Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pantothenate kinase 1

Gene

PANK1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in the physiological regulation of the intracellular CoA concentration.By similarity

Catalytic activityi

ATP + (R)-pantothenate = ADP + (R)-4'-phosphopantothenate.

Enzyme regulationi

Regulated by feedback inhibition by CoA and its thioesters. Strongly inhibited by acetyl-CoA and by manyl-CoA and also inhibited by high concentration of non-esterified CoA (CoASH) (By similarity).By similarity

Pathwayi: coenzyme A biosynthesis

This protein is involved in step 1 of the subpathway that synthesizes CoA from (R)-pantothenate.
Proteins known to be involved in the 5 steps of the subpathway in this organism are:
  1. Pantothenate kinase 4 (PANK4), Pantothenate kinase 3 (PANK3), Pantothenate kinase 1 (PANK1), Pantothenate kinase 2, mitochondrial (PANK2)
  2. Phosphopantothenate--cysteine ligase (PPCS)
  3. Phosphopantothenoylcysteine decarboxylase (PPCDC)
  4. Bifunctional coenzyme A synthase (COASY)
  5. Bifunctional coenzyme A synthase (COASY)
This subpathway is part of the pathway coenzyme A biosynthesis, which is itself part of Cofactor biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes CoA from (R)-pantothenate, the pathway coenzyme A biosynthesis and in Cofactor biosynthesis.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei417Acetyl-CoA1 Publication1
Binding sitei420Acetyl-CoA1 Publication1
Binding sitei432Acetyl-CoA1 Publication1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Keywords - Biological processi

Coenzyme A biosynthesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS07852-MONOMER.
ZFISH:HS07852-MONOMER.
BRENDAi2.7.1.33. 2681.
ReactomeiR-HSA-196783. Coenzyme A biosynthesis.
UniPathwayiUPA00241; UER00352.

Names & Taxonomyi

Protein namesi
Recommended name:
Pantothenate kinase 1 (EC:2.7.1.33)
Short name:
hPanK
Short name:
hPanK1
Alternative name(s):
Pantothenic acid kinase 1
Gene namesi
Name:PANK1
Synonyms:PANK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:8598. PANK1.

Subcellular locationi

  • Cytoplasm 1 Publication

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi53354.
OpenTargetsiENSG00000152782.
PharmGKBiPA32928.

Chemistry databases

ChEMBLiCHEMBL3407326.

Polymorphism and mutation databases

BioMutaiPANK1.
DMDMi27805665.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001618021 – 598Pantothenate kinase 1Add BLAST598

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei215PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8TE04.
MaxQBiQ8TE04.
PaxDbiQ8TE04.
PeptideAtlasiQ8TE04.
PRIDEiQ8TE04.

PTM databases

iPTMnetiQ8TE04.
PhosphoSitePlusiQ8TE04.

Expressioni

Tissue specificityi

Isoform 1 is expressed at high levels in brain, heart, kidney, liver, skeletal muscle and testis. Isoform 2 is detected at much lower levels in kidney, liver, brain and testis and is not detected in heart or skeletal muscle.1 Publication

Inductioni

Isoform 1 is induced by bezafibrate, a hypolipidemic drug which acts as an agonist of peroxisome proliferator activator receptor alpha (PPARA), while isoform 2 levels decrease slightly.1 Publication

Gene expression databases

BgeeiENSG00000152782.
CleanExiHS_PANK1.
GenevisibleiQ8TE04. HS.

Organism-specific databases

HPAiHPA021795.

Interactioni

Subunit structurei

Homodimer.1 Publication

Protein-protein interaction databases

BioGridi119751. 2 interactors.
IntActiQ8TE04. 1 interactor.
MINTiMINT-3319085.
STRINGi9606.ENSP00000302108.

Chemistry databases

BindingDBiQ8TE04.

Structurei

Secondary structure

1598
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi238 – 243Combined sources6
Beta strandi245 – 255Combined sources11
Helixi260 – 265Combined sources6
Helixi273 – 279Combined sources7
Beta strandi281 – 283Combined sources3
Beta strandi284 – 286Combined sources3
Beta strandi287 – 289Combined sources3
Helixi291 – 293Combined sources3
Beta strandi295 – 299Combined sources5
Beta strandi304 – 313Combined sources10
Helixi314 – 316Combined sources3
Helixi317 – 323Combined sources7
Helixi329 – 331Combined sources3
Beta strandi338 – 340Combined sources3
Turni341 – 344Combined sources4
Helixi345 – 347Combined sources3
Beta strandi357 – 360Combined sources4
Helixi363 – 377Combined sources15
Beta strandi384 – 390Combined sources7
Turni394 – 396Combined sources3
Beta strandi398 – 402Combined sources5
Beta strandi409 – 426Combined sources18
Beta strandi429 – 437Combined sources9
Helixi440 – 451Combined sources12
Helixi456 – 465Combined sources10
Helixi468 – 470Combined sources3
Beta strandi472 – 474Combined sources3
Helixi475 – 479Combined sources5
Helixi484 – 486Combined sources3
Beta strandi492 – 495Combined sources4
Turni496 – 501Combined sources6
Helixi503 – 506Combined sources4
Helixi511 – 537Combined sources27
Beta strandi542 – 546Combined sources5
Helixi547 – 549Combined sources3
Beta strandi551 – 553Combined sources3
Helixi554 – 566Combined sources13
Turni567 – 569Combined sources3
Beta strandi573 – 576Combined sources4
Turni577 – 580Combined sources4
Helixi582 – 591Combined sources10

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2I7NX-ray1.90A/B234-593[»]
3SMPX-ray1.90A/B231-597[»]
ProteinModelPortaliQ8TE04.
SMRiQ8TE04.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8TE04.

Family & Domainsi

Domaini

The N-terminal extension, present in isoform 1 may be the regulatory domain.

Sequence similaritiesi

Belongs to the type II pantothenate kinase family.Curated

Phylogenomic databases

eggNOGiKOG2201. Eukaryota.
COG5146. LUCA.
GeneTreeiENSGT00390000020719.
HOGENOMiHOG000194690.
HOVERGENiHBG053495.
InParanoidiQ8TE04.
KOiK09680.
OMAiWGCAGIP.
OrthoDBiEOG091G0851.
PhylomeDBiQ8TE04.
TreeFamiTF314866.

Family and domain databases

InterProiIPR004567. Type_II_PanK.
[Graphical view]
PfamiPF03630. Fumble. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00555. panK_eukar. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TE04-1) [UniParc]FASTAAdd to basket
Also known as: PanK1-alpha, PANK1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLKLVGGGGG QDWACSVAGT SLGGEEAAFE VARPGDQGKA GGGSPGWGCA
60 70 80 90 100
GIPDSAPGAG VLQAGAVGPA RGGQGAEEVG ESAGGGEERR VRHPQAPALR
110 120 130 140 150
LLNRKPQGGS GEIKTPENDL QRGRLSRGPR TAPPAPGMGD RSGQQERSVP
160 170 180 190 200
HSPGAPVGTS AAAVNGLLHN GFHPPPVQPP HVCSRGPVGG SDAAPQRLPL
210 220 230 240 250
LPELQPQPLL PQHDSPAKKC RLRRRMDSGR KNRPPFPWFG MDIGGTLVKL
260 270 280 290 300
VYFEPKDITA EEEQEEVENL KSIRKYLTSN TAYGKTGIRD VHLELKNLTM
310 320 330 340 350
CGRKGNLHFI RFPSCAMHRF IQMGSEKNFS SLHTTLCATG GGAFKFEEDF
360 370 380 390 400
RMIADLQLHK LDELDCLIQG LLYVDSVGFN GKPECYYFEN PTNPELCQKK
410 420 430 440 450
PYCLDNPYPM LLVNMGSGVS ILAVYSKDNY KRVTGTSLGG GTFLGLCCLL
460 470 480 490 500
TGCETFEEAL EMAAKGDSTN VDKLVKDIYG GDYERFGLQG SAVASSFGNM
510 520 530 540 550
MSKEKRDSIS KEDLARATLV TITNNIGSIA RMCALNENID RVVFVGNFLR
560 570 580 590
INMVSMKLLA YAMDFWSKGQ LKALFLEHEG YFGAVGALLE LFKMTDDK
Length:598
Mass (Da):64,339
Last modified:January 17, 2003 - v2
Checksum:i0A92115D5BEDFC4C
GO
Isoform 2 (identifier: Q8TE04-2) [UniParc]FASTAAdd to basket
Also known as: PANK1a, PanK1-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-235: MLKLVGGGGG...MDSGRKNRPP → MKLINGKKQT

Show »
Length:373
Mass (Da):41,671
Checksum:i6F7D73D40E15F0F5
GO
Isoform 3 (identifier: Q8TE04-3) [UniParc]FASTAAdd to basket
Also known as: PANK1b

The sequence of this isoform differs from the canonical sequence as follows:
     1-235: MLKLVGGGGG...MDSGRKNRPP → MKLINGKKQT
     438-496: Missing.

Show »
Length:314
Mass (Da):35,579
Checksum:i56D24B548DE056DE
GO
Isoform 4 (identifier: Q8TE04-4) [UniParc]FASTAAdd to basket
Also known as: PanK1-gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-198: Missing.
     199-235: PLLPELQPQPLLPQHDSPAKKCRLRRRMDSGRKNRPP → MAKSKHALLPFCHGMMQQEGLHQMQSLDLGLLSLQNS

Show »
Length:400
Mass (Da):44,634
Checksum:i9BA80EA526F43832
GO

Sequence cautioni

The sequence AAH26296 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti306N → D in AAL86371 (PubMed:11809413).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0045201 – 235MLKLV…KNRPP → MKLINGKKQT in isoform 2 and isoform 3. 3 PublicationsAdd BLAST235
Alternative sequenceiVSP_0128231 – 198Missing in isoform 4. 1 PublicationAdd BLAST198
Alternative sequenceiVSP_012824199 – 235PLLPE…KNRPP → MAKSKHALLPFCHGMMQQEG LHQMQSLDLGLLSLQNS in isoform 4. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_004521438 – 496Missing in isoform 3. 1 PublicationAdd BLAST59

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF355198 mRNA. Translation: AAL86371.1.
AL157400 Genomic DNA. Translation: CAI16826.1.
AL157400 Genomic DNA. Translation: CAI16827.1.
AY027661 mRNA. Translation: AAK20916.1.
AY027662 mRNA. Translation: AAK20917.1.
AY027663 mRNA. Translation: AAK20918.1.
CH471066 Genomic DNA. Translation: EAW50131.1.
BC026296 mRNA. Translation: AAH26296.1. Different initiation.
BK000008 mRNA. Translation: DAA00002.1.
BK000009 mRNA. Translation: DAA00003.1.
CCDSiCCDS31244.1. [Q8TE04-1]
CCDS7405.1. [Q8TE04-3]
CCDS7406.1. [Q8TE04-2]
RefSeqiNP_612189.2. NM_138316.3. [Q8TE04-3]
NP_683878.1. NM_148977.2. [Q8TE04-1]
NP_683879.1. NM_148978.2. [Q8TE04-2]
XP_016871822.1. XM_017016333.1. [Q8TE04-4]
XP_016871827.1. XM_017016338.1.
UniGeneiHs.163555.

Genome annotation databases

EnsembliENST00000307534; ENSP00000302108; ENSG00000152782. [Q8TE04-1]
ENST00000322191; ENSP00000318526; ENSG00000152782. [Q8TE04-3]
ENST00000342512; ENSP00000345118; ENSG00000152782. [Q8TE04-2]
GeneIDi53354.
KEGGihsa:53354.
UCSCiuc001kgn.3. human. [Q8TE04-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF355198 mRNA. Translation: AAL86371.1.
AL157400 Genomic DNA. Translation: CAI16826.1.
AL157400 Genomic DNA. Translation: CAI16827.1.
AY027661 mRNA. Translation: AAK20916.1.
AY027662 mRNA. Translation: AAK20917.1.
AY027663 mRNA. Translation: AAK20918.1.
CH471066 Genomic DNA. Translation: EAW50131.1.
BC026296 mRNA. Translation: AAH26296.1. Different initiation.
BK000008 mRNA. Translation: DAA00002.1.
BK000009 mRNA. Translation: DAA00003.1.
CCDSiCCDS31244.1. [Q8TE04-1]
CCDS7405.1. [Q8TE04-3]
CCDS7406.1. [Q8TE04-2]
RefSeqiNP_612189.2. NM_138316.3. [Q8TE04-3]
NP_683878.1. NM_148977.2. [Q8TE04-1]
NP_683879.1. NM_148978.2. [Q8TE04-2]
XP_016871822.1. XM_017016333.1. [Q8TE04-4]
XP_016871827.1. XM_017016338.1.
UniGeneiHs.163555.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2I7NX-ray1.90A/B234-593[»]
3SMPX-ray1.90A/B231-597[»]
ProteinModelPortaliQ8TE04.
SMRiQ8TE04.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119751. 2 interactors.
IntActiQ8TE04. 1 interactor.
MINTiMINT-3319085.
STRINGi9606.ENSP00000302108.

Chemistry databases

BindingDBiQ8TE04.
ChEMBLiCHEMBL3407326.

PTM databases

iPTMnetiQ8TE04.
PhosphoSitePlusiQ8TE04.

Polymorphism and mutation databases

BioMutaiPANK1.
DMDMi27805665.

Proteomic databases

EPDiQ8TE04.
MaxQBiQ8TE04.
PaxDbiQ8TE04.
PeptideAtlasiQ8TE04.
PRIDEiQ8TE04.

Protocols and materials databases

DNASUi53354.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000307534; ENSP00000302108; ENSG00000152782. [Q8TE04-1]
ENST00000322191; ENSP00000318526; ENSG00000152782. [Q8TE04-3]
ENST00000342512; ENSP00000345118; ENSG00000152782. [Q8TE04-2]
GeneIDi53354.
KEGGihsa:53354.
UCSCiuc001kgn.3. human. [Q8TE04-1]

Organism-specific databases

CTDi53354.
DisGeNETi53354.
GeneCardsiPANK1.
H-InvDBHIX0009024.
HGNCiHGNC:8598. PANK1.
HPAiHPA021795.
MIMi606160. gene.
neXtProtiNX_Q8TE04.
OpenTargetsiENSG00000152782.
PharmGKBiPA32928.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2201. Eukaryota.
COG5146. LUCA.
GeneTreeiENSGT00390000020719.
HOGENOMiHOG000194690.
HOVERGENiHBG053495.
InParanoidiQ8TE04.
KOiK09680.
OMAiWGCAGIP.
OrthoDBiEOG091G0851.
PhylomeDBiQ8TE04.
TreeFamiTF314866.

Enzyme and pathway databases

UniPathwayiUPA00241; UER00352.
BioCyciMetaCyc:HS07852-MONOMER.
ZFISH:HS07852-MONOMER.
BRENDAi2.7.1.33. 2681.
ReactomeiR-HSA-196783. Coenzyme A biosynthesis.

Miscellaneous databases

ChiTaRSiPANK1. human.
EvolutionaryTraceiQ8TE04.
GeneWikiiPANK1.
GenomeRNAii53354.
PROiQ8TE04.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000152782.
CleanExiHS_PANK1.
GenevisibleiQ8TE04. HS.

Family and domain databases

InterProiIPR004567. Type_II_PanK.
[Graphical view]
PfamiPF03630. Fumble. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00555. panK_eukar. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiPANK1_HUMAN
AccessioniPrimary (citable) accession number: Q8TE04
Secondary accession number(s): A6NIP0
, Q7RTX6, Q7Z495, Q8TBQ8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: January 17, 2003
Last modified: November 2, 2016
This is version 137 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.