Q8TE02 (ELP5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 69.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Elongator complex protein 5 Alternative name(s): Dermal papilla-derived protein 6 S-phase 2 protein | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 316 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4. Involved in cell migration By similarity. May be involved in TP53-mediated transcriptional regulation. Ref.1 |
| Subunit structure | Component of the RNA polymerase II elongator complex (Elongator), which consists of IKBKAP/ELP1, STIP1/ELP2, ELP3, ELP4, ELP5 and ELP6; in the complex, is required for optimal binding of ELP3 to ELP4. Ref.10 |
| Subcellular location | |
| Tissue specificity | Ubiquitously expressed with high levels in heart, brain, liver, skeletal muscle and testis. |
| Sequence similarities | Belongs to the ELP5 family. |
| Caution | It is uncertain whether Met-1 or Met-17 is the initiator. |
| Sequence caution | The sequence AAD20964.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAQ13591.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | positive regulation of cell migration Inferred from sequence or structural similarity. Source: UniProtKB regulation of transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | Elongator holoenzyme complex Inferred from direct assay Ref.10. Source: UniProtKB cytoplasmInferred from direct assay Ref.10. Source: UniProtKB nucleusInferred from direct assay Ref.10. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ATXN1 | P54253 | 2 | EBI-946189,EBI-930964 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8TE02-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8TE02-2) The sequence of this isoform differs from the canonical sequence as follows: 247-316: DPTTHLTFNL...QEDPDDDLDI → SKNAKARTRKCSLVSGHGRENKSCRGWGWGQGF | ||||||
| Isoform 3 (identifier: Q8TE02-3) The sequence of this isoform differs from the canonical sequence as follows: 154-179: DSSSVGKVSVLGLLHEELHGPGPVGA → ETPPSLFPLIHLPLPRSVPLFLSTLE 180-316: Missing. | ||||||
| Isoform 4 (identifier: Q8TE02-4) The sequence of this isoform differs from the canonical sequence as follows: 246-246: V → VHPLYLQV |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 316 | 316 | Elongator complex protein 5 | PRO_0000280817 | |||||
Natural variations | |||||||||
| Alternative sequence | 154 – 179 | 26 | DSSSV…GPVGA → ETPPSLFPLIHLPLPRSVPL FLSTLE in isoform 3. | VSP_023920 | |||||
| Alternative sequence | 180 – 316 | 137 | Missing in isoform 3. | VSP_023921 | |||||
| Alternative sequence | 246 | 1 | V → VHPLYLQV in isoform 4. | VSP_023922 | |||||
| Alternative sequence | 247 – 316 | 70 | DPTTH…DDLDI → SKNAKARTRKCSLVSGHGRE NKSCRGWGWGQGF in isoform 2. | VSP_023923 | |||||
| Natural variant | 14 | 1 | E → K. Ref.2 Corresponds to variant rs2521988 [ dbSNP | Ensembl ]. | VAR_053882 | |||||
| Natural variant | 303 | 1 | D → Y. Ref.6 Corresponds to variant rs17849664 [ dbSNP | Ensembl ]. | VAR_031205 | |||||
Experimental info | |||||||||
| Sequence conflict | 151 | 1 | C → R in AAM10496. Ref.1 | ||||||
| Sequence conflict | 175 | 1 | G → S in AAM10496. Ref.1 | ||||||
| Sequence conflict | 181 | 1 | S → N in AAM10496. Ref.1 | ||||||
| Sequence conflict | 228 | 1 | Q → K in AAM10496. Ref.1 | ||||||
| Sequence conflict | 245 | 1 | P → R in AAM10496. Ref.1 | ||||||
| Isoform 2: | |||||||||
| Sequence conflict | 263 | 1 | H → Q in AAQ13591. Ref.8 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of the human gene DERP6, which activates transcriptional activities of p53." Yuan J., Tang W., Luo K., Chen X., Gu X., Wan B., Yu L. Mol. Biol. Rep. 33:151-158(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION. |
| [2] | "Molecular cloning of a dermal papilla derived gene." Ikeda A., Yoshimoto M. Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT LYS-14. Tissue: Hair follicle dermal papilla. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Hippocampus. |
| [4] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT TYR-303. Tissue: Placenta. |
| [7] | "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells." Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. Chen Z.Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 10-316 (ISOFORM 3). Tissue: Umbilical cord blood. |
| [8] | Zhao B., Xu Y.Y., Liu Y.Q., Wang X.Y., Liu B., Sheng H., Ye J., Song L., Gao Y., Zhang C.L., Zhang J., Gao R.L., Wu Q.Y., Hui R.T. Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 24-316 (ISOFORM 2). Tissue: Aorta. |
| [9] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 149-316 (ISOFORM 4). Tissue: Amygdala. |
| [10] | "DERP6 (ELP5) and C3ORF75 (ELP6) regulate tumorigenicity and migration of melanoma cells as subunits of Elongator." Close P., Gillard M., Ladang A., Jiang Z., Papuga J., Hawkes N., Nguyen L., Chapelle J.P., Bouillenne F., Svejstrup J., Fillet M., Chariot A. J. Biol. Chem. 287:32535-32545(2012) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE RNA POLYMERASE II ELONGATOR COMPLEX, SUBCELLULAR LOCATION, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF087868 mRNA. Translation: AAM10496.1. AB013910 mRNA. Translation: BAB87800.1. AK289940 mRNA. Translation: BAF82629.1. AC003688 Genomic DNA. No translation available. CH471108 Genomic DNA. Translation: EAW90230.1. CH471108 Genomic DNA. Translation: EAW90231.1. BC002762 mRNA. Translation: AAH02762.2. AF070658 mRNA. Translation: AAD20964.1. Different initiation. AF163262 mRNA. Translation: AAQ13591.1. Different initiation. AL713741 mRNA. Translation: CAH56280.1. |
| IPI | IPI00328185. IPI00383650. IPI00402148. IPI00829707. IPI00877109. |
| RefSeq | NP_056177.3. NM_015362.3. NP_981958.1. NM_203413.1. NP_981959.1. NM_203414.1. NP_981960.1. NM_203415.1. |
| UniGene | Hs.417029. |
3D structure databases | |
| ProteinModelPortal | Q8TE02. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8TE02. 1 interaction. |
| MINT | MINT-2856032. |
| STRING | 9606.ENSP00000346412. |
PTM databases | |
| PhosphoSite | Q8TE02. |
Polymorphism databases | |
| DMDM | 134034093. |
Proteomic databases | |
| PaxDb | Q8TE02. |
| PRIDE | Q8TE02. |
Protocols and materials databases | |
| DNASU | 23587. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000354429; ENSP00000346412; ENSG00000170291. ENST00000356683; ENSP00000349111; ENSG00000170291. ENST00000396627; ENSP00000379868; ENSG00000170291. ENST00000396628; ENSP00000379869; ENSG00000170291. ENST00000573657; ENSP00000459633; ENSG00000170291. ENST00000574255; ENSP00000461489; ENSG00000170291. ENST00000574993; ENSP00000459835; ENSG00000170291. |
| GeneID | 23587. |
| KEGG | hsa:23587. |
| UCSC | uc002gfg.1. human. uc002gfk.1. human. |
Organism-specific databases | |
| CTD | 23587. |
| GeneCards | GC17P007154. |
| HGNC | HGNC:30617. ELP5. |
| HPA | HPA023279. |
| MIM | 615019. gene. |
| neXtProt | NX_Q8TE02. |
| PharmGKB | PA143485405. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG41404. |
| HOGENOM | HOG000013029. |
| HOVERGEN | HBG081433. |
| InParanoid | Q8TE02. |
| OMA | NSRLVYH. |
| OrthoDB | EOG4D26QP. |
| PhylomeDB | Q8TE02. |
Gene expression databases | |
| ArrayExpress | Q8TE02. |
| Bgee | Q8TE02. |
| CleanEx | HS_C17orf81. |
| Genevestigator | Q8TE02. |
Family and domain databases | |
| InterPro | IPR019519. Histone_acetylation_protein_2. [Graphical view] |
| Pfam | PF10483. Hap2_elong. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 23587. |
| NextBio | 46212. |
| SOURCE | Search... |
Entry information
| Entry name | ELP5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8TE02 Secondary accession number(s): A8K1M5 Q9Y2Q4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
