – 4711M → I.1 Publication
    Corresponds to variant rs34961213 [ dbSNP | Ensembl ].
    VAR_041384
    Natural varianti489 – 4891K → N.1 Publication
    Corresponds to variant rs2305685 [ dbSNP | Ensembl ].
    VAR_030124
    Natural varianti503 – 5031R → I in a colorectal adenocarcinoma sample; somatic mutation. 1 Publication
    VAR_041385
    Natural varianti692 – 6921R → C.1 Publication
    VAR_041386
    Natural varianti806 – 8061I → V in a head & Neck squamous cell carcinoma sample; somatic mutation. 1 Publication
    VAR_041387

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei89 – 15264SCSTV…DFPIG → R in isoform 3. 1 PublicationVSP_052274Add
    BLAST
    Alternative sequencei161 – 19939Missing in isoform 2. 1 PublicationVSP_052275Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB449876 mRNA. Translation: BAH16619.1.
    AK074305 mRNA. Translation: BAB85045.1.
    AK098157 mRNA. Translation: BAC05244.1. Sequence problems.
    AC093680 Genomic DNA. No translation available.
    AC107381 Genomic DNA. Translation: AAY40979.1.
    AC109361 Genomic DNA. No translation available.
    AC114734 Genomic DNA. Translation: AAY41041.1.
    AC125469 Genomic DNA. No translation available.
    AP001820 Genomic DNA. No translation available.
    CH471057 Genomic DNA. Translation: EAX06201.1.
    BC009208 mRNA. Translation: AAH09208.2.
    BC020853 mRNA. Translation: AAH20853.2.
    BC068496 mRNA. Translation: AAH68496.1.
    AF161420 mRNA. Translation: AAF28980.1. Frameshift.
    CCDSiCCDS3673.1. [Q8TEA7-3]
    CCDS54788.1. [Q8TEA7-1]
    CCDS54789.1. [Q8TEA7-2]
    RefSeqiNP_001156907.1. NM_001163435.2.
    NP_001156908.1. NM_001163436.2.
    NP_001156909.1. NM_001163437.2.
    NP_149106.2. NM_033115.4.
    UniGeneiHs.151498.
    Hs.292986.

    Genome annotation databases

    EnsembliENST00000273980; ENSP00000273980; ENSG00000145348. [Q8TEA7-1]
    ENST00000361687; ENSP00000355338; ENSG00000145348. [Q8TEA7-3]
    ENST00000394706; ENSP00000378196; ENSG00000145348. [Q8TEA7-2]
    ENST00000394708; ENSP00000378198; ENSG00000145348. [Q8TEA7-1]
    ENST00000432496; ENSP00000405847; ENSG00000145348. [Q8TEA7-1]
    GeneIDi93627.
    KEGGihsa:93627.
    UCSCiuc003hyb.2. human. [Q8TEA7-1]
    uc003hyc.2. human. [Q8TEA7-3]
    uc003hye.2. human. [Q8TEA7-2]

    Polymorphism databases

    DMDMi317373548.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB449876 mRNA. Translation: BAH16619.1 .
    AK074305 mRNA. Translation: BAB85045.1 .
    AK098157 mRNA. Translation: BAC05244.1 . Sequence problems.
    AC093680 Genomic DNA. No translation available.
    AC107381 Genomic DNA. Translation: AAY40979.1 .
    AC109361 Genomic DNA. No translation available.
    AC114734 Genomic DNA. Translation: AAY41041.1 .
    AC125469 Genomic DNA. No translation available.
    AP001820 Genomic DNA. No translation available.
    CH471057 Genomic DNA. Translation: EAX06201.1 .
    BC009208 mRNA. Translation: AAH09208.2 .
    BC020853 mRNA. Translation: AAH20853.2 .
    BC068496 mRNA. Translation: AAH68496.1 .
    AF161420 mRNA. Translation: AAF28980.1 . Frameshift.
    CCDSi CCDS3673.1. [Q8TEA7-3 ]
    CCDS54788.1. [Q8TEA7-1 ]
    CCDS54789.1. [Q8TEA7-2 ]
    RefSeqi NP_001156907.1. NM_001163435.2.
    NP_001156908.1. NM_001163436.2.
    NP_001156909.1. NM_001163437.2.
    NP_149106.2. NM_033115.4.
    UniGenei Hs.151498.
    Hs.292986.

    3D structure databases

    ProteinModelPortali Q8TEA7.
    SMRi Q8TEA7. Positions 1-333, 440-690.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 125042. 2 interactions.

    PTM databases

    PhosphoSitei Q8TEA7.

    Polymorphism databases

    DMDMi 317373548.

    Proteomic databases

    MaxQBi Q8TEA7.
    PaxDbi Q8TEA7.
    PRIDEi Q8TEA7.

    Protocols and materials databases

    DNASUi 93627.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000273980 ; ENSP00000273980 ; ENSG00000145348 . [Q8TEA7-1 ]
    ENST00000361687 ; ENSP00000355338 ; ENSG00000145348 . [Q8TEA7-3 ]
    ENST00000394706 ; ENSP00000378196 ; ENSG00000145348 . [Q8TEA7-2 ]
    ENST00000394708 ; ENSP00000378198 ; ENSG00000145348 . [Q8TEA7-1 ]
    ENST00000432496 ; ENSP00000405847 ; ENSG00000145348 . [Q8TEA7-1 ]
    GeneIDi 93627.
    KEGGi hsa:93627.
    UCSCi uc003hyb.2. human. [Q8TEA7-1 ]
    uc003hyc.2. human. [Q8TEA7-3 ]
    uc003hye.2. human. [Q8TEA7-2 ]

    Organism-specific databases

    CTDi 93627.
    GeneCardsi GC04M106967.
    HGNCi HGNC:28261. TBCK.
    HPAi HPA039951.
    neXtProti NX_Q8TEA7.
    PharmGKBi PA165664603.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5210.
    HOVERGENi HBG055536.
    InParanoidi Q8TEA7.
    KOi K17544.
    OMAi QYVYWQG.
    OrthoDBi EOG7288QV.
    PhylomeDBi Q8TEA7.
    TreeFami TF106242.

    Enzyme and pathway databases

    SignaLinki Q8TEA7.

    Miscellaneous databases

    GenomeRNAii 93627.
    NextBioi 78173.
    PROi Q8TEA7.

    Gene expression databases

    ArrayExpressi Q8TEA7.
    Bgeei Q8TEA7.
    Genevestigatori Q8TEA7.

    Family and domain databases

    Gene3Di 3.40.250.10. 1 hit.
    InterProi IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR000195. Rab-GTPase-TBC_dom.
    IPR001763. Rhodanese-like_dom.
    [Graphical view ]
    Pfami PF00069. Pkinase. 1 hit.
    PF00566. RabGAP-TBC. 1 hit.
    PF00581. Rhodanese. 1 hit.
    [Graphical view ]
    SMARTi SM00450. RHOD. 1 hit.
    SM00164. TBC. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47923. SSF47923. 2 hits.
    SSF52821. SSF52821. 1 hit.
    SSF56112. SSF56112. 1 hit.
    PROSITEi PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS50206. RHODANESE_3. 1 hit.
    PS50086. TBC_RABGAP. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity."
      Ishibashi K., Kanno E., Itoh T., Fukuda M.
      Genes Cells 14:41-52(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT GLU-266.
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 261-893 (ISOFORMS 1/2/3), VARIANT GLU-266.
      Tissue: HepatomaImported and TracheaImported.
    3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-266.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 608-893 (ISOFORMS 1/2/3).
      Tissue: LymphImported, PlacentaImported and ProstateImported.
    6. "Human partial CDS from CD34+ stem cells."
      Ye M., Zhang Q.-H., Zhou J., Shen Y., Wu X.-Y., Guan Z.Q., Wang L., Fan H.-Y., Mao Y.-F., Dai M., Huang Q.-H., Chen S.-J., Chen Z.
      Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 388-893 (ISOFORMS 1/2/3), VARIANT GLU-266.
      Tissue: Umbilical cord blood.
    7. Cited for: NOMENCLATURE.
    8. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    9. "Patterns of somatic mutation in human cancer genomes."
      Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
      , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
      Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS [LARGE SCALE ANALYSIS] LEU-66; MET-151; ASN-265; MET-425; ILE-471; ASN-489; ILE-503; CYS-692 AND VAL-806.

    Entry informationi

    Entry nameiTBCK_HUMAN
    AccessioniPrimary (citable) accession number: Q8TEA7
    Secondary accession number(s): B9A6J1
    , Q4W5B3, Q4W5E1, Q6NUP4, Q8N7M8, Q8WW57, Q96GV6, Q9P080
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 23, 2007
    Last sequence update: January 11, 2011
    Last modified: October 1, 2014
    This is version 98 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3