Q8TE77 (SSH3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 96.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein phosphatase Slingshot homolog 3 EC=3.1.3.16 EC=3.1.3.48 Alternative name(s): SSH-like protein 3 Short name=SSH-3L Short name=hSSH-3L | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 659 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Protein phosphatase which may play a role in the regulation of actin filament dynamics. Can dephosphorylate and activate the actin binding/depolymerizing factor cofilin, which subsequently binds to actin filaments and stimulates their disassembly By similarity. |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. A phosphoprotein + H2O = a protein + phosphate. |
| Subunit structure | Does not bind to, or colocalize with, filamentous actin By similarity. |
| Subcellular location | Cytoplasm › cytoskeleton By similarity. Nucleus By similarity. |
| Miscellaneous | Tyrosine phosphatase activity has not been demonstrated for this protein to date. |
| Sequence similarities | Belongs to the protein-tyrosine phosphatase family. Contains 1 tyrosine-protein phosphatase domain. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8TE77-1) Also known as: L; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8TE77-2) The sequence of this isoform differs from the canonical sequence as follows: 470-471: SR → RT 472-659: Missing. | ||||||
| Isoform 3 (identifier: Q8TE77-3) The sequence of this isoform differs from the canonical sequence as follows: 1-146: Missing. 147-154: LGVDFPDS → MAFPLSPA | ||||||
| Isoform 4 (identifier: Q8TE77-4) The sequence of this isoform differs from the canonical sequence as follows: 283-547: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q8TE77-5) The sequence of this isoform differs from the canonical sequence as follows: 1-330: Missing. 331-360: RIFPHLYLGSEWNAANLEELQRNRVTHILN → MEGTMMMQQRPVLSQQHPSFILNSSPAHSP 470-471: SR → RT 472-659: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 659 | 659 | Protein phosphatase Slingshot homolog 3 | PRO_0000094845 | |||||
Regions | |||||||||
| Domain | 328 – 468 | 141 | Tyrosine-protein phosphatase | ||||||
Sites | |||||||||
| Active site | 413 | 1 | Phosphocysteine intermediate By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 7 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 9 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 37 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 85 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 87 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 649 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 330 | 330 | Missing in isoform 5. | VSP_016330 | |||||
| Alternative sequence | 1 – 146 | 146 | Missing in isoform 3. | VSP_016331 | |||||
| Alternative sequence | 147 – 154 | 8 | LGVDFPDS → MAFPLSPA in isoform 3. | VSP_016332 | |||||
| Alternative sequence | 283 – 547 | 265 | Missing in isoform 4. | VSP_016333 | |||||
| Alternative sequence | 331 – 360 | 30 | RIFPH…THILN → MEGTMMMQQRPVLSQQHPSF ILNSSPAHSP in isoform 5. | VSP_016334 | |||||
| Alternative sequence | 470 – 471 | 2 | SR → RT in isoform 2 and isoform 5. | VSP_016335 | |||||
| Alternative sequence | 472 – 659 | 188 | Missing in isoform 2 and isoform 5. | VSP_016336 | |||||
| Natural variant | 239 | 1 | E → V. Corresponds to variant rs7114712 [ dbSNP | Ensembl ]. | VAR_057132 | |||||
| Natural variant | 600 | 1 | R → H. Corresponds to variant rs1573536 [ dbSNP | Ensembl ]. | VAR_057133 | |||||
Experimental info | |||||||||
| Sequence conflict | 58 | 1 | A → V Ref.1 | ||||||
| Sequence conflict | 58 | 1 | A → V Ref.2 | ||||||
| Sequence conflict | 509 | 1 | E → G in BAC04314. Ref.3 | ||||||
| Sequence conflict | 641 | 1 | F → S in BAB85080. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Control of actin reorganization by Slingshot, a family of phosphatases that dephosphorylate ADF/cofilin." Niwa R., Nagata-Ohashi K., Takeichi M., Mizuno K., Uemura T. Cell 108:233-246(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [2] | "Differential activities, subcellular distribution and tissue expression patterns of three members of Slingshot family phosphatases that dephosphorylate cofilin." Ohta Y., Kousaka K., Nagata-Ohashi K., Ohashi K., Muramoto A., Shima Y., Niwa R., Uemura T., Mizuno K. Genes Cells 8:811-824(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4 AND 5). Tissue: Cerebellum and Ovarian carcinoma. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Uterus. |
| [5] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-85 AND SER-87, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [6] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [7] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB072360 mRNA. Translation: BAB84119.3. AB099291 mRNA. Translation: BAC97814.1. AK000522 mRNA. Translation: BAA91228.1. AK001790 mRNA. Translation: BAA91913.1. AK074432 mRNA. Translation: BAB85080.1. AK094226 mRNA. Translation: BAC04314.1. BC007709 mRNA. Translation: AAH07709.1. |
| IPI | IPI00016485. IPI00171057. IPI00218486. IPI00385839. IPI00655638. |
| RefSeq | NP_060327.3. NM_017857.3. |
| UniGene | Hs.29173. |
3D structure databases | |
| ProteinModelPortal | Q8TE77. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000312081. |
PTM databases | |
| PhosphoSite | Q8TE77. |
Polymorphism databases | |
| DMDM | 82582268. |
Proteomic databases | |
| PaxDb | Q8TE77. |
| PRIDE | Q8TE77. |
Protocols and materials databases | |
| DNASU | 54961. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000308127; ENSP00000312081; ENSG00000172830. ENST00000376757; ENSP00000365948; ENSG00000172830. |
| GeneID | 54961. |
| KEGG | hsa:54961. |
| UCSC | uc001okj.3. human. uc001okl.3. human. |
Organism-specific databases | |
| CTD | 54961. |
| GeneCards | GC11P067071. |
| HGNC | HGNC:30581. SSH3. |
| HPA | HPA019949. HPA019957. |
| MIM | 606780. gene. |
| neXtProt | NX_Q8TE77. |
| PharmGKB | PA134929326. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG2453. |
| HOVERGEN | HBG089321. |
| InParanoid | Q8TE77. |
| KO | K05766. |
| OMA | HILNMAR. |
| OrthoDB | EOG4WDDBT. |
| PhylomeDB | Q8TE77. |
Gene expression databases | |
| ArrayExpress | Q8TE77. |
| Bgee | Q8TE77. |
| CleanEx | HS_SSH3. |
| Genevestigator | Q8TE77. |
| GermOnline | ENSG00000172830. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.10.60. 1 hit. |
| InterPro | IPR014876. DEK_C. IPR000340. Dual-sp_phosphatase_cat-dom. IPR020422. Dual-sp_phosphatase_subgr_cat. IPR024950. DUSP. IPR009057. Homeodomain-like. IPR000387. Tyr/Dual-sp_Pase. IPR016130. Tyr_Pase_AS. [Graphical view] |
| PANTHER | PTHR10159. PTHR10159. 1 hit. |
| Pfam | PF08766. DEK_C. 1 hit. PF00782. DSPc. 1 hit. [Graphical view] |
| SMART | SM00195. DSPc. 1 hit. [Graphical view] |
| PROSITE | PS00383. TYR_PHOSPHATASE_1. 1 hit. PS50056. TYR_PHOSPHATASE_2. 1 hit. PS50054. TYR_PHOSPHATASE_DUAL. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 54961. |
| NextBio | 58168. |
| SOURCE | Search... |
Entry information
| Entry name | SSH3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8TE77 Secondary accession number(s): Q6PK42 Q9NWZ7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
