Reviewed,
UniProtKB/Swiss-Prot Q8TE02 (DERP6_HUMAN)
Last modified
November 3, 2009.
Version 39.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Dermal papilla-derived protein 6 Alternative name(s): S-phase 2 protein | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 316 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May be involved in TP53-mediated transcriptional regulation. Ref.1 |
| Subcellular location | |
| Tissue specificity | Ubiquitously expressed with high levels in heart, brain, liver, skeletal muscle and testis. |
| Sequence similarities | Belongs to the ELP5 family. |
| Caution | It is uncertain whether Met-1 or Met-17 is the initiator. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | regulation of transcription Inferred from electronic annotation. Source: UniProtKB-KW transcriptionInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8TE02-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8TE02-2) The sequence of this isoform differs from the canonical sequence as follows: 247-316: DPTTHLTFNL...QEDPDDDLDI → SKNAKARTRKCSLVSGQGRENKSCRGWGWGQGF | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8TE02-3) The sequence of this isoform differs from the canonical sequence as follows: 154-179: DSSSVGKVSVLGLLHEELHGPGPVGA → ETPPSLFPLIHLPLPRSVPLFLSTLE 180-316: Missing. | ||||||
| Isoform 4 (identifier: Q8TE02-4) The sequence of this isoform differs from the canonical sequence as follows: 246-246: V → VHPLYLQV |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 316 | 316 | Dermal papilla-derived protein 6 | PRO_0000280817 | |||||
Natural variations | |||||||||
| Alternative sequence | 154 – 179 | 26 | DSSSV…GPVGA → ETPPSLFPLIHLPLPRSVPL FLSTLE in isoform 3. | VSP_023920 | |||||
| Alternative sequence | 180 – 316 | 137 | Missing in isoform 3. | VSP_023921 | |||||
| Alternative sequence | 246 | 1 | V → VHPLYLQV in isoform 4. | VSP_023922 | |||||
| Alternative sequence | 247 – 316 | 70 | DPTTH…DDLDI → SKNAKARTRKCSLVSGQGRE NKSCRGWGWGQGF in isoform 2. | VSP_023923 | |||||
| Natural variant | 14 | 1 | E → K: dbSNP rs2521988. Ref.2 | VAR_053882 | |||||
| Natural variant | 303 | 1 | D → Y: dbSNP rs17849664. Ref.3 | VAR_031205 | |||||
Experimental info | |||||||||
| Sequence conflict | 151 | 1 | C → R in AAM10496. Ref.1 | ||||||
| Sequence conflict | 175 | 1 | G → S in AAM10496. Ref.1 | ||||||
| Sequence conflict | 181 | 1 | S → N in AAM10496. Ref.1 | ||||||
| Sequence conflict | 228 | 1 | Q → K in AAM10496. Ref.1 | ||||||
| Sequence conflict | 245 | 1 | P → R in AAM10496. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of the human gene DERP6, which activates transcriptional activities of p53." Yuan J., Tang W., Luo K., Chen X., Gu X., Wan B., Yu L. Mol. Biol. Rep. 33:151-158(2006) [PubMed: 16850183] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION. |
| [2] | "Molecular cloning of a dermal papilla derived gene." Ikeda A., Yoshimoto M. Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT LYS-14. Tissue: Hair follicle dermal papilla. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT TYR-303. Tissue: Placenta. |
| [4] | "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells." Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. Chen Z.Genome Res. 10:1546-1560(2000) [PubMed: 11042152] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 10-316 (ISOFORM 3). Tissue: Umbilical cord blood. |
| [5] | Zhao B., Xu Y.Y., Liu Y.Q., Wang X.Y., Liu B., Sheng H., Ye J., Song L., Gao Y., Zhang C.L., Zhang J., Gao R.L., Wu Q.Y., Hui R.T. Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 24-316 (ISOFORM 2). Tissue: Aorta. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 149-316 (ISOFORM 4). Tissue: Amygdala. |
Cross-references
Sequence databases | |
|---|---|
| AF087868 mRNA. Translation: AAM10496.1. AB013910 mRNA. Translation: BAB87800.1. BC002762 mRNA. Translation: AAH02762.2. AF070658 mRNA. Translation: AAD20964.1. Different initiation. AF163262 mRNA. Translation: AAQ13591.1. Different initiation. AL713741 mRNA. Translation: CAH56280.1. | |
| IPI | IPI00328185. IPI00383650. IPI00402148. IPI00829707. |
| RefSeq | NP_056177.3. NP_981958.1. NP_981959.1. NP_981960.1. |
| UniGene | Hs.417029 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8TE02. 1 interaction. |
Proteomic databases | |
| PRIDE | Q8TE02. |
Genome annotation databases | |
| Ensembl | ENST00000354429; ENSP00000346412; ENSG00000170291; Homo sapiens. [Genome view] ENST00000356683; ENSP00000349111; ENSG00000170291; Homo sapiens. [Genome view] ENST00000396627; ENSP00000379868; ENSG00000170291; Homo sapiens. [Genome view] ENST00000396628; ENSP00000379869; ENSG00000170291; Homo sapiens. [Genome view] |
| GeneID | 23587. |
| KEGG | hsa:23587. |
| UCSC | uc002gfg.1. human. uc002gfk.1. human. uc002gfl.1. human. |
Organism-specific databases | |
| CTD | 23587. |
| GeneCards | GC17P007097. |
| HGNC | HGNC:30617. C17orf81. |
| HPA | HPA023279. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q8TE02. |
| OMA | NSRLVYH. |
Gene expression databases | |
| ArrayExpress | Q8TE02. |
| Bgee | Q8TE02. |
| CleanEx | HS_C17orf81. |
| Genevestigator | Q8TE02. |
Family and domain databases | |
| InterPro | IPR019519. Histone_acetylation_protein_2. [Graphical view] |
| Pfam | PF10483. Hap2_elong. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 46212. |
Entry information
| Entry name | DERP6_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8TE02 Secondary accession number(s): Q659B6 Q9Y2Q4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with


