Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8TE04

- PANK1_HUMAN

UniProt

Q8TE04 - PANK1_HUMAN

Protein

Pantothenate kinase 1

Gene

PANK1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 119 (01 Oct 2014)
      Sequence version 2 (17 Jan 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Plays a role in the physiological regulation of the intracellular CoA concentration.By similarity

    Catalytic activityi

    ATP + (R)-pantothenate = ADP + (R)-4'-phosphopantothenate.

    Enzyme regulationi

    Regulated by feedback inhibition by CoA and its thioesters. Strongly inhibited by acetyl-CoA and by manyl-CoA and also inhibited by high concentration of non-esterified CoA (CoASH) By similarity.By similarity

    Pathwayi

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei417 – 4171Acetyl-CoA1 Publication
    Binding sitei420 – 4201Acetyl-CoA1 Publication
    Binding sitei432 – 4321Acetyl-CoA1 Publication

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. pantothenate kinase activity Source: UniProtKB-EC

    GO - Biological processi

    1. coenzyme A biosynthetic process Source: UniProtKB-UniPathway
    2. coenzyme biosynthetic process Source: Reactome
    3. pantothenate metabolic process Source: Reactome
    4. small molecule metabolic process Source: Reactome
    5. vitamin metabolic process Source: Reactome
    6. water-soluble vitamin metabolic process Source: Reactome

    Keywords - Molecular functioni

    Kinase, Transferase

    Keywords - Biological processi

    Coenzyme A biosynthesis

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    ReactomeiREACT_11218. Coenzyme A biosynthesis.
    UniPathwayiUPA00241; UER00352.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Pantothenate kinase 1 (EC:2.7.1.33)
    Short name:
    hPanK
    Short name:
    hPanK1
    Alternative name(s):
    Pantothenic acid kinase 1
    Gene namesi
    Name:PANK1
    Synonyms:PANK
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 10

    Organism-specific databases

    HGNCiHGNC:8598. PANK1.

    Subcellular locationi

    Cytoplasm 1 Publication

    GO - Cellular componenti

    1. cell periphery Source: Ensembl
    2. clathrin coat Source: Ensembl
    3. cytosol Source: Reactome
    4. nucleus Source: Ensembl
    5. recycling endosome Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA32928.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 598598Pantothenate kinase 1PRO_0000161802Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei215 – 2151Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ8TE04.
    PaxDbiQ8TE04.
    PRIDEiQ8TE04.

    PTM databases

    PhosphoSiteiQ8TE04.

    Expressioni

    Tissue specificityi

    Isoform 1 is expressed at high levels in brain, heart, kidney, liver, skeletal muscle and testis. Isoform 2 is detected at much lower levels in kidney, liver, brain and testis and is not detected in heart or skeletal muscle.1 Publication

    Inductioni

    Isoform 1 is induced by bezafibrate, a hypolipidemic drug which acts as an agonist of peroxisome proliferator activator receptor alpha (PPARA), while isoform 2 levels decrease slightly.1 Publication

    Gene expression databases

    BgeeiQ8TE04.
    CleanExiHS_PANK1.
    GenevestigatoriQ8TE04.

    Organism-specific databases

    HPAiHPA021795.

    Interactioni

    Subunit structurei

    Homodimer.1 Publication

    Protein-protein interaction databases

    BioGridi119751. 2 interactions.
    IntActiQ8TE04. 1 interaction.
    MINTiMINT-3319085.
    STRINGi9606.ENSP00000302108.

    Structurei

    Secondary structure

    1
    598
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi238 – 2436
    Beta strandi245 – 25511
    Helixi260 – 2656
    Helixi273 – 2797
    Beta strandi281 – 2833
    Beta strandi284 – 2863
    Beta strandi287 – 2893
    Helixi291 – 2933
    Beta strandi295 – 2995
    Beta strandi304 – 31310
    Helixi314 – 3163
    Helixi317 – 3237
    Helixi329 – 3313
    Beta strandi338 – 3403
    Turni341 – 3444
    Helixi345 – 3473
    Beta strandi357 – 3604
    Helixi363 – 37715
    Beta strandi384 – 3907
    Turni394 – 3963
    Beta strandi398 – 4025
    Beta strandi409 – 42618
    Beta strandi429 – 4379
    Helixi440 – 45112
    Helixi456 – 46510
    Helixi468 – 4703
    Beta strandi472 – 4743
    Helixi475 – 4795
    Helixi484 – 4863
    Beta strandi492 – 4954
    Turni496 – 5016
    Helixi503 – 5064
    Helixi511 – 53727
    Beta strandi542 – 5465
    Helixi547 – 5493
    Beta strandi551 – 5533
    Helixi554 – 56613
    Turni567 – 5693
    Beta strandi573 – 5764
    Turni577 – 5804
    Helixi582 – 59110

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2I7NX-ray1.90A/B234-593[»]
    3SMPX-ray1.90A/B231-597[»]
    ProteinModelPortaliQ8TE04.
    SMRiQ8TE04. Positions 232-594.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ8TE04.

    Family & Domainsi

    Domaini

    The N-terminal extension, present in isoform 1 may be the regulatory domain.

    Sequence similaritiesi

    Belongs to the type II pantothenate kinase family.Curated

    Phylogenomic databases

    eggNOGiCOG5146.
    HOGENOMiHOG000194690.
    HOVERGENiHBG053495.
    InParanoidiQ8TE04.
    KOiK09680.
    OMAiCSRGPVG.
    OrthoDBiEOG7R2BJR.
    PhylomeDBiQ8TE04.
    TreeFamiTF314866.

    Family and domain databases

    InterProiIPR004567. Type_II_PanK.
    [Graphical view]
    PfamiPF03630. Fumble. 1 hit.
    [Graphical view]
    TIGRFAMsiTIGR00555. panK_eukar. 1 hit.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8TE04-1) [UniParc]FASTAAdd to Basket

    Also known as: PanK1-alpha, PANK1a

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLKLVGGGGG QDWACSVAGT SLGGEEAAFE VARPGDQGKA GGGSPGWGCA    50
    GIPDSAPGAG VLQAGAVGPA RGGQGAEEVG ESAGGGEERR VRHPQAPALR 100
    LLNRKPQGGS GEIKTPENDL QRGRLSRGPR TAPPAPGMGD RSGQQERSVP 150
    HSPGAPVGTS AAAVNGLLHN GFHPPPVQPP HVCSRGPVGG SDAAPQRLPL 200
    LPELQPQPLL PQHDSPAKKC RLRRRMDSGR KNRPPFPWFG MDIGGTLVKL 250
    VYFEPKDITA EEEQEEVENL KSIRKYLTSN TAYGKTGIRD VHLELKNLTM 300
    CGRKGNLHFI RFPSCAMHRF IQMGSEKNFS SLHTTLCATG GGAFKFEEDF 350
    RMIADLQLHK LDELDCLIQG LLYVDSVGFN GKPECYYFEN PTNPELCQKK 400
    PYCLDNPYPM LLVNMGSGVS ILAVYSKDNY KRVTGTSLGG GTFLGLCCLL 450
    TGCETFEEAL EMAAKGDSTN VDKLVKDIYG GDYERFGLQG SAVASSFGNM 500
    MSKEKRDSIS KEDLARATLV TITNNIGSIA RMCALNENID RVVFVGNFLR 550
    INMVSMKLLA YAMDFWSKGQ LKALFLEHEG YFGAVGALLE LFKMTDDK 598
    Length:598
    Mass (Da):64,339
    Last modified:January 17, 2003 - v2
    Checksum:i0A92115D5BEDFC4C
    GO
    Isoform 2 (identifier: Q8TE04-2) [UniParc]FASTAAdd to Basket

    Also known as: PANK1a, PanK1-beta

    The sequence of this isoform differs from the canonical sequence as follows:
         1-235: MLKLVGGGGG...MDSGRKNRPP → MKLINGKKQT

    Show »
    Length:373
    Mass (Da):41,671
    Checksum:i6F7D73D40E15F0F5
    GO
    Isoform 3 (identifier: Q8TE04-3) [UniParc]FASTAAdd to Basket

    Also known as: PANK1b

    The sequence of this isoform differs from the canonical sequence as follows:
         1-235: MLKLVGGGGG...MDSGRKNRPP → MKLINGKKQT
         438-496: Missing.

    Show »
    Length:314
    Mass (Da):35,579
    Checksum:i56D24B548DE056DE
    GO
    Isoform 4 (identifier: Q8TE04-4) [UniParc]FASTAAdd to Basket

    Also known as: PanK1-gamma

    The sequence of this isoform differs from the canonical sequence as follows:
         1-198: Missing.
         199-235: PLLPELQPQPLLPQHDSPAKKCRLRRRMDSGRKNRPP → MAKSKHALLPFCHGMMQQEGLHQMQSLDLGLLSLQNS

    Show »
    Length:400
    Mass (Da):44,634
    Checksum:i9BA80EA526F43832
    GO

    Sequence cautioni

    The sequence AAH26296.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti306 – 3061N → D in AAL86371. (PubMed:11809413)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 235235MLKLV…KNRPP → MKLINGKKQT in isoform 2 and isoform 3. 3 PublicationsVSP_004520Add
    BLAST
    Alternative sequencei1 – 198198Missing in isoform 4. 1 PublicationVSP_012823Add
    BLAST
    Alternative sequencei199 – 23537PLLPE…KNRPP → MAKSKHALLPFCHGMMQQEG LHQMQSLDLGLLSLQNS in isoform 4. 1 PublicationVSP_012824Add
    BLAST
    Alternative sequencei438 – 49659Missing in isoform 3. 1 PublicationVSP_004521Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF355198 mRNA. Translation: AAL86371.1.
    AL157400 Genomic DNA. Translation: CAI16826.1.
    AL157400 Genomic DNA. Translation: CAI16827.1.
    AY027661 mRNA. Translation: AAK20916.1.
    AY027662 mRNA. Translation: AAK20917.1.
    AY027663 mRNA. Translation: AAK20918.1.
    CH471066 Genomic DNA. Translation: EAW50131.1.
    BC026296 mRNA. Translation: AAH26296.1. Different initiation.
    BK000008 mRNA. Translation: DAA00002.1.
    BK000009 mRNA. Translation: DAA00003.1.
    CCDSiCCDS31244.1. [Q8TE04-1]
    CCDS7405.1. [Q8TE04-3]
    CCDS7406.1. [Q8TE04-2]
    RefSeqiNP_612189.2. NM_138316.3. [Q8TE04-3]
    NP_683878.1. NM_148977.2. [Q8TE04-1]
    NP_683879.1. NM_148978.2. [Q8TE04-2]
    UniGeneiHs.163555.

    Genome annotation databases

    EnsembliENST00000307534; ENSP00000302108; ENSG00000152782. [Q8TE04-1]
    ENST00000322191; ENSP00000318526; ENSG00000152782. [Q8TE04-3]
    ENST00000342512; ENSP00000345118; ENSG00000152782. [Q8TE04-2]
    GeneIDi53354.
    KEGGihsa:53354.
    UCSCiuc001kgn.2. human. [Q8TE04-2]
    uc001kgo.2. human. [Q8TE04-3]
    uc001kgp.2. human. [Q8TE04-1]
    uc009xtu.2. human. [Q8TE04-4]

    Polymorphism databases

    DMDMi27805665.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF355198 mRNA. Translation: AAL86371.1 .
    AL157400 Genomic DNA. Translation: CAI16826.1 .
    AL157400 Genomic DNA. Translation: CAI16827.1 .
    AY027661 mRNA. Translation: AAK20916.1 .
    AY027662 mRNA. Translation: AAK20917.1 .
    AY027663 mRNA. Translation: AAK20918.1 .
    CH471066 Genomic DNA. Translation: EAW50131.1 .
    BC026296 mRNA. Translation: AAH26296.1 . Different initiation.
    BK000008 mRNA. Translation: DAA00002.1 .
    BK000009 mRNA. Translation: DAA00003.1 .
    CCDSi CCDS31244.1. [Q8TE04-1 ]
    CCDS7405.1. [Q8TE04-3 ]
    CCDS7406.1. [Q8TE04-2 ]
    RefSeqi NP_612189.2. NM_138316.3. [Q8TE04-3 ]
    NP_683878.1. NM_148977.2. [Q8TE04-1 ]
    NP_683879.1. NM_148978.2. [Q8TE04-2 ]
    UniGenei Hs.163555.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2I7N X-ray 1.90 A/B 234-593 [» ]
    3SMP X-ray 1.90 A/B 231-597 [» ]
    ProteinModelPortali Q8TE04.
    SMRi Q8TE04. Positions 232-594.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119751. 2 interactions.
    IntActi Q8TE04. 1 interaction.
    MINTi MINT-3319085.
    STRINGi 9606.ENSP00000302108.

    Chemistry

    DrugBanki DB01393. Bezafibrate.

    PTM databases

    PhosphoSitei Q8TE04.

    Polymorphism databases

    DMDMi 27805665.

    Proteomic databases

    MaxQBi Q8TE04.
    PaxDbi Q8TE04.
    PRIDEi Q8TE04.

    Protocols and materials databases

    DNASUi 53354.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000307534 ; ENSP00000302108 ; ENSG00000152782 . [Q8TE04-1 ]
    ENST00000322191 ; ENSP00000318526 ; ENSG00000152782 . [Q8TE04-3 ]
    ENST00000342512 ; ENSP00000345118 ; ENSG00000152782 . [Q8TE04-2 ]
    GeneIDi 53354.
    KEGGi hsa:53354.
    UCSCi uc001kgn.2. human. [Q8TE04-2 ]
    uc001kgo.2. human. [Q8TE04-3 ]
    uc001kgp.2. human. [Q8TE04-1 ]
    uc009xtu.2. human. [Q8TE04-4 ]

    Organism-specific databases

    CTDi 53354.
    GeneCardsi GC10M091332.
    H-InvDB HIX0009024.
    HGNCi HGNC:8598. PANK1.
    HPAi HPA021795.
    MIMi 606160. gene.
    neXtProti NX_Q8TE04.
    PharmGKBi PA32928.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5146.
    HOGENOMi HOG000194690.
    HOVERGENi HBG053495.
    InParanoidi Q8TE04.
    KOi K09680.
    OMAi CSRGPVG.
    OrthoDBi EOG7R2BJR.
    PhylomeDBi Q8TE04.
    TreeFami TF314866.

    Enzyme and pathway databases

    UniPathwayi UPA00241 ; UER00352 .
    Reactomei REACT_11218. Coenzyme A biosynthesis.

    Miscellaneous databases

    ChiTaRSi PANK1. human.
    EvolutionaryTracei Q8TE04.
    GeneWikii PANK1.
    GenomeRNAii 53354.
    NextBioi 56014.
    PROi Q8TE04.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8TE04.
    CleanExi HS_PANK1.
    Genevestigatori Q8TE04.

    Family and domain databases

    InterProi IPR004567. Type_II_PanK.
    [Graphical view ]
    Pfami PF03630. Fumble. 1 hit.
    [Graphical view ]
    TIGRFAMsi TIGR00555. panK_eukar. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of a novel human pantothenate kinase gene."
      Ni X., Ma Y., Cheng H., Jiang M., Ying K., Xie Y., Mao Y.
      Int. J. Biochem. Cell Biol. 34:109-115(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
      Tissue: Fetal brain.
    2. "PPARalpha controls the intracellular coenzyme A concentration via regulation of PANK1alpha gene expression."
      Ramaswamy G., Karim M.A., Murti K.G., Jackowski S.
      J. Lipid Res. 45:17-31(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 4), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INDUCTION.
    3. "The DNA sequence and comparative analysis of human chromosome 10."
      Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
      , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
      Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 460-598 (ISOFORM 2).
      Tissue: Skeletal muscle.
    6. "A novel pantothenate kinase gene (PANK2) is defective in Hallervorden-Spatz syndrome."
      Zhou B., Westaway S.K., Levinson B., Johnson M.A., Gitschier J., Hayflick S.J.
      Nat. Genet. 28:345-349(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION (ISOFORM 2).
    7. Cited for: IDENTIFICATION (ISOFORM 1).
    8. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-215, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    9. "Crystal structures of human pantothenate kinases. Insights into allosteric regulation and mutations linked to a neurodegeneration disorder."
      Hong B.S., Senisterra G., Rabeh W.M., Vedadi M., Leonardi R., Zhang Y.M., Rock C.O., Jackowski S., Park H.W.
      J. Biol. Chem. 282:27984-27993(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 234-593 IN COMPLEX WITH ACETYL-COA, SUBUNIT, ENZYME REGULATION.

    Entry informationi

    Entry nameiPANK1_HUMAN
    AccessioniPrimary (citable) accession number: Q8TE04
    Secondary accession number(s): A6NIP0
    , Q7RTX6, Q7Z495, Q8TBQ8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 17, 2003
    Last sequence update: January 17, 2003
    Last modified: October 1, 2014
    This is version 119 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    4. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3