Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8TE02

- ELP5_HUMAN

UniProt

Q8TE02 - ELP5_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Elongator complex protein 5

Gene

ELP5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4. Involved in cell migration (By similarity). May be involved in TP53-mediated transcriptional regulation.By similarity1 Publication

GO - Biological processi

  1. chromatin organization Source: Reactome
  2. positive regulation of cell migration Source: UniProtKB
  3. regulation of transcription, DNA-templated Source: UniProtKB-KW
  4. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiREACT_172610. HATs acetylate histones.

Names & Taxonomyi

Protein namesi
Recommended name:
Elongator complex protein 5
Alternative name(s):
Dermal papilla-derived protein 6
S-phase 2 protein
Gene namesi
Name:ELP5
Synonyms:C17orf81, DERP6
ORF Names:HSPC002, MSTP071
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:30617. ELP5.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. Elongator holoenzyme complex Source: UniProtKB
  3. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA143485405.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 316316Elongator complex protein 5PRO_0000280817Add
BLAST

Proteomic databases

MaxQBiQ8TE02.
PaxDbiQ8TE02.
PRIDEiQ8TE02.

PTM databases

PhosphoSiteiQ8TE02.

Expressioni

Tissue specificityi

Ubiquitously expressed with high levels in heart, brain, liver, skeletal muscle and testis.

Gene expression databases

BgeeiQ8TE02.
CleanExiHS_C17orf81.
ExpressionAtlasiQ8TE02. baseline and differential.
GenevestigatoriQ8TE02.

Organism-specific databases

HPAiHPA023279.

Interactioni

Subunit structurei

Component of the RNA polymerase II elongator complex (Elongator), which consists of IKBKAP/ELP1, STIP1/ELP2, ELP3, ELP4, ELP5 and ELP6; in the complex, is required for optimal binding of ELP3 to ELP4.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ATXN1P542532EBI-946189,EBI-930964
ELP4Q96EB14EBI-946189,EBI-3951755

Protein-protein interaction databases

BioGridi117122. 9 interactions.
IntActiQ8TE02. 5 interactions.
MINTiMINT-2856032.
STRINGi9606.ENSP00000346412.

Structurei

3D structure databases

ProteinModelPortaliQ8TE02.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the ELP5 family.Curated

Phylogenomic databases

eggNOGiNOG41404.
GeneTreeiENSGT00390000009210.
HOGENOMiHOG000013029.
HOVERGENiHBG081433.
InParanoidiQ8TE02.
OMAiNSRLVYH.
OrthoDBiEOG70PBZX.
PhylomeDBiQ8TE02.
TreeFamiTF314636.

Family and domain databases

InterProiIPR019519. Elp5.
[Graphical view]
PfamiPF10483. Elong_Iki1. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8TE02-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTPSEGARAG TGRELEMLDS LLALGGLVLL RDSVEWEGRS LLKALVKKSA
60 70 80 90 100
LCGEQVHILG CEVSEEEFRE GFDSDINNRL VYHDFFRDPL NWSKTEEAFP
110 120 130 140 150
GGPLGALRAM CKRTDPVPVT IALDSLSWLL LRLPCTTLCQ VLHAVSHQDS
160 170 180 190 200
CPGDSSSVGK VSVLGLLHEE LHGPGPVGAL SSLAQTEVTL GGTMGQASAH
210 220 230 240 250
ILCRRPRQRP TDQTQWFSIL PDFSLDLQEG PSVESQPYSD PHIPPVDPTT
260 270 280 290 300
HLTFNLHLSK KEREARDSLI LPFQFSSEKQ QALLRPRPGQ ATSHIFYEPD
310
AYDDLDQEDP DDDLDI
Length:316
Mass (Da):34,841
Last modified:March 20, 2007 - v2
Checksum:iC96F86C6B99CE7CE
GO
Isoform 2 (identifier: Q8TE02-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     247-316: DPTTHLTFNL...QEDPDDDLDI → SKNAKARTRKCSLVSGHGRENKSCRGWGWGQGF

Show »
Length:279
Mass (Da):30,349
Checksum:i8178D41F211E8004
GO
Isoform 3 (identifier: Q8TE02-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-179: DSSSVGKVSVLGLLHEELHGPGPVGA → ETPPSLFPLIHLPLPRSVPLFLSTLE
     180-316: Missing.

Show »
Length:179
Mass (Da):19,719
Checksum:iD4FD6EDBB859EF3C
GO
Isoform 4 (identifier: Q8TE02-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     246-246: V → VHPLYLQV

Show »
Length:323
Mass (Da):35,692
Checksum:i085D33C458297F9A
GO

Sequence cautioni

The sequence AAD20964.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAQ13591.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti151 – 1511C → R in AAM10496. (PubMed:16850183)Curated
Sequence conflicti175 – 1751G → S in AAM10496. (PubMed:16850183)Curated
Sequence conflicti181 – 1811S → N in AAM10496. (PubMed:16850183)Curated
Sequence conflicti228 – 2281Q → K in AAM10496. (PubMed:16850183)Curated
Sequence conflicti245 – 2451P → R in AAM10496. (PubMed:16850183)Curated
Isoform 2 (identifier: Q8TE02-2)
Sequence conflicti263 – 2631H → Q in AAQ13591. 1 PublicationCurated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti14 – 141E → K.1 Publication
Corresponds to variant rs2521988 [ dbSNP | Ensembl ].
VAR_053882
Natural varianti303 – 3031D → Y.1 Publication
Corresponds to variant rs17849664 [ dbSNP | Ensembl ].
VAR_031205

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei154 – 17926DSSSV…GPVGA → ETPPSLFPLIHLPLPRSVPL FLSTLE in isoform 3. 1 PublicationVSP_023920Add
BLAST
Alternative sequencei180 – 316137Missing in isoform 3. 1 PublicationVSP_023921Add
BLAST
Alternative sequencei246 – 2461V → VHPLYLQV in isoform 4. 1 PublicationVSP_023922
Alternative sequencei247 – 31670DPTTH…DDLDI → SKNAKARTRKCSLVSGHGRE NKSCRGWGWGQGF in isoform 2. 2 PublicationsVSP_023923Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087868 mRNA. Translation: AAM10496.1.
AB013910 mRNA. Translation: BAB87800.1.
AK289940 mRNA. Translation: BAF82629.1.
AC003688 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90230.1.
CH471108 Genomic DNA. Translation: EAW90231.1.
BC002762 mRNA. Translation: AAH02762.2.
AF070658 mRNA. Translation: AAD20964.1. Different initiation.
AF163262 mRNA. Translation: AAQ13591.1. Different initiation.
AL713741 mRNA. Translation: CAH56280.1.
CCDSiCCDS11094.1. [Q8TE02-1]
CCDS11095.1. [Q8TE02-2]
RefSeqiNP_056177.3. NM_015362.4. [Q8TE02-1]
NP_981958.1. NM_203413.2. [Q8TE02-2]
NP_981959.1. NM_203414.2. [Q8TE02-1]
NP_981960.1. NM_203415.1. [Q8TE02-1]
UniGeneiHs.417029.

Genome annotation databases

EnsembliENST00000354429; ENSP00000346412; ENSG00000170291. [Q8TE02-1]
ENST00000356683; ENSP00000349111; ENSG00000170291. [Q8TE02-2]
ENST00000396627; ENSP00000379868; ENSG00000170291. [Q8TE02-1]
ENST00000396628; ENSP00000379869; ENSG00000170291. [Q8TE02-1]
ENST00000573657; ENSP00000459633; ENSG00000170291. [Q8TE02-3]
ENST00000574255; ENSP00000461489; ENSG00000170291. [Q8TE02-3]
ENST00000574993; ENSP00000459835; ENSG00000170291. [Q8TE02-2]
GeneIDi23587.
KEGGihsa:23587.
UCSCiuc002gfg.1. human. [Q8TE02-1]
uc002gfj.3. human. [Q8TE02-2]
uc002gfk.1. human. [Q8TE02-3]

Polymorphism databases

DMDMi134034093.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087868 mRNA. Translation: AAM10496.1 .
AB013910 mRNA. Translation: BAB87800.1 .
AK289940 mRNA. Translation: BAF82629.1 .
AC003688 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90230.1 .
CH471108 Genomic DNA. Translation: EAW90231.1 .
BC002762 mRNA. Translation: AAH02762.2 .
AF070658 mRNA. Translation: AAD20964.1 . Different initiation.
AF163262 mRNA. Translation: AAQ13591.1 . Different initiation.
AL713741 mRNA. Translation: CAH56280.1 .
CCDSi CCDS11094.1. [Q8TE02-1 ]
CCDS11095.1. [Q8TE02-2 ]
RefSeqi NP_056177.3. NM_015362.4. [Q8TE02-1 ]
NP_981958.1. NM_203413.2. [Q8TE02-2 ]
NP_981959.1. NM_203414.2. [Q8TE02-1 ]
NP_981960.1. NM_203415.1. [Q8TE02-1 ]
UniGenei Hs.417029.

3D structure databases

ProteinModelPortali Q8TE02.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 117122. 9 interactions.
IntActi Q8TE02. 5 interactions.
MINTi MINT-2856032.
STRINGi 9606.ENSP00000346412.

PTM databases

PhosphoSitei Q8TE02.

Polymorphism databases

DMDMi 134034093.

Proteomic databases

MaxQBi Q8TE02.
PaxDbi Q8TE02.
PRIDEi Q8TE02.

Protocols and materials databases

DNASUi 23587.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000354429 ; ENSP00000346412 ; ENSG00000170291 . [Q8TE02-1 ]
ENST00000356683 ; ENSP00000349111 ; ENSG00000170291 . [Q8TE02-2 ]
ENST00000396627 ; ENSP00000379868 ; ENSG00000170291 . [Q8TE02-1 ]
ENST00000396628 ; ENSP00000379869 ; ENSG00000170291 . [Q8TE02-1 ]
ENST00000573657 ; ENSP00000459633 ; ENSG00000170291 . [Q8TE02-3 ]
ENST00000574255 ; ENSP00000461489 ; ENSG00000170291 . [Q8TE02-3 ]
ENST00000574993 ; ENSP00000459835 ; ENSG00000170291 . [Q8TE02-2 ]
GeneIDi 23587.
KEGGi hsa:23587.
UCSCi uc002gfg.1. human. [Q8TE02-1 ]
uc002gfj.3. human. [Q8TE02-2 ]
uc002gfk.1. human. [Q8TE02-3 ]

Organism-specific databases

CTDi 23587.
GeneCardsi GC17P007154.
HGNCi HGNC:30617. ELP5.
HPAi HPA023279.
MIMi 615019. gene.
neXtProti NX_Q8TE02.
PharmGKBi PA143485405.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG41404.
GeneTreei ENSGT00390000009210.
HOGENOMi HOG000013029.
HOVERGENi HBG081433.
InParanoidi Q8TE02.
OMAi NSRLVYH.
OrthoDBi EOG70PBZX.
PhylomeDBi Q8TE02.
TreeFami TF314636.

Enzyme and pathway databases

Reactomei REACT_172610. HATs acetylate histones.

Miscellaneous databases

GeneWikii C17orf81.
GenomeRNAii 23587.
NextBioi 46212.
PROi Q8TE02.
SOURCEi Search...

Gene expression databases

Bgeei Q8TE02.
CleanExi HS_C17orf81.
ExpressionAtlasi Q8TE02. baseline and differential.
Genevestigatori Q8TE02.

Family and domain databases

InterProi IPR019519. Elp5.
[Graphical view ]
Pfami PF10483. Elong_Iki1. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of the human gene DERP6, which activates transcriptional activities of p53."
    Yuan J., Tang W., Luo K., Chen X., Gu X., Wan B., Yu L.
    Mol. Biol. Rep. 33:151-158(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION.
  2. "Molecular cloning of a dermal papilla derived gene."
    Ikeda A., Yoshimoto M.
    Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT LYS-14.
    Tissue: Hair follicle dermal papilla.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Hippocampus.
  4. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT TYR-303.
    Tissue: Placenta.
  7. "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
    Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X.
    , Gu J., Chen S.-J., Chen Z.
    Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 10-316 (ISOFORM 3).
    Tissue: Umbilical cord blood.
  8. Zhao B., Xu Y.Y., Liu Y.Q., Wang X.Y., Liu B., Sheng H., Ye J., Song L., Gao Y., Zhang C.L., Zhang J., Gao R.L., Wu Q.Y., Hui R.T.
    Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 24-316 (ISOFORM 2).
    Tissue: Aorta.
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 149-316 (ISOFORM 4).
    Tissue: Amygdala.
  10. "DERP6 (ELP5) and C3ORF75 (ELP6) regulate tumorigenicity and migration of melanoma cells as subunits of Elongator."
    Close P., Gillard M., Ladang A., Jiang Z., Papuga J., Hawkes N., Nguyen L., Chapelle J.P., Bouillenne F., Svejstrup J., Fillet M., Chariot A.
    J. Biol. Chem. 287:32535-32545(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN THE RNA POLYMERASE II ELONGATOR COMPLEX, SUBCELLULAR LOCATION, IDENTIFICATION BY MASS SPECTROMETRY.

Entry informationi

Entry nameiELP5_HUMAN
AccessioniPrimary (citable) accession number: Q8TE02
Secondary accession number(s): A8K1M5
, D3DTN9, Q659B6, Q7Z2T4, Q8TDR9, Q9BUB2, Q9Y2Q4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 20, 2007
Last modified: October 29, 2014
This is version 85 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

It is uncertain whether Met-1 or Met-17 is the initiator.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3