Q8TE56 (ATS17_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 105.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: A disintegrin and metalloproteinase with thrombospondin motifs 17 Short name=ADAM-TS 17 Short name=ADAM-TS17 Short name=ADAMTS-17 EC=3.4.24.- | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1095 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Secreted › extracellular space › extracellular matrix By similarity. |
| Tissue specificity | Isoform 1 and isoform 2 are expressed at high levels in the lung, brain, whole eye and retina. Isoform 1 shows a weaker expression in the heart, kidney and skeletal muscle. Isoform 2 shows a weaker expression in the kidney, bone marrow and skeletal muscle. Isoform 1 and isoform 2 are expressed at high levels in the fetal heart, kidney, and whole eye, whereas a weak expression is seen in the fetal liver. Ref.5 |
| Domain | The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. |
| Post-translational modification | The precursor is cleaved by a furin endopeptidase By similarity. Glycosylated. Can be O-fucosylated by POFUT2 on a serine or a threonine residue found within the consensus sequence C1-X(2)-(S/T)-C2-G of the TSP type-1 repeat domains where C1 and C2 are the first and second cysteine residue of the repeat, respectively. Fucosylated repeats can then be further glycosylated by the addition of a beta-1,3-glucose residue by the glucosyltransferase, B3GALTL. Fucosylation mediates the efficient secretion of ADAMTS family members. Also can be C-glycosylated with one or two mannose molecules on tryptophan residues within the consensus sequence W-X-X-W of the TPRs, and N-glycosylated. These other glycosylations can also facilitate secretion By similarity. |
| Involvement in disease | Weill-Marchesani-like syndrome (WMLS) [MIM:613195]: A disorder characterized by many of the key features of Weill-Marchesani syndrome, including lenticular myopia, ectopia lentis, glaucoma, spherophakia and short stature. However, the characteristic brachydactyly or decreased joint flexibility of Weill-Marchesani syndrome are absent. |
| Sequence similarities | Contains 1 disintegrin domain. Contains 1 peptidase M12B domain. Contains 1 PLAC domain. Contains 5 TSP type-1 domains. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Extracellular matrix Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Deafness Dwarfism |
| Domain | Repeat Signal |
| Ligand | Metal-binding Zinc |
| Molecular function | Hydrolase Metalloprotease Protease |
| PTM | Cleavage on pair of basic residues Disulfide bond Glycoprotein Zymogen |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | proteolysis Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | proteinaceous extracellular matrix Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | metalloendopeptidase activity Inferred from electronic annotation. Source: InterPro zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms may exist. | ||||||
| Isoform 1 (identifier: Q8TE56-1) Also known as: a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8TE56-2) Also known as: b; The sequence of this isoform differs from the canonical sequence as follows: 1-243: Missing. 713-745: ALKDSGKGSINSDWKIELPGEFQIAGTTVRYVR → GYIEAAVIPAGARRIRVVEDKPAHSFLGKTQMT 746-1095: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 27 | 27 | Potential | ||||||||
| Propeptide | 28 – 223 | 196 | By similarity | PRO_0000029198 | |||||||
| Chain | 224 – 1095 | 872 | A disintegrin and metalloproteinase with thrombospondin motifs 17 | PRO_0000029199 | |||||||
Regions | |||||||||||
| Domain | 232 – 452 | 221 | Peptidase M12B | ||||||||
| Domain | 453 – 542 | 90 | Disintegrin | ||||||||
| Domain | 543 – 598 | 56 | TSP type-1 1 | ||||||||
| Domain | 800 – 860 | 61 | TSP type-1 2 | ||||||||
| Domain | 861 – 922 | 62 | TSP type-1 3 | ||||||||
| Domain | 925 – 968 | 44 | TSP type-1 4 | ||||||||
| Domain | 972 – 1029 | 58 | TSP type-1 5 | ||||||||
| Domain | 1045 – 1084 | 40 | PLAC | ||||||||
| Region | 702 – 779 | 78 | Spacer | ||||||||
| Motif | 199 – 206 | 8 | Cysteine switch By similarity | ||||||||
| Compositional bias | 60 – 120 | 61 | Arg-rich | ||||||||
| Compositional bias | 599 – 701 | 103 | Cys-rich | ||||||||
Sites | |||||||||||
| Active site | 390 | 1 | By similarity | ||||||||
| Metal binding | 201 | 1 | Zinc; in inhibited form By similarity | ||||||||
| Metal binding | 389 | 1 | Zinc; catalytic By similarity | ||||||||
| Metal binding | 393 | 1 | Zinc; catalytic By similarity | ||||||||
| Metal binding | 399 | 1 | Zinc; catalytic By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 167 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 483 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 785 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 790 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 832 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 839 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 894 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 367 ↔ 447 | By similarity | |||||||||
| Disulfide bond | 406 ↔ 431 | By similarity | |||||||||
| Disulfide bond | 555 ↔ 592 | By similarity | |||||||||
| Disulfide bond | 559 ↔ 597 | By similarity | |||||||||
| Disulfide bond | 570 ↔ 582 | By similarity | |||||||||
| Disulfide bond | 873 ↔ 916 | By similarity | |||||||||
| Disulfide bond | 877 ↔ 921 | By similarity | |||||||||
| Disulfide bond | 888 ↔ 905 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 243 | 243 | Missing in isoform 2. | VSP_040331 | |||||||
| Alternative sequence | 713 – 745 | 33 | ALKDS…VRYVR → GYIEAAVIPAGARRIRVVED KPAHSFLGKTQMT in isoform 2. | VSP_040332 | |||||||
| Alternative sequence | 746 – 1095 | 350 | Missing in isoform 2. | VSP_040333 | |||||||
| Natural variant | 216 | 1 | S → L. Ref.5 Corresponds to variant rs7496668 [ dbSNP | Ensembl ]. | VAR_057081 | |||||||
| Natural variant | 482 | 1 | M → T. Ref.5 Corresponds to variant rs28567966 [ dbSNP | Ensembl ]. | VAR_057082 | |||||||
| Natural variant | 566 | 1 | R → T. Ref.2 | VAR_064041 | |||||||
| Natural variant | 1094 | 1 | N → S. Ref.1 Ref.5 Corresponds to variant rs2573652 [ dbSNP | Ensembl ]. | VAR_060317 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 702 | 1 | V → A in BAD18500. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning, expression analysis, and structural characterization of seven novel human ADAMTSs, a family of metalloproteinases with disintegrin and thrombospondin-1 domains." Cal S., Obaya A.J., Llamazares M., Garabaya C., Quesada V., Lopez-Otin C. Gene 283:49-62(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT SER-1094. |
| [2] | "Genetic variation in ADAMTS17 gene." Tan J., Davila S., Hibberd M.L., Seielstad M. Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-566. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Thymus. |
| [4] | "Analysis of the DNA sequence and duplication history of human chromosome 15." Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. Nusbaum C.Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "Homozygous mutations in ADAMTS10 and ADAMTS17 cause lenticular myopia, ectopia lentis, glaucoma, spherophakia, and short stature." Morales J., Al-Sharif L., Khalil D.S., Shinwari J.M., Bavi P., Al-Mahrouqi R.A., Al-Rajhi A., Alkuraya F.S., Meyer B.F., Al Tassan N. Am. J. Hum. Genet. 85:558-568(2009) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS LEU-216; THR-482 AND SER-1094, INVOLVEMENT IN WMLS, ALTERNATIVE SPLICING, TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ315735 mRNA. Translation: CAC86016.1. DQ217943 Genomic DNA. Translation: ABB70740.1. AK131344 mRNA. Translation: BAD18500.1. AC015723 Genomic DNA. No translation available. AC022710 Genomic DNA. No translation available. AC084855 Genomic DNA. No translation available. AC113187 Genomic DNA. No translation available. |
| IPI | IPI00152635. IPI00442191. |
| RefSeq | NP_620688.2. NM_139057.2. |
| UniGene | Hs.513200. |
3D structure databases | |
| ProteinModelPortal | Q8TE56. |
| SMR | Q8TE56. Positions 234-785, 798-972, 975-1031. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000268070. |
Protein family/group databases | |
| MEROPS | M12.027. |
PTM databases | |
| PhosphoSite | Q8TE56. |
Polymorphism databases | |
| DMDM | 296434401. |
Proteomic databases | |
| PaxDb | Q8TE56. |
| PRIDE | Q8TE56. |
Protocols and materials databases | |
| DNASU | 170691. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000268070; ENSP00000268070; ENSG00000140470. |
| GeneID | 170691. |
| KEGG | hsa:170691. |
| UCSC | uc002bvv.1. human. uc002bvx.1. human. |
Organism-specific databases | |
| CTD | 170691. |
| GeneCards | GC15M100511. |
| H-InvDB | HIX0012615. |
| HGNC | HGNC:17109. ADAMTS17. |
| MIM | 607511. gene. 613195. phenotype. |
| neXtProt | NX_Q8TE56. |
| Orphanet | 3449. Weill-Marchesani syndrome. |
| PharmGKB | PA24543. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG259740. |
| HOGENOM | HOG000004800. |
| HOVERGEN | HBG050621. |
| InParanoid | Q8TE56. |
| KO | K08631. |
| OMA | QSCEGQD. |
| OrthoDB | EOG480HVW. |
| PhylomeDB | Q8TE56. |
Gene expression databases | |
| ArrayExpress | Q8TE56. |
| Bgee | Q8TE56. |
| CleanEx | HS_ADAMTS17. |
| Genevestigator | Q8TE56. |
| GermOnline | ENSG00000140470. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.40.390.10. 1 hit. |
| InterPro | IPR010294. ADAM_spacer1. IPR024079. MetalloPept_cat_dom. IPR001590. Peptidase_M12B. IPR013273. Peptidase_M12B_ADAM-TS. IPR002870. Peptidase_M12B_N. IPR010909. PLAC. IPR000884. Thrombospondin_1_rpt. IPR007087. Znf_C2H2. [Graphical view] |
| Pfam | PF05986. ADAM_spacer1. 1 hit. PF01562. Pep_M12B_propep. 1 hit. PF08686. PLAC. 1 hit. PF01421. Reprolysin. 1 hit. PF00090. TSP_1. 4 hits. [Graphical view] |
| PRINTS | PR01857. ADAMTSFAMILY. |
| SMART | SM00209. TSP1. 5 hits. [Graphical view] |
| SUPFAM | SSF82895. TSP1. 5 hits. |
| PROSITE | PS50215. ADAM_MEPRO. 1 hit. PS00546. CYSTEINE_SWITCH. False negative. PS00427. DISINTEGRIN_1. False negative. PS50214. DISINTEGRIN_2. False negative. PS50900. PLAC. 1 hit. PS50092. TSP1. 5 hits. PS00142. ZINC_PROTEASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | ADAMTS17. human. |
| GenomeRNAi | 170691. |
| NextBio | 89106. |
| SOURCE | Search... |
Entry information
| Entry name | ATS17_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8TE56 Secondary accession number(s): Q2I7G4, Q6ZN75 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
