SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8TE68

- ES8L1_HUMAN

UniProt

Q8TE68 - ES8L1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Epidermal growth factor receptor kinase substrate 8-like protein 1
Gene
EPS8L1, DRC3, EPS8R1, PP10566
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Stimulates guanine exchange activity of SOS1. May play a role in membrane ruffling and remodeling of the actin cytoskeleton.1 Publication

GO - Molecular functioni

  1. T cell receptor binding Source: UniProt
  2. actin binding Source: UniProt
  3. protein binding Source: IntAct

GO - Biological processi

  1. Rho protein signal transduction Source: UniProt
  2. positive regulation of ruffle assembly Source: UniProt
  3. regulation of Rac GTPase activity Source: GOC
  4. regulation of Rho GTPase activity Source: GOC
  5. regulation of Rho protein signal transduction Source: UniProt
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Epidermal growth factor receptor kinase substrate 8-like protein 1
Short name:
EPS8-like protein 1
Alternative name(s):
Epidermal growth factor receptor pathway substrate 8-related protein 1
Short name:
EPS8-related protein 1
Gene namesi
Name:EPS8L1
Synonyms:DRC3, EPS8R1
ORF Names:PP10566
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:21295. EPS8L1.

Subcellular locationi

Cytoplasm 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. extracellular vesicular exosome Source: UniProt
  3. protein complex Source: UniProt
  4. ruffle membrane Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134990326.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 723723Epidermal growth factor receptor kinase substrate 8-like protein 1
PRO_0000239082Add
BLAST

Proteomic databases

MaxQBiQ8TE68.
PaxDbiQ8TE68.
PRIDEiQ8TE68.

PTM databases

PhosphoSiteiQ8TE68.

Expressioni

Tissue specificityi

Detected in placenta.1 Publication

Gene expression databases

ArrayExpressiQ8TE68.
BgeeiQ8TE68.
CleanExiHS_EPS8L1.
GenevestigatoriQ8TE68.

Organism-specific databases

HPAiHPA041851.
HPA043545.

Interactioni

Subunit structurei

Interacts with ABI1. Part of a complex that contains SOS1, ABI1 and EPS8L2. Associates with F-actin.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CD3EP077666EBI-7487998,EBI-1211297

Protein-protein interaction databases

BioGridi120218. 4 interactions.
IntActiQ8TE68. 1 interaction.
MINTiMINT-4829629.
STRINGi9606.ENSP00000201647.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi482 – 4876
Beta strandi493 – 4964
Beta strandi504 – 5096
Beta strandi511 – 5188
Beta strandi525 – 5284
Helixi529 – 5313
Beta strandi532 – 5343

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2K2MNMR-A481-536[»]
2ROLNMR-A478-537[»]
ProteinModelPortaliQ8TE68.
SMRiQ8TE68. Positions 30-159, 478-537, 612-694.

Miscellaneous databases

EvolutionaryTraceiQ8TE68.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini478 – 53760SH3
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili689 – 71931 Reviewed prediction
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi119 – 1224Poly-Leu
Compositional biasi448 – 4514Poly-Arg
Compositional biasi534 – 57643Pro-rich
Add
BLAST

Sequence similaritiesi

Belongs to the EPS8 family.
Contains 1 SH3 domain.

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

eggNOGiNOG263108.
HOVERGENiHBG003090.
InParanoidiQ8TE68.
KOiK17277.
OMAiMLCVNEE.
PhylomeDBiQ8TE68.
TreeFamiTF313069.

Family and domain databases

InterProiIPR013625. PTB.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF08416. PTB. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
SMARTiSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8TE68-1) [UniParc]FASTAAdd to Basket

Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSTATGPEAA PKPSAKSIYE QRKRYSTVVM ADVSQYPVNH LVTFCLGEDD    50
GVHTVEDASR KLAVMDSQGR VWAQEMLLRV SPDHVTLLDP ASKEELESYP 100
LGAIVRCDAV MPPGRSRSLL LLVCQEPERA QPDVHFFQGL RLGAELIRED 150
IQGALHNYRS GRGERRAAAL RATQEELQRD RSPAAETPPL QRRPSVRAVI 200
STVERGAGRG RPQAKPIPEA EEAQRPEPVG TSSNADSASP DLGPRGPDLA 250
VLQAEREVDI LNHVFDDVES FVSRLQKSAE AARVLEHRER GRRSRRRAAG 300
EGLLTLRAKP PSEAEYTDVL QKIKYAFSLL ARLRGNIADP SSPELLHFLF 350
GPLQMIVNTS GGPEFASSVR RPHLTSDAVA LLRDNVTPRE NELWTSLGDS 400
WTRPGLELSP EEGPPYRPEF FSGWEPPVTD PQSRAWEDPV EKQLQHERRR 450
RQQSAPQVAV NGHRDLEPES EPQLESETAG KWVLCNYDFQ ARNSSELSVK 500
QRDVLEVLDD SRKWWKVRDP AGQEGYVPYN ILTPYPGPRL HHSQSPARSL 550
NSTPPPPPAP APAPPPALAR PRWDRPRWDS CDSLNGLDPS EKEKFSQMLI 600
VNEELQARLA QGRSGPSRAV PGPRAPEPQL SPGSDASEVR AWLQAKGFSS 650
GTVDALGVLT GAQLFSLQKE ELRAVSPEEG ARVYSQVTVQ RSLLEDKEKV 700
SELEAVMEKQ KKKVEGEVEM EVI 723
Length:723
Mass (Da):80,251
Last modified:May 18, 2010 - v3
Checksum:iE55F71B6E128151E
GO
Isoform 2 (identifier: Q8TE68-2) [UniParc]FASTAAdd to Basket

Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     1-127: Missing.
     128-143: ERAQPDVHFFQGLRLG → MNRTWPRRIWGSSQDE

Show »
Length:596
Mass (Da):66,477
Checksum:iCA417997A8419B8F
GO
Isoform 3 (identifier: Q8TE68-3) [UniParc]FASTAAdd to Basket

Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MSTATGPEAAPKPSAKSIYEQRKRYSTVVMADVSQYPVN → MGRKAIVLAIANTSLAFPLCQ
     451-451: R → RQVTQATQQGRGWEVRGRGRSAWPRLTRLSYFL
     509-696: DDSRKWWKVR...VTVQRSLLED → ED

Show »
Length:551
Mass (Da):61,682
Checksum:i39325B1AB8281946
GO
Isoform 4 (identifier: Q8TE68-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-177: Missing.
     178-187: QRDRSPAAET → MSPLSPGSPL
     191-300: QRRPSVRAVI...GRRSRRRAAG → ARADLTAILTGCPPLSACLVLAPRPHRRARLLPS
     451-451: R → RQVTQATQQGRGWEVRGRGRSAWPRLTRLSYFL

Show »
Length:502
Mass (Da):55,807
Checksum:i03BA1843CECD229A
GO

Sequence cautioni

The sequence AAG03038.1 differs from that shown. Reason: Frameshift at position 596.
The sequence AAG03039.1 differs from that shown. Reason: Erroneous gene model prediction.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti4 – 41A → T.2 Publications
Corresponds to variant rs12609976 [ dbSNP | Ensembl ].
VAR_060375
Natural varianti288 – 2881R → G.
Corresponds to variant rs1620074 [ dbSNP | Ensembl ].
VAR_060376
Natural varianti457 – 4571Q → E.2 Publications
Corresponds to variant rs1628576 [ dbSNP | Ensembl ].
VAR_056870
Natural varianti669 – 6691K → R.3 Publications
Corresponds to variant rs1054940 [ dbSNP | Ensembl ].
VAR_060377
Natural varianti703 – 7031L → P.
Corresponds to variant rs60073068 [ dbSNP | Ensembl ].
VAR_061647

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 177177Missing in isoform 4.
VSP_019082Add
BLAST
Alternative sequencei1 – 127127Missing in isoform 2.
VSP_019083Add
BLAST
Alternative sequencei1 – 3939MSTAT…QYPVN → MGRKAIVLAIANTSLAFPLC Q in isoform 3.
VSP_019084Add
BLAST
Alternative sequencei128 – 14316ERAQP…GLRLG → MNRTWPRRIWGSSQDE in isoform 2.
VSP_019085Add
BLAST
Alternative sequencei178 – 18710QRDRSPAAET → MSPLSPGSPL in isoform 4.
VSP_019086
Alternative sequencei191 – 300110QRRPS…RRAAG → ARADLTAILTGCPPLSACLV LAPRPHRRARLLPS in isoform 4.
VSP_019087Add
BLAST
Alternative sequencei451 – 4511R → RQVTQATQQGRGWEVRGRGR SAWPRLTRLSYFL in isoform 3 and isoform 4.
VSP_019088
Alternative sequencei509 – 696188DDSRK…SLLED → ED in isoform 3.
VSP_019089Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti30 – 301M → T in BAC11399. 1 Publication
Sequence conflicti555 – 5551P → S in AAL76117. 1 Publication
Sequence conflicti688 – 6881T → I in BAA91041. 1 Publication
Sequence conflicti695 – 6951E → G in BAC11399. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF282168 Genomic DNA. Translation: AAG03039.1. Sequence problems.
AF282167 mRNA. Translation: AAG03038.1. Frameshift.
AY074928 mRNA. Translation: AAL76117.1.
AF370395 mRNA. Translation: AAQ15231.1.
AK000265 mRNA. Translation: BAA91041.1.
AK075098 mRNA. Translation: BAC11399.1.
AC005782 Genomic DNA. No translation available.
AC011476 Genomic DNA. No translation available.
BC004907 mRNA. Translation: AAH04907.2.
BC015763 mRNA. Translation: AAH15763.1.
CCDSiCCDS12914.1. [Q8TE68-1]
CCDS12915.1. [Q8TE68-2]
RefSeqiNP_060199.3. NM_017729.3. [Q8TE68-2]
NP_573441.2. NM_133180.2. [Q8TE68-1]
UniGeneiHs.438862.

Genome annotation databases

EnsembliENST00000201647; ENSP00000201647; ENSG00000131037. [Q8TE68-1]
ENST00000245618; ENSP00000245618; ENSG00000131037. [Q8TE68-2]
ENST00000570966; ENSP00000460865; ENSG00000262092. [Q8TE68-1]
ENST00000571441; ENSP00000459036; ENSG00000262225. [Q8TE68-2]
ENST00000571474; ENSP00000459625; ENSG00000262287. [Q8TE68-2]
ENST00000572133; ENSP00000459405; ENSG00000263295. [Q8TE68-1]
ENST00000572335; ENSP00000461108; ENSG00000262430. [Q8TE68-1]
ENST00000572411; ENSP00000458499; ENSG00000262430. [Q8TE68-2]
ENST00000572780; ENSP00000461691; ENSG00000263295. [Q8TE68-2]
ENST00000573442; ENSP00000459703; ENSG00000262092. [Q8TE68-2]
ENST00000573454; ENSP00000459674; ENSG00000262467. [Q8TE68-2]
ENST00000574541; ENSP00000458597; ENSG00000262225. [Q8TE68-1]
ENST00000574553; ENSP00000460946; ENSG00000262878. [Q8TE68-2]
ENST00000574658; ENSP00000461137; ENSG00000262878. [Q8TE68-1]
ENST00000575092; ENSP00000460617; ENSG00000262467. [Q8TE68-1]
ENST00000576005; ENSP00000459396; ENSG00000262835. [Q8TE68-2]
ENST00000576261; ENSP00000459340; ENSG00000262287. [Q8TE68-1]
ENST00000577025; ENSP00000459502; ENSG00000262835. [Q8TE68-1]
ENST00000603724; ENSP00000474194; ENSG00000270836. [Q8TE68-2]
ENST00000604610; ENSP00000474112; ENSG00000270836. [Q8TE68-1]
GeneIDi54869.
KEGGihsa:54869.
UCSCiuc002qis.4. human. [Q8TE68-1]
uc002qiu.3. human. [Q8TE68-2]
uc002qiv.3. human. [Q8TE68-4]
uc010ess.1. human. [Q8TE68-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF282168 Genomic DNA. Translation: AAG03039.1 . Sequence problems.
AF282167 mRNA. Translation: AAG03038.1 . Frameshift.
AY074928 mRNA. Translation: AAL76117.1 .
AF370395 mRNA. Translation: AAQ15231.1 .
AK000265 mRNA. Translation: BAA91041.1 .
AK075098 mRNA. Translation: BAC11399.1 .
AC005782 Genomic DNA. No translation available.
AC011476 Genomic DNA. No translation available.
BC004907 mRNA. Translation: AAH04907.2 .
BC015763 mRNA. Translation: AAH15763.1 .
CCDSi CCDS12914.1. [Q8TE68-1 ]
CCDS12915.1. [Q8TE68-2 ]
RefSeqi NP_060199.3. NM_017729.3. [Q8TE68-2 ]
NP_573441.2. NM_133180.2. [Q8TE68-1 ]
UniGenei Hs.438862.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2K2M NMR - A 481-536 [» ]
2ROL NMR - A 478-537 [» ]
ProteinModelPortali Q8TE68.
SMRi Q8TE68. Positions 30-159, 478-537, 612-694.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120218. 4 interactions.
IntActi Q8TE68. 1 interaction.
MINTi MINT-4829629.
STRINGi 9606.ENSP00000201647.

PTM databases

PhosphoSitei Q8TE68.

Proteomic databases

MaxQBi Q8TE68.
PaxDbi Q8TE68.
PRIDEi Q8TE68.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000201647 ; ENSP00000201647 ; ENSG00000131037 . [Q8TE68-1 ]
ENST00000245618 ; ENSP00000245618 ; ENSG00000131037 . [Q8TE68-2 ]
ENST00000570966 ; ENSP00000460865 ; ENSG00000262092 . [Q8TE68-1 ]
ENST00000571441 ; ENSP00000459036 ; ENSG00000262225 . [Q8TE68-2 ]
ENST00000571474 ; ENSP00000459625 ; ENSG00000262287 . [Q8TE68-2 ]
ENST00000572133 ; ENSP00000459405 ; ENSG00000263295 . [Q8TE68-1 ]
ENST00000572335 ; ENSP00000461108 ; ENSG00000262430 . [Q8TE68-1 ]
ENST00000572411 ; ENSP00000458499 ; ENSG00000262430 . [Q8TE68-2 ]
ENST00000572780 ; ENSP00000461691 ; ENSG00000263295 . [Q8TE68-2 ]
ENST00000573442 ; ENSP00000459703 ; ENSG00000262092 . [Q8TE68-2 ]
ENST00000573454 ; ENSP00000459674 ; ENSG00000262467 . [Q8TE68-2 ]
ENST00000574541 ; ENSP00000458597 ; ENSG00000262225 . [Q8TE68-1 ]
ENST00000574553 ; ENSP00000460946 ; ENSG00000262878 . [Q8TE68-2 ]
ENST00000574658 ; ENSP00000461137 ; ENSG00000262878 . [Q8TE68-1 ]
ENST00000575092 ; ENSP00000460617 ; ENSG00000262467 . [Q8TE68-1 ]
ENST00000576005 ; ENSP00000459396 ; ENSG00000262835 . [Q8TE68-2 ]
ENST00000576261 ; ENSP00000459340 ; ENSG00000262287 . [Q8TE68-1 ]
ENST00000577025 ; ENSP00000459502 ; ENSG00000262835 . [Q8TE68-1 ]
ENST00000603724 ; ENSP00000474194 ; ENSG00000270836 . [Q8TE68-2 ]
ENST00000604610 ; ENSP00000474112 ; ENSG00000270836 . [Q8TE68-1 ]
GeneIDi 54869.
KEGGi hsa:54869.
UCSCi uc002qis.4. human. [Q8TE68-1 ]
uc002qiu.3. human. [Q8TE68-2 ]
uc002qiv.3. human. [Q8TE68-4 ]
uc010ess.1. human. [Q8TE68-3 ]

Organism-specific databases

CTDi 54869.
GeneCardsi GC19P055583.
HGNCi HGNC:21295. EPS8L1.
HPAi HPA041851.
HPA043545.
MIMi 614987. gene.
neXtProti NX_Q8TE68.
PharmGKBi PA134990326.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG263108.
HOVERGENi HBG003090.
InParanoidi Q8TE68.
KOi K17277.
OMAi MLCVNEE.
PhylomeDBi Q8TE68.
TreeFami TF313069.

Miscellaneous databases

ChiTaRSi EPS8L1. human.
EvolutionaryTracei Q8TE68.
GeneWikii EPS8L1.
GenomeRNAii 54869.
NextBioi 57779.
PROi Q8TE68.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8TE68.
Bgeei Q8TE68.
CleanExi HS_EPS8L1.
Genevestigatori Q8TE68.

Family and domain databases

InterProi IPR013625. PTB.
IPR001452. SH3_domain.
[Graphical view ]
Pfami PF08416. PTB. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view ]
SMARTi SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF50044. SSF50044. 1 hit.
PROSITEi PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and expression analyses of down-regulated cDNA C6-2A in human esophageal cancer."
    Wu K., Xu Z., Wang M., Xu X., Han Y., Cao Y., Wang R., Sun Y., Wu M.
    Zhonghua Yi Xue Yi Chuan Xue Za Zhi 16:325-327(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 4).
  2. "In silico analysis of the EPS8 gene family: genomic organization, expression profile, and protein structure."
    Tocchetti A., Confalonieri S., Scita G., Di Fiore P.P., Betsholtz C.
    Genomics 81:234-244(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS THR-4; GLU-457 AND ARG-669.
  3. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
    Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
    , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
    Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS THR-4; GLU-457 AND ARG-669.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT ARG-669.
    Tissue: Placenta.
  5. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Muscle and Skin.
  7. "The eps8 family of proteins links growth factor stimulation to actin reorganization generating functional redundancy in the Ras/Rac pathway."
    Offenhaeuser N., Borgonovo A., Disanza A., Romano P., Ponzanelli I., Iannolo G., Di Fiore P.P., Scita G.
    Mol. Biol. Cell 15:91-98(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, IDENTIFICATION IN A COMPLEX WITH ABI1 AND SOS1, INTERACTION WITH ABI1, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiES8L1_HUMAN
AccessioniPrimary (citable) accession number: Q8TE68
Secondary accession number(s): Q71RE2
, Q8NC10, Q96BB7, Q9BSQ2, Q9GZQ2, Q9NXH0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: May 18, 2010
Last modified: July 9, 2014
This is version 95 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi