Q8TE04 (PANK1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 92.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Pantothenate kinase 1 Short name=hPanK Short name=hPanK1 EC=2.7.1.33 Alternative name(s): Pantothenic acid kinase 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 598 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role in the physiological regulation of the intracellular CoA concentration By similarity. |
| Catalytic activity | ATP + (R)-pantothenate = ADP + (R)-4'-phosphopantothenate. |
| Enzyme regulation | Regulated by feedback inhibition by CoA and its thioesters. Strongly inhibited by acetyl-CoA and by manyl-CoA and also inhibited by high concentration of non-esterified CoA (CoASH) By similarity. |
| Pathway | Cofactor biosynthesis; coenzyme A biosynthesis; CoA from (R)-pantothenate: step 1/5. |
| Subcellular location | |
| Tissue specificity | Isoform 1 is expressed at high levels in brain, heart, kidney, liver, skeletal muscle and testis. Isoform 2 is detected at much lower levels in kidney, liver, brain and testis and is not detected in heart or skeletal muscle. Ref.2 |
| Induction | Isoform 1 is induced by bezafibrate, a hypolipidemic drug which acts as an agonist of peroxisome proliferator activator receptor alpha (PPARA), while isoform 2 levels decrease slightly. Ref.2 |
| Domain | The N-terminal extension, present in isoform 1 may be the regulatory domain. |
| Sequence similarities | Belongs to the type II pantothenate kinase family. |
| Sequence caution | The sequence AAH26296.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Coenzyme A biosynthesis |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Transferase |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | coenzyme A biosynthetic process Inferred from electronic annotation. Source: UniProtKB-KW pantothenate metabolic processTraceable author statement. Source: Reactome |
| Cellular component | cytosol Traceable author statement. Source: Reactome nucleusInferred from direct assay. Source: HPA |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW pantothenate kinase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8TE04-1) Also known as: PanK1-alpha; PANK1a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8TE04-2) Also known as: PANK1a; PanK1-beta; The sequence of this isoform differs from the canonical sequence as follows: 1-235: MLKLVGGGGG...MDSGRKNRPP → MKLINGKKQT | ||||||
| Isoform 3 (identifier: Q8TE04-3) Also known as: PANK1b; The sequence of this isoform differs from the canonical sequence as follows: 1-235: MLKLVGGGGG...MDSGRKNRPP → MKLINGKKQT 438-496: Missing. | ||||||
| Isoform 4 (identifier: Q8TE04-4) Also known as: PanK1-gamma; The sequence of this isoform differs from the canonical sequence as follows: 1-198: Missing. 199-235: PLLPELQPQPLLPQHDSPAKKCRLRRRMDSGRKNRPP → MAKSKHALLPFCHGMMQQEGLHQMQSLDLGLLSLQNS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 598 | 598 | Pantothenate kinase 1 | PRO_0000161802 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 235 | 235 | MLKLV…KNRPP → MKLINGKKQT in isoform 2 and isoform 3. | VSP_004520 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 198 | 198 | Missing in isoform 4. | VSP_012823 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 199 – 235 | 37 | PLLPE…KNRPP → MAKSKHALLPFCHGMMQQEG LHQMQSLDLGLLSLQNS in isoform 4. | VSP_012824 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 438 – 496 | 59 | Missing in isoform 3. | VSP_004521 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 306 | 1 | N → D in AAL86371. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 238 – 243 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 245 – 255 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 273 – 279 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 284 – 286 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 291 – 293 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 295 – 299 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 304 – 313 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 314 – 316 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 317 – 323 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 338 – 340 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 341 – 344 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 345 – 347 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 363 – 377 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 384 – 390 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 394 – 396 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 398 – 402 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 409 – 426 | 18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 429 – 437 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 440 – 451 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 456 – 465 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 468 – 470 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 472 – 474 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 475 – 479 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 484 – 486 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 492 – 495 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 496 – 501 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 503 – 506 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 511 – 537 | 27 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 542 – 546 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 547 – 549 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 551 – 553 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 554 – 566 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 567 – 569 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 573 – 576 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 577 – 580 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 582 – 591 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of a novel human pantothenate kinase gene." Ni X., Ma Y., Cheng H., Jiang M., Ying K., Xie Y., Mao Y. Int. J. Biochem. Cell Biol. 34:109-115(2002) [PubMed: 11809413] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). Tissue: Fetal brain. |
| [2] | "PPARalpha controls the intracellular coenzyme A concentration via regulation of PANK1alpha gene expression." Ramaswamy G., Karim M.A., Murti K.G., Jackowski S. J. Lipid Res. 45:17-31(2004) [PubMed: 14523052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 4), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INDUCTION. |
| [3] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 460-598 (ISOFORM 2). Tissue: Skeletal muscle. |
| [6] | "A novel pantothenate kinase gene (PANK2) is defective in Hallervorden-Spatz syndrome." Zhou B., Westaway S.K., Levinson B., Johnson M.A., Gitschier J., Hayflick S.J. Nat. Genet. 28:345-349(2001) [PubMed: 11479594] [Abstract] Cited for: IDENTIFICATION (ISOFORM 2). |
| [7] | Zhou B., Westaway S.K., Levinson B., Johnson M.A., Gitschier J., Hayflick S.J. Unpublished observations (JUL-2001) Cited for: IDENTIFICATION (ISOFORM 1). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF355198 mRNA. Translation: AAL86371.1. AL157400 Genomic DNA. Translation: CAI16826.1. AL157400 Genomic DNA. Translation: CAI16827.1. AY027661 mRNA. Translation: AAK20916.1. AY027662 mRNA. Translation: AAK20917.1. AY027663 mRNA. Translation: AAK20918.1. CH471066 Genomic DNA. Translation: EAW50131.1. BC026296 mRNA. Translation: AAH26296.1. Different initiation. BK000008 mRNA. Translation: DAA00002.1. BK000009 mRNA. Translation: DAA00003.1. | ||||||||||||||||||
| IPI | IPI00152578. IPI00170950. IPI00220147. IPI00553196. | ||||||||||||||||||
| RefSeq | NP_612189.2. NM_138316.3. NP_683878.1. NM_148977.2. NP_683879.1. NM_148978.2. | ||||||||||||||||||
| UniGene | Hs.376351. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q8TE04. | ||||||||||||||||||
| SMR | Q8TE04. Positions 232-594. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| MINT | MINT-3319085. | ||||||||||||||||||
| STRING | Q8TE04. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q8TE04. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 27805665. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | Q8TE04. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000307534; ENSP00000302108; ENSG00000152782. | ||||||||||||||||||
| GeneID | 53354. | ||||||||||||||||||
| KEGG | hsa:53354. | ||||||||||||||||||
| NMPDR | fig|9606.3.peg.4324. | ||||||||||||||||||
| UCSC | uc001kgn.1. human. uc001kgo.1. human. uc001kgp.1. human. uc009xtu.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 53354. | ||||||||||||||||||
| GeneCards | GC10M091332. | ||||||||||||||||||
| H-InvDB | HIX0009024. | ||||||||||||||||||
| HGNC | HGNC:8598. PANK1. | ||||||||||||||||||
| HPA | HPA021795. | ||||||||||||||||||
| MIM | 606160. gene. | ||||||||||||||||||
| neXtProt | NX_Q8TE04. | ||||||||||||||||||
| PharmGKB | PA32928. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | prNOG16781. | ||||||||||||||||||
| GeneTree | ENSGT00390000020719. | ||||||||||||||||||
| HOGENOM | HBG736409. | ||||||||||||||||||
| HOVERGEN | HBG053495. | ||||||||||||||||||
| InParanoid | Q8TE04. | ||||||||||||||||||
| OMA | GFHPPPV. | ||||||||||||||||||
| OrthoDB | EOG49P9ZQ. | ||||||||||||||||||
| PhylomeDB | Q8TE04. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_111217. Metabolism. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q8TE04. | ||||||||||||||||||
| Bgee | Q8TE04. | ||||||||||||||||||
| CleanEx | HS_PANK1. | ||||||||||||||||||
| Genevestigator | Q8TE04. | ||||||||||||||||||
| GermOnline | ENSG00000152782. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR004567. Type_II_PanK. [Graphical view] | ||||||||||||||||||
| KO | K09680. | ||||||||||||||||||
| Pfam | PF03630. Fumble. 1 hit. [Graphical view] | ||||||||||||||||||
| TIGRFAMs | TIGR00555. PanK_eukar. 1 hit. | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| DrugBank | DB01393. Bezafibrate. | ||||||||||||||||||
| NextBio | 56014. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | PANK1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8TE04 Secondary accession number(s): A6NIP0 Q8TBQ8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with