Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pantothenate kinase 1

Gene

PANK1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in the physiological regulation of the intracellular CoA concentration.By similarity

Catalytic activityi

ATP + (R)-pantothenate = ADP + (R)-4'-phosphopantothenate.

Enzyme regulationi

Regulated by feedback inhibition by CoA and its thioesters. Strongly inhibited by acetyl-CoA and by manyl-CoA and also inhibited by high concentration of non-esterified CoA (CoASH) (By similarity).By similarity

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei417 – 4171Acetyl-CoA1 Publication
Binding sitei420 – 4201Acetyl-CoA1 Publication
Binding sitei432 – 4321Acetyl-CoA1 Publication

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. pantothenate kinase activity Source: UniProtKB-EC

GO - Biological processi

  1. coenzyme A biosynthetic process Source: UniProtKB-UniPathway
  2. coenzyme biosynthetic process Source: Reactome
  3. pantothenate metabolic process Source: Reactome
  4. small molecule metabolic process Source: Reactome
  5. vitamin metabolic process Source: Reactome
  6. water-soluble vitamin metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Keywords - Biological processi

Coenzyme A biosynthesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_11218. Coenzyme A biosynthesis.
UniPathwayiUPA00241; UER00352.

Names & Taxonomyi

Protein namesi
Recommended name:
Pantothenate kinase 1 (EC:2.7.1.33)
Short name:
hPanK
Short name:
hPanK1
Alternative name(s):
Pantothenic acid kinase 1
Gene namesi
Name:PANK1
Synonyms:PANK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:8598. PANK1.

Subcellular locationi

Cytoplasm 1 Publication

GO - Cellular componenti

  1. cell periphery Source: Ensembl
  2. clathrin coat Source: Ensembl
  3. cytosol Source: Reactome
  4. nucleus Source: Ensembl
  5. recycling endosome Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA32928.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 598598Pantothenate kinase 1PRO_0000161802Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei215 – 2151Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8TE04.
PaxDbiQ8TE04.
PRIDEiQ8TE04.

PTM databases

PhosphoSiteiQ8TE04.

Expressioni

Tissue specificityi

Isoform 1 is expressed at high levels in brain, heart, kidney, liver, skeletal muscle and testis. Isoform 2 is detected at much lower levels in kidney, liver, brain and testis and is not detected in heart or skeletal muscle.1 Publication

Inductioni

Isoform 1 is induced by bezafibrate, a hypolipidemic drug which acts as an agonist of peroxisome proliferator activator receptor alpha (PPARA), while isoform 2 levels decrease slightly.1 Publication

Gene expression databases

BgeeiQ8TE04.
CleanExiHS_PANK1.
GenevestigatoriQ8TE04.

Organism-specific databases

HPAiHPA021795.

Interactioni

Subunit structurei

Homodimer.1 Publication

Protein-protein interaction databases

BioGridi119751. 2 interactions.
IntActiQ8TE04. 1 interaction.
MINTiMINT-3319085.
STRINGi9606.ENSP00000302108.

Structurei

Secondary structure

1
598
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi238 – 2436Combined sources
Beta strandi245 – 25511Combined sources
Helixi260 – 2656Combined sources
Helixi273 – 2797Combined sources
Beta strandi281 – 2833Combined sources
Beta strandi284 – 2863Combined sources
Beta strandi287 – 2893Combined sources
Helixi291 – 2933Combined sources
Beta strandi295 – 2995Combined sources
Beta strandi304 – 31310Combined sources
Helixi314 – 3163Combined sources
Helixi317 – 3237Combined sources
Helixi329 – 3313Combined sources
Beta strandi338 – 3403Combined sources
Turni341 – 3444Combined sources
Helixi345 – 3473Combined sources
Beta strandi357 – 3604Combined sources
Helixi363 – 37715Combined sources
Beta strandi384 – 3907Combined sources
Turni394 – 3963Combined sources
Beta strandi398 – 4025Combined sources
Beta strandi409 – 42618Combined sources
Beta strandi429 – 4379Combined sources
Helixi440 – 45112Combined sources
Helixi456 – 46510Combined sources
Helixi468 – 4703Combined sources
Beta strandi472 – 4743Combined sources
Helixi475 – 4795Combined sources
Helixi484 – 4863Combined sources
Beta strandi492 – 4954Combined sources
Turni496 – 5016Combined sources
Helixi503 – 5064Combined sources
Helixi511 – 53727Combined sources
Beta strandi542 – 5465Combined sources
Helixi547 – 5493Combined sources
Beta strandi551 – 5533Combined sources
Helixi554 – 56613Combined sources
Turni567 – 5693Combined sources
Beta strandi573 – 5764Combined sources
Turni577 – 5804Combined sources
Helixi582 – 59110Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2I7NX-ray1.90A/B234-593[»]
3SMPX-ray1.90A/B231-597[»]
ProteinModelPortaliQ8TE04.
SMRiQ8TE04. Positions 232-594.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8TE04.

Family & Domainsi

Domaini

The N-terminal extension, present in isoform 1 may be the regulatory domain.

Sequence similaritiesi

Belongs to the type II pantothenate kinase family.Curated

Phylogenomic databases

eggNOGiCOG5146.
GeneTreeiENSGT00390000020719.
HOGENOMiHOG000194690.
HOVERGENiHBG053495.
InParanoidiQ8TE04.
KOiK09680.
OMAiWGCAGIP.
OrthoDBiEOG7R2BJR.
PhylomeDBiQ8TE04.
TreeFamiTF314866.

Family and domain databases

InterProiIPR004567. Type_II_PanK.
[Graphical view]
PfamiPF03630. Fumble. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00555. panK_eukar. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8TE04-1) [UniParc]FASTAAdd to Basket

Also known as: PanK1-alpha, PANK1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLKLVGGGGG QDWACSVAGT SLGGEEAAFE VARPGDQGKA GGGSPGWGCA
60 70 80 90 100
GIPDSAPGAG VLQAGAVGPA RGGQGAEEVG ESAGGGEERR VRHPQAPALR
110 120 130 140 150
LLNRKPQGGS GEIKTPENDL QRGRLSRGPR TAPPAPGMGD RSGQQERSVP
160 170 180 190 200
HSPGAPVGTS AAAVNGLLHN GFHPPPVQPP HVCSRGPVGG SDAAPQRLPL
210 220 230 240 250
LPELQPQPLL PQHDSPAKKC RLRRRMDSGR KNRPPFPWFG MDIGGTLVKL
260 270 280 290 300
VYFEPKDITA EEEQEEVENL KSIRKYLTSN TAYGKTGIRD VHLELKNLTM
310 320 330 340 350
CGRKGNLHFI RFPSCAMHRF IQMGSEKNFS SLHTTLCATG GGAFKFEEDF
360 370 380 390 400
RMIADLQLHK LDELDCLIQG LLYVDSVGFN GKPECYYFEN PTNPELCQKK
410 420 430 440 450
PYCLDNPYPM LLVNMGSGVS ILAVYSKDNY KRVTGTSLGG GTFLGLCCLL
460 470 480 490 500
TGCETFEEAL EMAAKGDSTN VDKLVKDIYG GDYERFGLQG SAVASSFGNM
510 520 530 540 550
MSKEKRDSIS KEDLARATLV TITNNIGSIA RMCALNENID RVVFVGNFLR
560 570 580 590
INMVSMKLLA YAMDFWSKGQ LKALFLEHEG YFGAVGALLE LFKMTDDK
Length:598
Mass (Da):64,339
Last modified:January 17, 2003 - v2
Checksum:i0A92115D5BEDFC4C
GO
Isoform 2 (identifier: Q8TE04-2) [UniParc]FASTAAdd to Basket

Also known as: PANK1a, PanK1-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-235: MLKLVGGGGG...MDSGRKNRPP → MKLINGKKQT

Show »
Length:373
Mass (Da):41,671
Checksum:i6F7D73D40E15F0F5
GO
Isoform 3 (identifier: Q8TE04-3) [UniParc]FASTAAdd to Basket

Also known as: PANK1b

The sequence of this isoform differs from the canonical sequence as follows:
     1-235: MLKLVGGGGG...MDSGRKNRPP → MKLINGKKQT
     438-496: Missing.

Show »
Length:314
Mass (Da):35,579
Checksum:i56D24B548DE056DE
GO
Isoform 4 (identifier: Q8TE04-4) [UniParc]FASTAAdd to Basket

Also known as: PanK1-gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-198: Missing.
     199-235: PLLPELQPQPLLPQHDSPAKKCRLRRRMDSGRKNRPP → MAKSKHALLPFCHGMMQQEGLHQMQSLDLGLLSLQNS

Show »
Length:400
Mass (Da):44,634
Checksum:i9BA80EA526F43832
GO

Sequence cautioni

The sequence AAH26296.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti306 – 3061N → D in AAL86371. (PubMed:11809413)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 235235MLKLV…KNRPP → MKLINGKKQT in isoform 2 and isoform 3. 3 PublicationsVSP_004520Add
BLAST
Alternative sequencei1 – 198198Missing in isoform 4. 1 PublicationVSP_012823Add
BLAST
Alternative sequencei199 – 23537PLLPE…KNRPP → MAKSKHALLPFCHGMMQQEG LHQMQSLDLGLLSLQNS in isoform 4. 1 PublicationVSP_012824Add
BLAST
Alternative sequencei438 – 49659Missing in isoform 3. 1 PublicationVSP_004521Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF355198 mRNA. Translation: AAL86371.1.
AL157400 Genomic DNA. Translation: CAI16826.1.
AL157400 Genomic DNA. Translation: CAI16827.1.
AY027661 mRNA. Translation: AAK20916.1.
AY027662 mRNA. Translation: AAK20917.1.
AY027663 mRNA. Translation: AAK20918.1.
CH471066 Genomic DNA. Translation: EAW50131.1.
BC026296 mRNA. Translation: AAH26296.1. Different initiation.
BK000008 mRNA. Translation: DAA00002.1.
BK000009 mRNA. Translation: DAA00003.1.
CCDSiCCDS31244.1. [Q8TE04-1]
CCDS7405.1. [Q8TE04-3]
CCDS7406.1. [Q8TE04-2]
RefSeqiNP_612189.2. NM_138316.3. [Q8TE04-3]
NP_683878.1. NM_148977.2. [Q8TE04-1]
NP_683879.1. NM_148978.2. [Q8TE04-2]
UniGeneiHs.163555.

Genome annotation databases

EnsembliENST00000307534; ENSP00000302108; ENSG00000152782. [Q8TE04-1]
ENST00000322191; ENSP00000318526; ENSG00000152782. [Q8TE04-3]
ENST00000342512; ENSP00000345118; ENSG00000152782. [Q8TE04-2]
GeneIDi53354.
KEGGihsa:53354.
UCSCiuc001kgn.2. human. [Q8TE04-2]
uc001kgo.2. human. [Q8TE04-3]
uc001kgp.2. human. [Q8TE04-1]
uc009xtu.2. human. [Q8TE04-4]

Polymorphism databases

DMDMi27805665.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF355198 mRNA. Translation: AAL86371.1.
AL157400 Genomic DNA. Translation: CAI16826.1.
AL157400 Genomic DNA. Translation: CAI16827.1.
AY027661 mRNA. Translation: AAK20916.1.
AY027662 mRNA. Translation: AAK20917.1.
AY027663 mRNA. Translation: AAK20918.1.
CH471066 Genomic DNA. Translation: EAW50131.1.
BC026296 mRNA. Translation: AAH26296.1. Different initiation.
BK000008 mRNA. Translation: DAA00002.1.
BK000009 mRNA. Translation: DAA00003.1.
CCDSiCCDS31244.1. [Q8TE04-1]
CCDS7405.1. [Q8TE04-3]
CCDS7406.1. [Q8TE04-2]
RefSeqiNP_612189.2. NM_138316.3. [Q8TE04-3]
NP_683878.1. NM_148977.2. [Q8TE04-1]
NP_683879.1. NM_148978.2. [Q8TE04-2]
UniGeneiHs.163555.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2I7NX-ray1.90A/B234-593[»]
3SMPX-ray1.90A/B231-597[»]
ProteinModelPortaliQ8TE04.
SMRiQ8TE04. Positions 232-594.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119751. 2 interactions.
IntActiQ8TE04. 1 interaction.
MINTiMINT-3319085.
STRINGi9606.ENSP00000302108.

PTM databases

PhosphoSiteiQ8TE04.

Polymorphism databases

DMDMi27805665.

Proteomic databases

MaxQBiQ8TE04.
PaxDbiQ8TE04.
PRIDEiQ8TE04.

Protocols and materials databases

DNASUi53354.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000307534; ENSP00000302108; ENSG00000152782. [Q8TE04-1]
ENST00000322191; ENSP00000318526; ENSG00000152782. [Q8TE04-3]
ENST00000342512; ENSP00000345118; ENSG00000152782. [Q8TE04-2]
GeneIDi53354.
KEGGihsa:53354.
UCSCiuc001kgn.2. human. [Q8TE04-2]
uc001kgo.2. human. [Q8TE04-3]
uc001kgp.2. human. [Q8TE04-1]
uc009xtu.2. human. [Q8TE04-4]

Organism-specific databases

CTDi53354.
GeneCardsiGC10M091332.
H-InvDBHIX0009024.
HGNCiHGNC:8598. PANK1.
HPAiHPA021795.
MIMi606160. gene.
neXtProtiNX_Q8TE04.
PharmGKBiPA32928.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG5146.
GeneTreeiENSGT00390000020719.
HOGENOMiHOG000194690.
HOVERGENiHBG053495.
InParanoidiQ8TE04.
KOiK09680.
OMAiWGCAGIP.
OrthoDBiEOG7R2BJR.
PhylomeDBiQ8TE04.
TreeFamiTF314866.

Enzyme and pathway databases

UniPathwayiUPA00241; UER00352.
ReactomeiREACT_11218. Coenzyme A biosynthesis.

Miscellaneous databases

ChiTaRSiPANK1. human.
EvolutionaryTraceiQ8TE04.
GeneWikiiPANK1.
GenomeRNAii53354.
NextBioi56014.
PROiQ8TE04.
SOURCEiSearch...

Gene expression databases

BgeeiQ8TE04.
CleanExiHS_PANK1.
GenevestigatoriQ8TE04.

Family and domain databases

InterProiIPR004567. Type_II_PanK.
[Graphical view]
PfamiPF03630. Fumble. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00555. panK_eukar. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of a novel human pantothenate kinase gene."
    Ni X., Ma Y., Cheng H., Jiang M., Ying K., Xie Y., Mao Y.
    Int. J. Biochem. Cell Biol. 34:109-115(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    Tissue: Fetal brain.
  2. "PPARalpha controls the intracellular coenzyme A concentration via regulation of PANK1alpha gene expression."
    Ramaswamy G., Karim M.A., Murti K.G., Jackowski S.
    J. Lipid Res. 45:17-31(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 4), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INDUCTION.
  3. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 460-598 (ISOFORM 2).
    Tissue: Skeletal muscle.
  6. "A novel pantothenate kinase gene (PANK2) is defective in Hallervorden-Spatz syndrome."
    Zhou B., Westaway S.K., Levinson B., Johnson M.A., Gitschier J., Hayflick S.J.
    Nat. Genet. 28:345-349(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION (ISOFORM 2).
  7. Cited for: IDENTIFICATION (ISOFORM 1).
  8. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-215, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  9. "Crystal structures of human pantothenate kinases. Insights into allosteric regulation and mutations linked to a neurodegeneration disorder."
    Hong B.S., Senisterra G., Rabeh W.M., Vedadi M., Leonardi R., Zhang Y.M., Rock C.O., Jackowski S., Park H.W.
    J. Biol. Chem. 282:27984-27993(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 234-593 IN COMPLEX WITH ACETYL-COA, SUBUNIT, ENZYME REGULATION.

Entry informationi

Entry nameiPANK1_HUMAN
AccessioniPrimary (citable) accession number: Q8TE04
Secondary accession number(s): A6NIP0
, Q7RTX6, Q7Z495, Q8TBQ8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: January 17, 2003
Last modified: January 7, 2015
This is version 122 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.