Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8TE77 (SSH3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 104. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein phosphatase Slingshot homolog 3

EC=3.1.3.16
EC=3.1.3.48
Alternative name(s):
SSH-like protein 3
Short name=SSH-3L
Short name=hSSH-3L
Gene names
Name:SSH3
Synonyms:SSH3L
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length659 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Protein phosphatase which may play a role in the regulation of actin filament dynamics. Can dephosphorylate and activate the actin binding/depolymerizing factor cofilin, which subsequently binds to actin filaments and stimulates their disassembly By similarity.

Catalytic activity

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.

[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Subunit structure

Does not bind to, or colocalize with, filamentous actin By similarity.

Subcellular location

Cytoplasmcytoskeleton By similarity. Nucleus By similarity.

Miscellaneous

Tyrosine phosphatase activity has not been demonstrated for this protein to date.

Sequence similarities

Belongs to the protein-tyrosine phosphatase family.

Contains 1 tyrosine-protein phosphatase domain.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8TE77-1)

Also known as: L;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8TE77-2)

The sequence of this isoform differs from the canonical sequence as follows:
     470-471: SR → RT
     472-659: Missing.
Isoform 3 (identifier: Q8TE77-3)

The sequence of this isoform differs from the canonical sequence as follows:
     2-146: Missing.
     147-154: LGVDFPDS → MAFPLSPA
Isoform 4 (identifier: Q8TE77-4)

The sequence of this isoform differs from the canonical sequence as follows:
     283-547: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: Q8TE77-5)

The sequence of this isoform differs from the canonical sequence as follows:
     2-330: Missing.
     331-360: RIFPHLYLGSEWNAANLEELQRNRVTHILN → MEGTMMMQQRPVLSQQHPSFILNSSPAHSP
     470-471: SR → RT
     472-659: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed By similarity
Chain2 – 659658Protein phosphatase Slingshot homolog 3
PRO_0000094845

Regions

Domain328 – 468141Tyrosine-protein phosphatase

Sites

Active site4131Phosphocysteine intermediate By similarity

Amino acid modifications

Modified residue21N-acetylalanine By similarity
Modified residue851Phosphoserine Ref.5
Modified residue871Phosphoserine Ref.5

Natural variations

Alternative sequence2 – 330329Missing in isoform 5.
VSP_016330
Alternative sequence2 – 146145Missing in isoform 3.
VSP_016331
Alternative sequence147 – 1548LGVDFPDS → MAFPLSPA in isoform 3.
VSP_016332
Alternative sequence283 – 547265Missing in isoform 4.
VSP_016333
Alternative sequence331 – 36030RIFPH…THILN → MEGTMMMQQRPVLSQQHPSF ILNSSPAHSP in isoform 5.
VSP_016334
Alternative sequence470 – 4712SR → RT in isoform 2 and isoform 5.
VSP_016335
Alternative sequence472 – 659188Missing in isoform 2 and isoform 5.
VSP_016336
Natural variant2391E → V.
Corresponds to variant rs7114712 [ dbSNP | Ensembl ].
VAR_057132
Natural variant6001R → H.
Corresponds to variant rs1573536 [ dbSNP | Ensembl ].
VAR_057133

Experimental info

Sequence conflict581A → V Ref.1
Sequence conflict581A → V Ref.2
Sequence conflict5091E → G in BAC04314. Ref.3
Sequence conflict6411F → S in BAB85080. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (L) [UniParc].

Last modified November 22, 2005. Version 2.
Checksum: 0D96F86EAFE81D3B

FASTA65972,996
        10         20         30         40         50         60 
MALVTVSRSP PGSGASTPVG PWDQAVQRRS RLQRRQSFAV LRGAVLGLQD GGDNDDAAEA 

        70         80         90        100        110        120 
SSEPTEKAPS EEELHGDQTD FGQGSQSPQK QEEQRQHLHL MVQLLRPQDD IRLAAQLEAP 

       130        140        150        160        170        180 
RPPRLRYLLV VSTREGEGLS QDETVLLGVD FPDSSSPSCT LGLVLPLWSD TQVYLDGDGG 

       190        200        210        220        230        240 
FSVTSGGQSR IFKPISIQTM WATLQVLHQA CEAALGSGLV PGGSALTWAS HYQERLNSEQ 

       250        260        270        280        290        300 
SCLNEWTAMA DLESLRPPSA EPGGSSEQEQ MEQAIRAELW KVLDVSDLES VTSKEIRQAL 

       310        320        330        340        350        360 
ELRLGLPLQQ YRDFIDNQML LLVAQRDRAS RIFPHLYLGS EWNAANLEEL QRNRVTHILN 

       370        380        390        400        410        420 
MAREIDNFYP ERFTYHNVRL WDEESAQLLP HWKETHRFIE AARAQGTHVL VHCKMGVSRS 

       430        440        450        460        470        480 
AATVLAYAMK QYECSLEQAL RHVQELRPIA RPNPGFLRQL QIYQGILTAS RQSHVWEQKV 

       490        500        510        520        530        540 
GGVSPEEHPA PEVSTPFPPL PPEPEGGGEE KVVGMEESQA APKEEPGPRP RINLRGVMRS 

       550        560        570        580        590        600 
ISLLEPSLEL ESTSETSDMP EVFSSHESSH EEPLQPFPQL ARTKGGQQVD RGPQPALKSR 

       610        620        630        640        650 
QSVVTLQGSA VVANRTQAFQ EQEQGQGQGQ GEPCISSTPR FRKVVRQASV HDSGEEGEA 

« Hide

Isoform 2 [UniParc].

Checksum: 826A8914B638DCC0
Show »

FASTA47152,713
Isoform 3 [UniParc].

Checksum: CA4F7CD4CE02B99F
Show »

FASTA51457,113
Isoform 4 [UniParc].

Checksum: F87C7F5A29048AAE
Show »

FASTA39442,724
Isoform 5 [UniParc].

Checksum: 7A1687EE220D2DD9
Show »

FASTA14216,488

References

« Hide 'large scale' references
[1]"Control of actin reorganization by Slingshot, a family of phosphatases that dephosphorylate ADF/cofilin."
Niwa R., Nagata-Ohashi K., Takeichi M., Mizuno K., Uemura T.
Cell 108:233-246(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
[2]"Differential activities, subcellular distribution and tissue expression patterns of three members of Slingshot family phosphatases that dephosphorylate cofilin."
Ohta Y., Kousaka K., Nagata-Ohashi K., Ohashi K., Muramoto A., Shima Y., Niwa R., Uemura T., Mizuno K.
Genes Cells 8:811-824(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4 AND 5).
Tissue: Cerebellum and Ovarian carcinoma.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Uterus.
[5]"ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage."
Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.
Science 316:1160-1166(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-85 AND SER-87, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Embryonic kidney.
[6]"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[7]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB072360 mRNA. Translation: BAB84119.3.
AB099291 mRNA. Translation: BAC97814.1.
AK000522 mRNA. Translation: BAA91228.1.
AK001790 mRNA. Translation: BAA91913.1.
AK074432 mRNA. Translation: BAB85080.1.
AK094226 mRNA. Translation: BAC04314.1.
BC007709 mRNA. Translation: AAH07709.1.
RefSeqNP_060327.3. NM_017857.3.
UniGeneHs.29173.

3D structure databases

ProteinModelPortalQ8TE77.
SMRQ8TE77. Positions 264-323, 330-469.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120299. 2 interactions.
IntActQ8TE77. 2 interactions.
MINTMINT-5006487.
STRING9606.ENSP00000312081.

PTM databases

PhosphoSiteQ8TE77.

Polymorphism databases

DMDM82582268.

Proteomic databases

PaxDbQ8TE77.
PRIDEQ8TE77.

Protocols and materials databases

DNASU54961.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000308127; ENSP00000312081; ENSG00000172830. [Q8TE77-1]
ENST00000376757; ENSP00000365948; ENSG00000172830. [Q8TE77-2]
GeneID54961.
KEGGhsa:54961.
UCSCuc001okj.3. human. [Q8TE77-1]
uc001okl.3. human. [Q8TE77-3]

Organism-specific databases

CTD54961.
GeneCardsGC11P067071.
HGNCHGNC:30581. SSH3.
HPAHPA019949.
HPA019957.
MIM606780. gene.
neXtProtNX_Q8TE77.
PharmGKBPA134929326.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG2453.
HOVERGENHBG089321.
InParanoidQ8TE77.
KOK05766.
OMAPHWKETH.
OrthoDBEOG7B8S33.
PhylomeDBQ8TE77.
TreeFamTF319444.

Gene expression databases

ArrayExpressQ8TE77.
BgeeQ8TE77.
CleanExHS_SSH3.
GenevestigatorQ8TE77.

Family and domain databases

Gene3D1.10.10.60. 1 hit.
InterProIPR014876. DEK_C.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR020422. Dual-sp_phosphatase_subgr_cat.
IPR024950. DUSP.
IPR009057. Homeodomain-like.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
[Graphical view]
PANTHERPTHR10159. PTHR10159. 1 hit.
PfamPF08766. DEK_C. 1 hit.
PF00782. DSPc. 1 hit.
[Graphical view]
SMARTSM00195. DSPc. 1 hit.
[Graphical view]
PROSITEPS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiSSH3.
GenomeRNAi54961.
NextBio58168.
PROQ8TE77.
SOURCESearch...

Entry information

Entry nameSSH3_HUMAN
AccessionPrimary (citable) accession number: Q8TE77
Secondary accession number(s): Q6PK42 expand/collapse secondary AC list , Q76I75, Q8N9L8, Q8WYL0, Q9NV45, Q9NWZ7
Entry history
Integrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: November 22, 2005
Last modified: April 16, 2014
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 11

Human chromosome 11: entries, gene names and cross-references to MIM