Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein phosphatase Slingshot homolog 3

Gene

SSH3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Protein phosphatase which may play a role in the regulation of actin filament dynamics. Can dephosphorylate and activate the actin binding/depolymerizing factor cofilin, which subsequently binds to actin filaments and stimulates their disassembly (By similarity).By similarity

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.PROSITE-ProRule annotation
[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei413Phosphocysteine intermediatePROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Enzyme and pathway databases

BioCyciZFISH:HS10577-MONOMER.
SIGNORiQ8TE77.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein phosphatase Slingshot homolog 3 (EC:3.1.3.16, EC:3.1.3.48)
Alternative name(s):
SSH-like protein 3
Short name:
SSH-3L
Short name:
hSSH-3L
Gene namesi
Name:SSH3
Synonyms:SSH3L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:30581. SSH3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000172830.
PharmGKBiPA134929326.

Polymorphism and mutation databases

BioMutaiSSH3.
DMDMi82582268.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00000948452 – 659Protein phosphatase Slingshot homolog 3Add BLAST658

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1
Modified residuei9PhosphoserineCombined sources1
Modified residuei37PhosphoserineCombined sources1
Modified residuei85PhosphoserineCombined sources1
Modified residuei87PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ8TE77.
MaxQBiQ8TE77.
PaxDbiQ8TE77.
PeptideAtlasiQ8TE77.
PRIDEiQ8TE77.

PTM databases

DEPODiQ8TE77.
iPTMnetiQ8TE77.
PhosphoSitePlusiQ8TE77.

Expressioni

Gene expression databases

BgeeiENSG00000172830.
CleanExiHS_SSH3.
ExpressionAtlasiQ8TE77. baseline and differential.
GenevisibleiQ8TE77. HS.

Organism-specific databases

HPAiHPA019949.
HPA019957.

Interactioni

Subunit structurei

Does not bind to, or colocalize with, filamentous actin.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi120299. 16 interactors.
IntActiQ8TE77. 5 interactors.
MINTiMINT-5006487.
STRINGi9606.ENSP00000312081.

Structurei

3D structure databases

ProteinModelPortaliQ8TE77.
SMRiQ8TE77.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini328 – 468Tyrosine-protein phosphataseAdd BLAST141

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1716. Eukaryota.
COG2453. LUCA.
GeneTreeiENSGT00760000118902.
HOVERGENiHBG089321.
InParanoidiQ8TE77.
KOiK05766.
OMAiGPWPALK.
OrthoDBiEOG091G0249.
PhylomeDBiQ8TE77.
TreeFamiTF319444.

Family and domain databases

CDDicd00127. DSPc. 1 hit.
Gene3Di1.10.10.60. 1 hit.
3.90.190.10. 1 hit.
InterProiIPR014876. DEK_C.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR024950. DUSP.
IPR009057. Homeodomain-like.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR027232. Ssh.
IPR016130. Tyr_Pase_AS.
IPR000387. TYR_PHOSPHATASE_dom.
IPR020422. TYR_PHOSPHATASE_DUAL_dom.
[Graphical view]
PANTHERiPTHR10159. PTHR10159. 1 hit.
PTHR10159:SF349. PTHR10159:SF349. 1 hit.
PfamiPF08766. DEK_C. 1 hit.
PF00782. DSPc. 1 hit.
[Graphical view]
SMARTiSM00195. DSPc. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 1 hit.
PROSITEiPS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TE77-1) [UniParc]FASTAAdd to basket
Also known as: L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALVTVSRSP PGSGASTPVG PWDQAVQRRS RLQRRQSFAV LRGAVLGLQD
60 70 80 90 100
GGDNDDAAEA SSEPTEKAPS EEELHGDQTD FGQGSQSPQK QEEQRQHLHL
110 120 130 140 150
MVQLLRPQDD IRLAAQLEAP RPPRLRYLLV VSTREGEGLS QDETVLLGVD
160 170 180 190 200
FPDSSSPSCT LGLVLPLWSD TQVYLDGDGG FSVTSGGQSR IFKPISIQTM
210 220 230 240 250
WATLQVLHQA CEAALGSGLV PGGSALTWAS HYQERLNSEQ SCLNEWTAMA
260 270 280 290 300
DLESLRPPSA EPGGSSEQEQ MEQAIRAELW KVLDVSDLES VTSKEIRQAL
310 320 330 340 350
ELRLGLPLQQ YRDFIDNQML LLVAQRDRAS RIFPHLYLGS EWNAANLEEL
360 370 380 390 400
QRNRVTHILN MAREIDNFYP ERFTYHNVRL WDEESAQLLP HWKETHRFIE
410 420 430 440 450
AARAQGTHVL VHCKMGVSRS AATVLAYAMK QYECSLEQAL RHVQELRPIA
460 470 480 490 500
RPNPGFLRQL QIYQGILTAS RQSHVWEQKV GGVSPEEHPA PEVSTPFPPL
510 520 530 540 550
PPEPEGGGEE KVVGMEESQA APKEEPGPRP RINLRGVMRS ISLLEPSLEL
560 570 580 590 600
ESTSETSDMP EVFSSHESSH EEPLQPFPQL ARTKGGQQVD RGPQPALKSR
610 620 630 640 650
QSVVTLQGSA VVANRTQAFQ EQEQGQGQGQ GEPCISSTPR FRKVVRQASV

HDSGEEGEA
Length:659
Mass (Da):72,996
Last modified:November 22, 2005 - v2
Checksum:i0D96F86EAFE81D3B
GO
Isoform 2 (identifier: Q8TE77-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     470-471: SR → RT
     472-659: Missing.

Show »
Length:471
Mass (Da):52,713
Checksum:i826A8914B638DCC0
GO
Isoform 3 (identifier: Q8TE77-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-146: Missing.
     147-154: LGVDFPDS → MAFPLSPA

Show »
Length:513
Mass (Da):56,982
Checksum:iCA5FF8403E02B99F
GO
Isoform 4 (identifier: Q8TE77-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     283-547: Missing.

Note: No experimental confirmation available.
Show »
Length:394
Mass (Da):42,724
Checksum:iF87C7F5A29048AAE
GO
Isoform 5 (identifier: Q8TE77-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-330: Missing.
     331-360: RIFPHLYLGSEWNAANLEELQRNRVTHILN → MEGTMMMQQRPVLSQQHPSFILNSSPAHSP
     470-471: SR → RT
     472-659: Missing.

Note: No experimental confirmation available.
Show »
Length:141
Mass (Da):16,357
Checksum:i5B268790931CA5B6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti58A → V (PubMed:11832213).Curated1
Sequence conflicti58A → V (PubMed:14531860).Curated1
Sequence conflicti509E → G in BAC04314 (PubMed:14702039).Curated1
Sequence conflicti641F → S in BAB85080 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_057132239E → V.Corresponds to variant rs7114712dbSNPEnsembl.1
Natural variantiVAR_057133600R → H.Corresponds to variant rs1573536dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0163301 – 330Missing in isoform 5. 1 PublicationAdd BLAST330
Alternative sequenceiVSP_0163311 – 146Missing in isoform 3. 1 PublicationAdd BLAST146
Alternative sequenceiVSP_016332147 – 154LGVDFPDS → MAFPLSPA in isoform 3. 1 Publication8
Alternative sequenceiVSP_016333283 – 547Missing in isoform 4. 1 PublicationAdd BLAST265
Alternative sequenceiVSP_016334331 – 360RIFPH…THILN → MEGTMMMQQRPVLSQQHPSF ILNSSPAHSP in isoform 5. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_016335470 – 471SR → RT in isoform 2 and isoform 5. 2 Publications2
Alternative sequenceiVSP_016336472 – 659Missing in isoform 2 and isoform 5. 2 PublicationsAdd BLAST188

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB072360 mRNA. Translation: BAB84119.3.
AB099291 mRNA. Translation: BAC97814.1.
AK000522 mRNA. Translation: BAA91228.1.
AK001790 mRNA. Translation: BAA91913.1.
AK074432 mRNA. Translation: BAB85080.1.
AK094226 mRNA. Translation: BAC04314.1.
BC007709 mRNA. Translation: AAH07709.1.
CCDSiCCDS8157.1. [Q8TE77-1]
RefSeqiNP_060327.3. NM_017857.3. [Q8TE77-1]
UniGeneiHs.29173.

Genome annotation databases

EnsembliENST00000308127; ENSP00000312081; ENSG00000172830. [Q8TE77-1]
ENST00000376757; ENSP00000365948; ENSG00000172830. [Q8TE77-3]
ENST00000532881; ENSP00000431788; ENSG00000172830. [Q8TE77-2]
GeneIDi54961.
KEGGihsa:54961.
UCSCiuc001okj.4. human. [Q8TE77-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB072360 mRNA. Translation: BAB84119.3.
AB099291 mRNA. Translation: BAC97814.1.
AK000522 mRNA. Translation: BAA91228.1.
AK001790 mRNA. Translation: BAA91913.1.
AK074432 mRNA. Translation: BAB85080.1.
AK094226 mRNA. Translation: BAC04314.1.
BC007709 mRNA. Translation: AAH07709.1.
CCDSiCCDS8157.1. [Q8TE77-1]
RefSeqiNP_060327.3. NM_017857.3. [Q8TE77-1]
UniGeneiHs.29173.

3D structure databases

ProteinModelPortaliQ8TE77.
SMRiQ8TE77.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120299. 16 interactors.
IntActiQ8TE77. 5 interactors.
MINTiMINT-5006487.
STRINGi9606.ENSP00000312081.

PTM databases

DEPODiQ8TE77.
iPTMnetiQ8TE77.
PhosphoSitePlusiQ8TE77.

Polymorphism and mutation databases

BioMutaiSSH3.
DMDMi82582268.

Proteomic databases

EPDiQ8TE77.
MaxQBiQ8TE77.
PaxDbiQ8TE77.
PeptideAtlasiQ8TE77.
PRIDEiQ8TE77.

Protocols and materials databases

DNASUi54961.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000308127; ENSP00000312081; ENSG00000172830. [Q8TE77-1]
ENST00000376757; ENSP00000365948; ENSG00000172830. [Q8TE77-3]
ENST00000532881; ENSP00000431788; ENSG00000172830. [Q8TE77-2]
GeneIDi54961.
KEGGihsa:54961.
UCSCiuc001okj.4. human. [Q8TE77-1]

Organism-specific databases

CTDi54961.
GeneCardsiSSH3.
HGNCiHGNC:30581. SSH3.
HPAiHPA019949.
HPA019957.
MIMi606780. gene.
neXtProtiNX_Q8TE77.
OpenTargetsiENSG00000172830.
PharmGKBiPA134929326.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1716. Eukaryota.
COG2453. LUCA.
GeneTreeiENSGT00760000118902.
HOVERGENiHBG089321.
InParanoidiQ8TE77.
KOiK05766.
OMAiGPWPALK.
OrthoDBiEOG091G0249.
PhylomeDBiQ8TE77.
TreeFamiTF319444.

Enzyme and pathway databases

BioCyciZFISH:HS10577-MONOMER.
SIGNORiQ8TE77.

Miscellaneous databases

GeneWikiiSSH3.
GenomeRNAii54961.
PROiQ8TE77.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000172830.
CleanExiHS_SSH3.
ExpressionAtlasiQ8TE77. baseline and differential.
GenevisibleiQ8TE77. HS.

Family and domain databases

CDDicd00127. DSPc. 1 hit.
Gene3Di1.10.10.60. 1 hit.
3.90.190.10. 1 hit.
InterProiIPR014876. DEK_C.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR024950. DUSP.
IPR009057. Homeodomain-like.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR027232. Ssh.
IPR016130. Tyr_Pase_AS.
IPR000387. TYR_PHOSPHATASE_dom.
IPR020422. TYR_PHOSPHATASE_DUAL_dom.
[Graphical view]
PANTHERiPTHR10159. PTHR10159. 1 hit.
PTHR10159:SF349. PTHR10159:SF349. 1 hit.
PfamiPF08766. DEK_C. 1 hit.
PF00782. DSPc. 1 hit.
[Graphical view]
SMARTiSM00195. DSPc. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 1 hit.
PROSITEiPS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSSH3_HUMAN
AccessioniPrimary (citable) accession number: Q8TE77
Secondary accession number(s): Q6PK42
, Q76I75, Q8N9L8, Q8WYL0, Q9NV45, Q9NWZ7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: November 22, 2005
Last modified: November 30, 2016
This is version 131 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Tyrosine phosphatase activity has not been demonstrated for this protein to date.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.