Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8TE04 (PANK1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 115. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Pantothenate kinase 1

Short name=hPanK
Short name=hPanK1
EC=2.7.1.33
Alternative name(s):
Pantothenic acid kinase 1
Gene names
Name:PANK1
Synonyms:PANK
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length598 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Plays a role in the physiological regulation of the intracellular CoA concentration By similarity.

Catalytic activity

ATP + (R)-pantothenate = ADP + (R)-4'-phosphopantothenate.

Enzyme regulation

Regulated by feedback inhibition by CoA and its thioesters. Strongly inhibited by acetyl-CoA and by manyl-CoA and also inhibited by high concentration of non-esterified CoA (CoASH) By similarity. Ref.9

Pathway

Cofactor biosynthesis; coenzyme A biosynthesis; CoA from (R)-pantothenate: step 1/5.

Subunit structure

Homodimer. Ref.9

Subcellular location

Cytoplasm Ref.2.

Tissue specificity

Isoform 1 is expressed at high levels in brain, heart, kidney, liver, skeletal muscle and testis. Isoform 2 is detected at much lower levels in kidney, liver, brain and testis and is not detected in heart or skeletal muscle. Ref.2

Induction

Isoform 1 is induced by bezafibrate, a hypolipidemic drug which acts as an agonist of peroxisome proliferator activator receptor alpha (PPARA), while isoform 2 levels decrease slightly. Ref.2 Ref.9

Domain

The N-terminal extension, present in isoform 1 may be the regulatory domain.

Sequence similarities

Belongs to the type II pantothenate kinase family.

Sequence caution

The sequence AAH26296.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8TE04-1)

Also known as: PanK1-alpha; PANK1a;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8TE04-2)

Also known as: PANK1a; PanK1-beta;

The sequence of this isoform differs from the canonical sequence as follows:
     1-235: MLKLVGGGGG...MDSGRKNRPP → MKLINGKKQT
Isoform 3 (identifier: Q8TE04-3)

Also known as: PANK1b;

The sequence of this isoform differs from the canonical sequence as follows:
     1-235: MLKLVGGGGG...MDSGRKNRPP → MKLINGKKQT
     438-496: Missing.
Isoform 4 (identifier: Q8TE04-4)

Also known as: PanK1-gamma;

The sequence of this isoform differs from the canonical sequence as follows:
     1-198: Missing.
     199-235: PLLPELQPQPLLPQHDSPAKKCRLRRRMDSGRKNRPP → MAKSKHALLPFCHGMMQQEGLHQMQSLDLGLLSLQNS

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 598598Pantothenate kinase 1
PRO_0000161802

Sites

Binding site4171Acetyl-CoA
Binding site4201Acetyl-CoA
Binding site4321Acetyl-CoA

Amino acid modifications

Modified residue2151Phosphoserine Ref.8

Natural variations

Alternative sequence1 – 235235MLKLV…KNRPP → MKLINGKKQT in isoform 2 and isoform 3.
VSP_004520
Alternative sequence1 – 198198Missing in isoform 4.
VSP_012823
Alternative sequence199 – 23537PLLPE…KNRPP → MAKSKHALLPFCHGMMQQEG LHQMQSLDLGLLSLQNS in isoform 4.
VSP_012824
Alternative sequence438 – 49659Missing in isoform 3.
VSP_004521

Experimental info

Sequence conflict3061N → D in AAL86371. Ref.1

Secondary structure

....................................................................... 598
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (PanK1-alpha) (PANK1a) [UniParc].

Last modified January 17, 2003. Version 2.
Checksum: 0A92115D5BEDFC4C

FASTA59864,339
        10         20         30         40         50         60 
MLKLVGGGGG QDWACSVAGT SLGGEEAAFE VARPGDQGKA GGGSPGWGCA GIPDSAPGAG 

        70         80         90        100        110        120 
VLQAGAVGPA RGGQGAEEVG ESAGGGEERR VRHPQAPALR LLNRKPQGGS GEIKTPENDL 

       130        140        150        160        170        180 
QRGRLSRGPR TAPPAPGMGD RSGQQERSVP HSPGAPVGTS AAAVNGLLHN GFHPPPVQPP 

       190        200        210        220        230        240 
HVCSRGPVGG SDAAPQRLPL LPELQPQPLL PQHDSPAKKC RLRRRMDSGR KNRPPFPWFG 

       250        260        270        280        290        300 
MDIGGTLVKL VYFEPKDITA EEEQEEVENL KSIRKYLTSN TAYGKTGIRD VHLELKNLTM 

       310        320        330        340        350        360 
CGRKGNLHFI RFPSCAMHRF IQMGSEKNFS SLHTTLCATG GGAFKFEEDF RMIADLQLHK 

       370        380        390        400        410        420 
LDELDCLIQG LLYVDSVGFN GKPECYYFEN PTNPELCQKK PYCLDNPYPM LLVNMGSGVS 

       430        440        450        460        470        480 
ILAVYSKDNY KRVTGTSLGG GTFLGLCCLL TGCETFEEAL EMAAKGDSTN VDKLVKDIYG 

       490        500        510        520        530        540 
GDYERFGLQG SAVASSFGNM MSKEKRDSIS KEDLARATLV TITNNIGSIA RMCALNENID 

       550        560        570        580        590 
RVVFVGNFLR INMVSMKLLA YAMDFWSKGQ LKALFLEHEG YFGAVGALLE LFKMTDDK 

« Hide

Isoform 2 (PANK1a) (PanK1-beta) [UniParc].

Checksum: 6F7D73D40E15F0F5
Show »

FASTA37341,671
Isoform 3 (PANK1b) [UniParc].

Checksum: 56D24B548DE056DE
Show »

FASTA31435,579
Isoform 4 (PanK1-gamma) [UniParc].

Checksum: 9BA80EA526F43832
Show »

FASTA40044,634

References

« Hide 'large scale' references
[1]"Cloning and characterization of a novel human pantothenate kinase gene."
Ni X., Ma Y., Cheng H., Jiang M., Ying K., Xie Y., Mao Y.
Int. J. Biochem. Cell Biol. 34:109-115(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
Tissue: Fetal brain.
[2]"PPARalpha controls the intracellular coenzyme A concentration via regulation of PANK1alpha gene expression."
Ramaswamy G., Karim M.A., Murti K.G., Jackowski S.
J. Lipid Res. 45:17-31(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 4), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INDUCTION.
[3]"The DNA sequence and comparative analysis of human chromosome 10."
Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. expand/collapse author list , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 460-598 (ISOFORM 2).
Tissue: Skeletal muscle.
[6]"A novel pantothenate kinase gene (PANK2) is defective in Hallervorden-Spatz syndrome."
Zhou B., Westaway S.K., Levinson B., Johnson M.A., Gitschier J., Hayflick S.J.
Nat. Genet. 28:345-349(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION (ISOFORM 2).
[7]Zhou B., Westaway S.K., Levinson B., Johnson M.A., Gitschier J., Hayflick S.J.
Unpublished observations (JUL-2001)
Cited for: IDENTIFICATION (ISOFORM 1).
[8]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-215, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[9]"Crystal structures of human pantothenate kinases. Insights into allosteric regulation and mutations linked to a neurodegeneration disorder."
Hong B.S., Senisterra G., Rabeh W.M., Vedadi M., Leonardi R., Zhang Y.M., Rock C.O., Jackowski S., Park H.W.
J. Biol. Chem. 282:27984-27993(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 234-593 IN COMPLEX WITH ACETYL-COA, SUBUNIT, ENZYME REGULATION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF355198 mRNA. Translation: AAL86371.1.
AL157400 Genomic DNA. Translation: CAI16826.1.
AL157400 Genomic DNA. Translation: CAI16827.1.
AY027661 mRNA. Translation: AAK20916.1.
AY027662 mRNA. Translation: AAK20917.1.
AY027663 mRNA. Translation: AAK20918.1.
CH471066 Genomic DNA. Translation: EAW50131.1.
BC026296 mRNA. Translation: AAH26296.1. Different initiation.
BK000008 mRNA. Translation: DAA00002.1.
BK000009 mRNA. Translation: DAA00003.1.
RefSeqNP_612189.2. NM_138316.3.
NP_683878.1. NM_148977.2.
NP_683879.1. NM_148978.2.
UniGeneHs.163555.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2I7NX-ray1.90A/B234-593[»]
3SMPX-ray1.90A/B231-597[»]
ProteinModelPortalQ8TE04.
SMRQ8TE04. Positions 232-594.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119751. 2 interactions.
IntActQ8TE04. 1 interaction.
MINTMINT-3319085.
STRING9606.ENSP00000302108.

Chemistry

DrugBankDB01393. Bezafibrate.

PTM databases

PhosphoSiteQ8TE04.

Polymorphism databases

DMDM27805665.

Proteomic databases

PaxDbQ8TE04.
PRIDEQ8TE04.

Protocols and materials databases

DNASU53354.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000307534; ENSP00000302108; ENSG00000152782. [Q8TE04-1]
ENST00000322191; ENSP00000318526; ENSG00000152782. [Q8TE04-3]
ENST00000342512; ENSP00000345118; ENSG00000152782. [Q8TE04-2]
ENST00000371774; ENSP00000360839; ENSG00000152782. [Q8TE04-4]
GeneID53354.
KEGGhsa:53354.
UCSCuc001kgn.2. human. [Q8TE04-2]
uc001kgo.2. human. [Q8TE04-3]
uc001kgp.2. human. [Q8TE04-1]
uc009xtu.2. human. [Q8TE04-4]

Organism-specific databases

CTD53354.
GeneCardsGC10M091332.
H-InvDBHIX0009024.
HGNCHGNC:8598. PANK1.
HPAHPA021795.
MIM606160. gene.
neXtProtNX_Q8TE04.
PharmGKBPA32928.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5146.
HOGENOMHOG000194690.
HOVERGENHBG053495.
InParanoidQ8TE04.
KOK09680.
OMACSRGPVG.
OrthoDBEOG7R2BJR.
PhylomeDBQ8TE04.
TreeFamTF314866.

Enzyme and pathway databases

ReactomeREACT_111217. Metabolism.
REACT_116125. Disease.
UniPathwayUPA00241; UER00352.

Gene expression databases

BgeeQ8TE04.
CleanExHS_PANK1.
GenevestigatorQ8TE04.

Family and domain databases

InterProIPR004567. Type_II_PanK.
[Graphical view]
PfamPF03630. Fumble. 1 hit.
[Graphical view]
TIGRFAMsTIGR00555. panK_eukar. 1 hit.
ProtoNetSearch...

Other

ChiTaRSPANK1. human.
EvolutionaryTraceQ8TE04.
GeneWikiPANK1.
GenomeRNAi53354.
NextBio56014.
PROQ8TE04.
SOURCESearch...

Entry information

Entry namePANK1_HUMAN
AccessionPrimary (citable) accession number: Q8TE04
Secondary accession number(s): A6NIP0 expand/collapse secondary AC list , Q7RTX6, Q7Z495, Q8TBQ8
Entry history
Integrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: January 17, 2003
Last modified: April 16, 2014
This is version 115 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

PATHWAY comments

Index of metabolic and biosynthesis pathways

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 10

Human chromosome 10: entries, gene names and cross-references to MIM