Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

TBC domain-containing protein kinase-like protein

Gene

TBCK

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • ATP binding Source: UniProtKB
  • protein kinase activity Source: UniProtKB

GO - Biological processi

  • protein phosphorylation Source: GOC
Complete GO annotation...

Enzyme and pathway databases

SignaLinkiQ8TEA7.

Names & Taxonomyi

Protein namesi
Recommended name:
TBC domain-containing protein kinase-like protein
Gene namesi
Name:TBCK1 Publication
Synonyms:TBCKL
ORF Names:HSPC302
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:28261. TBCK.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA165664603.

Polymorphism and mutation databases

BioMutaiTBCK.
DMDMi317373548.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 893893TBC domain-containing protein kinase-like proteinPRO_0000273278Add
BLAST

Proteomic databases

MaxQBiQ8TEA7.
PaxDbiQ8TEA7.
PRIDEiQ8TEA7.

PTM databases

PhosphoSiteiQ8TEA7.

Expressioni

Gene expression databases

BgeeiQ8TEA7.
ExpressionAtlasiQ8TEA7. baseline and differential.
GenevisibleiQ8TEA7. HS.

Organism-specific databases

HPAiHPA039951.
HPA051611.

Interactioni

Protein-protein interaction databases

BioGridi125042. 2 interactions.
STRINGi9606.ENSP00000273980.

Structurei

3D structure databases

ProteinModelPortaliQ8TEA7.
SMRiQ8TEA7. Positions 28-333, 467-690.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 273273Protein kinasePROSITE-ProRule annotationAdd
BLAST
Domaini466 – 651186Rab-GAP TBCPROSITE-ProRule annotationAdd
BLAST
Domaini790 – 889100RhodanesePROSITE-ProRule annotationAdd
BLAST

Domaini

The protein kinase domain is predicted to be catalytically inactive.Sequence Analysis

Sequence similaritiesi

Belongs to the protein kinase superfamily.Curated
Contains 1 protein kinase domain.PROSITE-ProRule annotation
Contains 1 Rab-GAP TBC domain.PROSITE-ProRule annotation
Contains 1 rhodanese domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG5210.
GeneTreeiENSGT00790000123094.
HOVERGENiHBG055536.
InParanoidiQ8TEA7.
KOiK17544.
OMAiPYTAMLQ.
OrthoDBiEOG7288QV.
PhylomeDBiQ8TEA7.
TreeFamiTF106242.

Family and domain databases

Gene3Di3.40.250.10. 1 hit.
InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR000195. Rab-GTPase-TBC_dom.
IPR001763. Rhodanese-like_dom.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
PF00566. RabGAP-TBC. 1 hit.
PF00581. Rhodanese. 1 hit.
[Graphical view]
SMARTiSM00450. RHOD. 1 hit.
SM00164. TBC. 1 hit.
[Graphical view]
SUPFAMiSSF47923. SSF47923. 2 hits.
SSF52821. SSF52821. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
PS50206. RHODANESE_3. 1 hit.
PS50086. TBC_RABGAP. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q8TEA7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFPLKDAEMG AFTFFASALP HDVCGSNGLP LTPNSIKILG RFQILKTITH
60 70 80 90 100
PRLCQYVDIS RGKHERLVVV AEHCERSLED LLRERKPVSC STVLCIAFEV
110 120 130 140 150
LQGLQYMNKH GIVHRALSPH NILLDRKGHI KLAKFGLYHM TAHGDDVDFP
160 170 180 190 200
IGYPSYLAPE VIAQGIFKTT DHMPSKKPLP SGPKSDVWSL GIILFELCVG
210 220 230 240 250
RKLFQSLDIS ERLKFLLTLD CVDDTLIVLA EEHGCLDIIK ELPETVIDLL
260 270 280 290 300
NKCLTFHPSK RPTPDQLMKD KVFSEVSPLY TPFTKPASLF SSSLRCADLT
310 320 330 340 350
LPEDISQLCK DINNDYLAER SIEEVYYLWC LAGGDLEKEL VNKEIIRSKP
360 370 380 390 400
PICTLPNFLF EDGESFGQGR DRSSLLDDTT VTLSLCQLRN RLKDVGGEAF
410 420 430 440 450
YPLLEDDQSN LPHSNSNNEL SAAATLPLII REKDTEYQLN RIILFDRLLK
460 470 480 490 500
AYPYKKNQIW KEARVDIPPL MRGLTWAALL GVEGAIHAKY DAIDKDTPIP
510 520 530 540 550
TDRQIEVDIP RCHQYDELLS SPEGHAKFRR VLKAWVVSHP DLVYWQGLDS
560 570 580 590 600
LCAPFLYLNF NNEALAYACM SAFIPKYLYN FFLKDNSHVI QEYLTVFSQM
610 620 630 640 650
IAFHDPELSN HLNEIGFIPD LYAIPWFLTM FTHVFPLHKI FHLWDTLLLG
660 670 680 690 700
NSSFPFCIGV AILQQLRDRL LANGFNECIL LFSDLPEIDI ERCVRESINL
710 720 730 740 750
FCWTPKSATY RQHAQPPKPS SDSSGGRSSA PYFSAECPDP PKTDLSRESI
760 770 780 790 800
PLNDLKSEVS PRISAEDLID LCELTVTGHF KTPSKKTKSS KPKLLVVDIR
810 820 830 840 850
NSEDFIRGHI SGSINIPFSA AFTAEGELTQ GPYTAMLQNF KGKVIVIVGH
860 870 880 890
VAKHTAEFAA HLVKMKYPRI CILDGGINKI KPTGLLTIPS PQI
Length:893
Mass (Da):100,679
Last modified:January 11, 2011 - v4
Checksum:i7B5A11E37A49D03B
GO
Isoform 21 Publication (identifier: Q8TEA7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     161-199: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:854
Mass (Da):96,443
Checksum:iDBF6940FE6D8D60C
GO
Isoform 31 Publication (identifier: Q8TEA7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     89-152: SCSTVLCIAFEVLQGLQYMNKHGIVHRALSPHNILLDRKGHIKLAKFGLYHMTAHGDDVDFPIG → R

Note: No experimental confirmation available.Curated
Show »
Length:830
Mass (Da):93,725
Checksum:i010755C970CC33F1
GO

Sequence cautioni

The sequence AAF28980.1 differs from that shown. Reason: Frameshift at positions 507, 516, 660, 665 and 672. Curated
The sequence BAC05244.1 differs from that shown.intron retention.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti601 – 6011I → N in AAF28980 (Ref. 6) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti66 – 661R → L.1 Publication
VAR_041380
Natural varianti151 – 1511I → M.1 Publication
VAR_041381
Natural varianti265 – 2651D → N.1 Publication
VAR_041382
Natural varianti266 – 2661Q → E.4 Publications
Corresponds to variant rs3775091 [ dbSNP | Ensembl ].
VAR_030123
Natural varianti425 – 4251T → M.1 Publication
Corresponds to variant rs34307452 [ dbSNP | Ensembl ].
VAR_041383
Natural varianti471 – 4711M → I.1 Publication
Corresponds to variant rs34961213 [ dbSNP | Ensembl ].
VAR_041384
Natural varianti489 – 4891K → N.1 Publication
Corresponds to variant rs2305685 [ dbSNP | Ensembl ].
VAR_030124
Natural varianti503 – 5031R → I in a colorectal adenocarcinoma sample; somatic mutation. 1 Publication
VAR_041385
Natural varianti692 – 6921R → C.1 Publication
VAR_041386
Natural varianti806 – 8061I → V in a head & Neck squamous cell carcinoma sample; somatic mutation. 1 Publication
VAR_041387

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei89 – 15264SCSTV…DFPIG → R in isoform 3. 1 PublicationVSP_052274Add
BLAST
Alternative sequencei161 – 19939Missing in isoform 2. 1 PublicationVSP_052275Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB449876 mRNA. Translation: BAH16619.1.
AK074305 mRNA. Translation: BAB85045.1.
AK098157 mRNA. Translation: BAC05244.1. Sequence problems.
AC093680 Genomic DNA. No translation available.
AC107381 Genomic DNA. Translation: AAY40979.1.
AC109361 Genomic DNA. No translation available.
AC114734 Genomic DNA. Translation: AAY41041.1.
AC125469 Genomic DNA. No translation available.
AP001820 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX06201.1.
BC009208 mRNA. Translation: AAH09208.2.
BC020853 mRNA. Translation: AAH20853.2.
BC068496 mRNA. Translation: AAH68496.1.
AF161420 mRNA. Translation: AAF28980.1. Frameshift.
CCDSiCCDS3673.1. [Q8TEA7-3]
CCDS54788.1. [Q8TEA7-1]
CCDS54789.1. [Q8TEA7-2]
RefSeqiNP_001156907.1. NM_001163435.2.
NP_001156908.1. NM_001163436.2.
NP_001156909.1. NM_001163437.2.
NP_149106.2. NM_033115.4.
XP_011530719.1. XM_011532417.1. [Q8TEA7-1]
UniGeneiHs.151498.
Hs.292986.

Genome annotation databases

EnsembliENST00000273980; ENSP00000273980; ENSG00000145348.
ENST00000361687; ENSP00000355338; ENSG00000145348. [Q8TEA7-3]
ENST00000394706; ENSP00000378196; ENSG00000145348. [Q8TEA7-2]
ENST00000394708; ENSP00000378198; ENSG00000145348.
ENST00000432496; ENSP00000405847; ENSG00000145348.
GeneIDi93627.
KEGGihsa:93627.
UCSCiuc003hyb.2. human. [Q8TEA7-1]
uc003hyc.2. human. [Q8TEA7-3]
uc003hye.2. human. [Q8TEA7-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB449876 mRNA. Translation: BAH16619.1.
AK074305 mRNA. Translation: BAB85045.1.
AK098157 mRNA. Translation: BAC05244.1. Sequence problems.
AC093680 Genomic DNA. No translation available.
AC107381 Genomic DNA. Translation: AAY40979.1.
AC109361 Genomic DNA. No translation available.
AC114734 Genomic DNA. Translation: AAY41041.1.
AC125469 Genomic DNA. No translation available.
AP001820 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX06201.1.
BC009208 mRNA. Translation: AAH09208.2.
BC020853 mRNA. Translation: AAH20853.2.
BC068496 mRNA. Translation: AAH68496.1.
AF161420 mRNA. Translation: AAF28980.1. Frameshift.
CCDSiCCDS3673.1. [Q8TEA7-3]
CCDS54788.1. [Q8TEA7-1]
CCDS54789.1. [Q8TEA7-2]
RefSeqiNP_001156907.1. NM_001163435.2.
NP_001156908.1. NM_001163436.2.
NP_001156909.1. NM_001163437.2.
NP_149106.2. NM_033115.4.
XP_011530719.1. XM_011532417.1. [Q8TEA7-1]
UniGeneiHs.151498.
Hs.292986.

3D structure databases

ProteinModelPortaliQ8TEA7.
SMRiQ8TEA7. Positions 28-333, 467-690.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125042. 2 interactions.
STRINGi9606.ENSP00000273980.

PTM databases

PhosphoSiteiQ8TEA7.

Polymorphism and mutation databases

BioMutaiTBCK.
DMDMi317373548.

Proteomic databases

MaxQBiQ8TEA7.
PaxDbiQ8TEA7.
PRIDEiQ8TEA7.

Protocols and materials databases

DNASUi93627.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000273980; ENSP00000273980; ENSG00000145348.
ENST00000361687; ENSP00000355338; ENSG00000145348. [Q8TEA7-3]
ENST00000394706; ENSP00000378196; ENSG00000145348. [Q8TEA7-2]
ENST00000394708; ENSP00000378198; ENSG00000145348.
ENST00000432496; ENSP00000405847; ENSG00000145348.
GeneIDi93627.
KEGGihsa:93627.
UCSCiuc003hyb.2. human. [Q8TEA7-1]
uc003hyc.2. human. [Q8TEA7-3]
uc003hye.2. human. [Q8TEA7-2]

Organism-specific databases

CTDi93627.
GeneCardsiGC04M106967.
HGNCiHGNC:28261. TBCK.
HPAiHPA039951.
HPA051611.
neXtProtiNX_Q8TEA7.
PharmGKBiPA165664603.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG5210.
GeneTreeiENSGT00790000123094.
HOVERGENiHBG055536.
InParanoidiQ8TEA7.
KOiK17544.
OMAiPYTAMLQ.
OrthoDBiEOG7288QV.
PhylomeDBiQ8TEA7.
TreeFamiTF106242.

Enzyme and pathway databases

SignaLinkiQ8TEA7.

Miscellaneous databases

ChiTaRSiTBCK. human.
GenomeRNAii93627.
NextBioi78173.
PROiQ8TEA7.

Gene expression databases

BgeeiQ8TEA7.
ExpressionAtlasiQ8TEA7. baseline and differential.
GenevisibleiQ8TEA7. HS.

Family and domain databases

Gene3Di3.40.250.10. 1 hit.
InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR000195. Rab-GTPase-TBC_dom.
IPR001763. Rhodanese-like_dom.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
PF00566. RabGAP-TBC. 1 hit.
PF00581. Rhodanese. 1 hit.
[Graphical view]
SMARTiSM00450. RHOD. 1 hit.
SM00164. TBC. 1 hit.
[Graphical view]
SUPFAMiSSF47923. SSF47923. 2 hits.
SSF52821. SSF52821. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
PS50206. RHODANESE_3. 1 hit.
PS50086. TBC_RABGAP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity."
    Ishibashi K., Kanno E., Itoh T., Fukuda M.
    Genes Cells 14:41-52(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT GLU-266.
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 261-893 (ISOFORMS 1/2/3), VARIANT GLU-266.
    Tissue: HepatomaImported and TracheaImported.
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-266.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 608-893 (ISOFORMS 1/2/3).
    Tissue: LymphImported, PlacentaImported and ProstateImported.
  6. "Human partial CDS from CD34+ stem cells."
    Ye M., Zhang Q.-H., Zhou J., Shen Y., Wu X.-Y., Guan Z.Q., Wang L., Fan H.-Y., Mao Y.-F., Dai M., Huang Q.-H., Chen S.-J., Chen Z.
    Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 388-893 (ISOFORMS 1/2/3), VARIANT GLU-266.
    Tissue: Umbilical cord blood.
  7. Cited for: NOMENCLATURE.
  8. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] LEU-66; MET-151; ASN-265; MET-425; ILE-471; ASN-489; ILE-503; CYS-692 AND VAL-806.

Entry informationi

Entry nameiTBCK_HUMAN
AccessioniPrimary (citable) accession number: Q8TEA7
Secondary accession number(s): B9A6J1
, Q4W5B3, Q4W5E1, Q6NUP4, Q8N7M8, Q8WW57, Q96GV6, Q9P080
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 23, 2007
Last sequence update: January 11, 2011
Last modified: July 22, 2015
This is version 107 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.