SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8TE04

- PANK1_HUMAN

UniProt

Q8TE04 - PANK1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Pantothenate kinase 1

Gene
PANK1, PANK
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Plays a role in the physiological regulation of the intracellular CoA concentration By similarity.

Catalytic activityi

ATP + (R)-pantothenate = ADP + (R)-4'-phosphopantothenate.

Enzyme regulationi

Regulated by feedback inhibition by CoA and its thioesters. Strongly inhibited by acetyl-CoA and by manyl-CoA and also inhibited by high concentration of non-esterified CoA (CoASH) By similarity.1 Publication

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei417 – 4171Acetyl-CoA
Binding sitei420 – 4201Acetyl-CoA
Binding sitei432 – 4321Acetyl-CoA

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. pantothenate kinase activity Source: UniProtKB-EC

GO - Biological processi

  1. coenzyme A biosynthetic process Source: UniProtKB-UniPathway
  2. coenzyme biosynthetic process Source: Reactome
  3. pantothenate metabolic process Source: Reactome
  4. small molecule metabolic process Source: Reactome
  5. vitamin metabolic process Source: Reactome
  6. water-soluble vitamin metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Keywords - Biological processi

Coenzyme A biosynthesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_11218. Coenzyme A biosynthesis.
UniPathwayiUPA00241; UER00352.

Names & Taxonomyi

Protein namesi
Recommended name:
Pantothenate kinase 1 (EC:2.7.1.33)
Short name:
hPanK
Short name:
hPanK1
Alternative name(s):
Pantothenic acid kinase 1
Gene namesi
Name:PANK1
Synonyms:PANK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:8598. PANK1.

Subcellular locationi

Cytoplasm 1 Publication

GO - Cellular componenti

  1. cell periphery Source: Ensembl
  2. clathrin coat Source: Ensembl
  3. cytosol Source: Reactome
  4. nucleus Source: Ensembl
  5. recycling endosome Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA32928.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 598598Pantothenate kinase 1PRO_0000161802Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei215 – 2151Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8TE04.
PaxDbiQ8TE04.
PRIDEiQ8TE04.

PTM databases

PhosphoSiteiQ8TE04.

Expressioni

Tissue specificityi

Isoform 1 is expressed at high levels in brain, heart, kidney, liver, skeletal muscle and testis. Isoform 2 is detected at much lower levels in kidney, liver, brain and testis and is not detected in heart or skeletal muscle.1 Publication

Inductioni

Isoform 1 is induced by bezafibrate, a hypolipidemic drug which acts as an agonist of peroxisome proliferator activator receptor alpha (PPARA), while isoform 2 levels decrease slightly.2 Publications

Gene expression databases

BgeeiQ8TE04.
CleanExiHS_PANK1.
GenevestigatoriQ8TE04.

Organism-specific databases

HPAiHPA021795.

Interactioni

Subunit structurei

Homodimer.1 Publication

Protein-protein interaction databases

BioGridi119751. 2 interactions.
IntActiQ8TE04. 1 interaction.
MINTiMINT-3319085.
STRINGi9606.ENSP00000302108.

Structurei

Secondary structure

1
598
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi238 – 2436
Beta strandi245 – 25511
Helixi260 – 2656
Helixi273 – 2797
Beta strandi281 – 2833
Beta strandi284 – 2863
Beta strandi287 – 2893
Helixi291 – 2933
Beta strandi295 – 2995
Beta strandi304 – 31310
Helixi314 – 3163
Helixi317 – 3237
Helixi329 – 3313
Beta strandi338 – 3403
Turni341 – 3444
Helixi345 – 3473
Beta strandi357 – 3604
Helixi363 – 37715
Beta strandi384 – 3907
Turni394 – 3963
Beta strandi398 – 4025
Beta strandi409 – 42618
Beta strandi429 – 4379
Helixi440 – 45112
Helixi456 – 46510
Helixi468 – 4703
Beta strandi472 – 4743
Helixi475 – 4795
Helixi484 – 4863
Beta strandi492 – 4954
Turni496 – 5016
Helixi503 – 5064
Helixi511 – 53727
Beta strandi542 – 5465
Helixi547 – 5493
Beta strandi551 – 5533
Helixi554 – 56613
Turni567 – 5693
Beta strandi573 – 5764
Turni577 – 5804
Helixi582 – 59110

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2I7NX-ray1.90A/B234-593[»]
3SMPX-ray1.90A/B231-597[»]
ProteinModelPortaliQ8TE04.
SMRiQ8TE04. Positions 232-594.

Miscellaneous databases

EvolutionaryTraceiQ8TE04.

Family & Domainsi

Domaini

The N-terminal extension, present in isoform 1 may be the regulatory domain.

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG5146.
HOGENOMiHOG000194690.
HOVERGENiHBG053495.
InParanoidiQ8TE04.
KOiK09680.
OMAiCSRGPVG.
OrthoDBiEOG7R2BJR.
PhylomeDBiQ8TE04.
TreeFamiTF314866.

Family and domain databases

InterProiIPR004567. Type_II_PanK.
[Graphical view]
PfamiPF03630. Fumble. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00555. panK_eukar. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8TE04-1) [UniParc]FASTAAdd to Basket

Also known as: PanK1-alpha, PANK1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLKLVGGGGG QDWACSVAGT SLGGEEAAFE VARPGDQGKA GGGSPGWGCA    50
GIPDSAPGAG VLQAGAVGPA RGGQGAEEVG ESAGGGEERR VRHPQAPALR 100
LLNRKPQGGS GEIKTPENDL QRGRLSRGPR TAPPAPGMGD RSGQQERSVP 150
HSPGAPVGTS AAAVNGLLHN GFHPPPVQPP HVCSRGPVGG SDAAPQRLPL 200
LPELQPQPLL PQHDSPAKKC RLRRRMDSGR KNRPPFPWFG MDIGGTLVKL 250
VYFEPKDITA EEEQEEVENL KSIRKYLTSN TAYGKTGIRD VHLELKNLTM 300
CGRKGNLHFI RFPSCAMHRF IQMGSEKNFS SLHTTLCATG GGAFKFEEDF 350
RMIADLQLHK LDELDCLIQG LLYVDSVGFN GKPECYYFEN PTNPELCQKK 400
PYCLDNPYPM LLVNMGSGVS ILAVYSKDNY KRVTGTSLGG GTFLGLCCLL 450
TGCETFEEAL EMAAKGDSTN VDKLVKDIYG GDYERFGLQG SAVASSFGNM 500
MSKEKRDSIS KEDLARATLV TITNNIGSIA RMCALNENID RVVFVGNFLR 550
INMVSMKLLA YAMDFWSKGQ LKALFLEHEG YFGAVGALLE LFKMTDDK 598
Length:598
Mass (Da):64,339
Last modified:January 17, 2003 - v2
Checksum:i0A92115D5BEDFC4C
GO
Isoform 2 (identifier: Q8TE04-2) [UniParc]FASTAAdd to Basket

Also known as: PANK1a, PanK1-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-235: MLKLVGGGGG...MDSGRKNRPP → MKLINGKKQT

Show »
Length:373
Mass (Da):41,671
Checksum:i6F7D73D40E15F0F5
GO
Isoform 3 (identifier: Q8TE04-3) [UniParc]FASTAAdd to Basket

Also known as: PANK1b

The sequence of this isoform differs from the canonical sequence as follows:
     1-235: MLKLVGGGGG...MDSGRKNRPP → MKLINGKKQT
     438-496: Missing.

Show »
Length:314
Mass (Da):35,579
Checksum:i56D24B548DE056DE
GO
Isoform 4 (identifier: Q8TE04-4) [UniParc]FASTAAdd to Basket

Also known as: PanK1-gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-198: Missing.
     199-235: PLLPELQPQPLLPQHDSPAKKCRLRRRMDSGRKNRPP → MAKSKHALLPFCHGMMQQEGLHQMQSLDLGLLSLQNS

Show »
Length:400
Mass (Da):44,634
Checksum:i9BA80EA526F43832
GO

Sequence cautioni

The sequence AAH26296.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 235235MLKLV…KNRPP → MKLINGKKQT in isoform 2 and isoform 3. VSP_004520Add
BLAST
Alternative sequencei1 – 198198Missing in isoform 4. VSP_012823Add
BLAST
Alternative sequencei199 – 23537PLLPE…KNRPP → MAKSKHALLPFCHGMMQQEG LHQMQSLDLGLLSLQNS in isoform 4. VSP_012824Add
BLAST
Alternative sequencei438 – 49659Missing in isoform 3. VSP_004521Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti306 – 3061N → D in AAL86371. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF355198 mRNA. Translation: AAL86371.1.
AL157400 Genomic DNA. Translation: CAI16826.1.
AL157400 Genomic DNA. Translation: CAI16827.1.
AY027661 mRNA. Translation: AAK20916.1.
AY027662 mRNA. Translation: AAK20917.1.
AY027663 mRNA. Translation: AAK20918.1.
CH471066 Genomic DNA. Translation: EAW50131.1.
BC026296 mRNA. Translation: AAH26296.1. Different initiation.
BK000008 mRNA. Translation: DAA00002.1.
BK000009 mRNA. Translation: DAA00003.1.
CCDSiCCDS31244.1. [Q8TE04-1]
CCDS7405.1. [Q8TE04-3]
CCDS7406.1. [Q8TE04-2]
RefSeqiNP_612189.2. NM_138316.3. [Q8TE04-3]
NP_683878.1. NM_148977.2. [Q8TE04-1]
NP_683879.1. NM_148978.2. [Q8TE04-2]
UniGeneiHs.163555.

Genome annotation databases

EnsembliENST00000307534; ENSP00000302108; ENSG00000152782. [Q8TE04-1]
ENST00000322191; ENSP00000318526; ENSG00000152782. [Q8TE04-3]
ENST00000342512; ENSP00000345118; ENSG00000152782. [Q8TE04-2]
ENST00000371774; ENSP00000360839; ENSG00000152782. [Q8TE04-4]
GeneIDi53354.
KEGGihsa:53354.
UCSCiuc001kgn.2. human. [Q8TE04-2]
uc001kgo.2. human. [Q8TE04-3]
uc001kgp.2. human. [Q8TE04-1]
uc009xtu.2. human. [Q8TE04-4]

Polymorphism databases

DMDMi27805665.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF355198 mRNA. Translation: AAL86371.1 .
AL157400 Genomic DNA. Translation: CAI16826.1 .
AL157400 Genomic DNA. Translation: CAI16827.1 .
AY027661 mRNA. Translation: AAK20916.1 .
AY027662 mRNA. Translation: AAK20917.1 .
AY027663 mRNA. Translation: AAK20918.1 .
CH471066 Genomic DNA. Translation: EAW50131.1 .
BC026296 mRNA. Translation: AAH26296.1 . Different initiation.
BK000008 mRNA. Translation: DAA00002.1 .
BK000009 mRNA. Translation: DAA00003.1 .
CCDSi CCDS31244.1. [Q8TE04-1 ]
CCDS7405.1. [Q8TE04-3 ]
CCDS7406.1. [Q8TE04-2 ]
RefSeqi NP_612189.2. NM_138316.3. [Q8TE04-3 ]
NP_683878.1. NM_148977.2. [Q8TE04-1 ]
NP_683879.1. NM_148978.2. [Q8TE04-2 ]
UniGenei Hs.163555.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2I7N X-ray 1.90 A/B 234-593 [» ]
3SMP X-ray 1.90 A/B 231-597 [» ]
ProteinModelPortali Q8TE04.
SMRi Q8TE04. Positions 232-594.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119751. 2 interactions.
IntActi Q8TE04. 1 interaction.
MINTi MINT-3319085.
STRINGi 9606.ENSP00000302108.

Chemistry

DrugBanki DB01393. Bezafibrate.

PTM databases

PhosphoSitei Q8TE04.

Polymorphism databases

DMDMi 27805665.

Proteomic databases

MaxQBi Q8TE04.
PaxDbi Q8TE04.
PRIDEi Q8TE04.

Protocols and materials databases

DNASUi 53354.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000307534 ; ENSP00000302108 ; ENSG00000152782 . [Q8TE04-1 ]
ENST00000322191 ; ENSP00000318526 ; ENSG00000152782 . [Q8TE04-3 ]
ENST00000342512 ; ENSP00000345118 ; ENSG00000152782 . [Q8TE04-2 ]
ENST00000371774 ; ENSP00000360839 ; ENSG00000152782 . [Q8TE04-4 ]
GeneIDi 53354.
KEGGi hsa:53354.
UCSCi uc001kgn.2. human. [Q8TE04-2 ]
uc001kgo.2. human. [Q8TE04-3 ]
uc001kgp.2. human. [Q8TE04-1 ]
uc009xtu.2. human. [Q8TE04-4 ]

Organism-specific databases

CTDi 53354.
GeneCardsi GC10M091332.
H-InvDB HIX0009024.
HGNCi HGNC:8598. PANK1.
HPAi HPA021795.
MIMi 606160. gene.
neXtProti NX_Q8TE04.
PharmGKBi PA32928.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5146.
HOGENOMi HOG000194690.
HOVERGENi HBG053495.
InParanoidi Q8TE04.
KOi K09680.
OMAi CSRGPVG.
OrthoDBi EOG7R2BJR.
PhylomeDBi Q8TE04.
TreeFami TF314866.

Enzyme and pathway databases

UniPathwayi UPA00241 ; UER00352 .
Reactomei REACT_11218. Coenzyme A biosynthesis.

Miscellaneous databases

ChiTaRSi PANK1. human.
EvolutionaryTracei Q8TE04.
GeneWikii PANK1.
GenomeRNAii 53354.
NextBioi 56014.
PROi Q8TE04.
SOURCEi Search...

Gene expression databases

Bgeei Q8TE04.
CleanExi HS_PANK1.
Genevestigatori Q8TE04.

Family and domain databases

InterProi IPR004567. Type_II_PanK.
[Graphical view ]
Pfami PF03630. Fumble. 1 hit.
[Graphical view ]
TIGRFAMsi TIGR00555. panK_eukar. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of a novel human pantothenate kinase gene."
    Ni X., Ma Y., Cheng H., Jiang M., Ying K., Xie Y., Mao Y.
    Int. J. Biochem. Cell Biol. 34:109-115(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    Tissue: Fetal brain.
  2. "PPARalpha controls the intracellular coenzyme A concentration via regulation of PANK1alpha gene expression."
    Ramaswamy G., Karim M.A., Murti K.G., Jackowski S.
    J. Lipid Res. 45:17-31(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 4), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INDUCTION.
  3. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 460-598 (ISOFORM 2).
    Tissue: Skeletal muscle.
  6. "A novel pantothenate kinase gene (PANK2) is defective in Hallervorden-Spatz syndrome."
    Zhou B., Westaway S.K., Levinson B., Johnson M.A., Gitschier J., Hayflick S.J.
    Nat. Genet. 28:345-349(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION (ISOFORM 2).
  7. Cited for: IDENTIFICATION (ISOFORM 1).
  8. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-215, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  9. "Crystal structures of human pantothenate kinases. Insights into allosteric regulation and mutations linked to a neurodegeneration disorder."
    Hong B.S., Senisterra G., Rabeh W.M., Vedadi M., Leonardi R., Zhang Y.M., Rock C.O., Jackowski S., Park H.W.
    J. Biol. Chem. 282:27984-27993(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 234-593 IN COMPLEX WITH ACETYL-COA, SUBUNIT, ENZYME REGULATION.

Entry informationi

Entry nameiPANK1_HUMAN
AccessioniPrimary (citable) accession number: Q8TE04
Secondary accession number(s): A6NIP0
, Q7RTX6, Q7Z495, Q8TBQ8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: January 17, 2003
Last modified: September 3, 2014
This is version 118 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi