Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Elongator complex protein 5

Gene

ELP5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4. Involved in cell migration (By similarity). May be involved in TP53-mediated transcriptional regulation.By similarity1 Publication

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Enzyme and pathway databases

BioCyciZFISH:ENSG00000170291-MONOMER.
ReactomeiR-HSA-3214847. HATs acetylate histones.

Names & Taxonomyi

Protein namesi
Recommended name:
Elongator complex protein 5
Alternative name(s):
Dermal papilla-derived protein 6
S-phase 2 protein
Gene namesi
Name:ELP5
Synonyms:C17orf81, DERP6
ORF Names:HSPC002, MSTP071
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:30617. ELP5.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • Elongator holoenzyme complex Source: UniProtKB
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000170291.
PharmGKBiPA143485405.

Polymorphism and mutation databases

BioMutaiELP5.
DMDMi134034093.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002808171 – 316Elongator complex protein 5Add BLAST316

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei268PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8TE02.
MaxQBiQ8TE02.
PaxDbiQ8TE02.
PeptideAtlasiQ8TE02.
PRIDEiQ8TE02.

PTM databases

iPTMnetiQ8TE02.
PhosphoSitePlusiQ8TE02.

Expressioni

Tissue specificityi

Ubiquitously expressed with high levels in heart, brain, liver, skeletal muscle and testis.

Gene expression databases

BgeeiENSG00000170291.
CleanExiHS_C17orf81.
ExpressionAtlasiQ8TE02. baseline and differential.
GenevisibleiQ8TE02. HS.

Organism-specific databases

HPAiHPA023279.

Interactioni

Subunit structurei

Component of the RNA polymerase II elongator complex (Elongator), which consists of IKBKAP/ELP1, STIP1/ELP2, ELP3, ELP4, ELP5 and ELP6; in the complex, is required for optimal binding of ELP3 to ELP4.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ATXN1P542532EBI-946189,EBI-930964
ELP4Q96EB14EBI-946189,EBI-3951755

Protein-protein interaction databases

BioGridi117122. 10 interactors.
IntActiQ8TE02. 5 interactors.
MINTiMINT-2856032.
STRINGi9606.ENSP00000346412.

Structurei

3D structure databases

ProteinModelPortaliQ8TE02.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the ELP5 family.Curated

Phylogenomic databases

eggNOGiENOG410IZJG. Eukaryota.
ENOG411201Y. LUCA.
GeneTreeiENSGT00390000009210.
HOGENOMiHOG000013029.
HOVERGENiHBG081433.
InParanoidiQ8TE02.
OMAiNSRLVYH.
OrthoDBiEOG091G13RW.
PhylomeDBiQ8TE02.
TreeFamiTF314636.

Family and domain databases

InterProiIPR019519. Elp5.
[Graphical view]
PANTHERiPTHR15641. PTHR15641. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TE02-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTPSEGARAG TGRELEMLDS LLALGGLVLL RDSVEWEGRS LLKALVKKSA
60 70 80 90 100
LCGEQVHILG CEVSEEEFRE GFDSDINNRL VYHDFFRDPL NWSKTEEAFP
110 120 130 140 150
GGPLGALRAM CKRTDPVPVT IALDSLSWLL LRLPCTTLCQ VLHAVSHQDS
160 170 180 190 200
CPGDSSSVGK VSVLGLLHEE LHGPGPVGAL SSLAQTEVTL GGTMGQASAH
210 220 230 240 250
ILCRRPRQRP TDQTQWFSIL PDFSLDLQEG PSVESQPYSD PHIPPVDPTT
260 270 280 290 300
HLTFNLHLSK KEREARDSLI LPFQFSSEKQ QALLRPRPGQ ATSHIFYEPD
310
AYDDLDQEDP DDDLDI
Length:316
Mass (Da):34,841
Last modified:March 20, 2007 - v2
Checksum:iC96F86C6B99CE7CE
GO
Isoform 2 (identifier: Q8TE02-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     247-316: DPTTHLTFNL...QEDPDDDLDI → SKNAKARTRKCSLVSGHGRENKSCRGWGWGQGF

Show »
Length:279
Mass (Da):30,349
Checksum:i8178D41F211E8004
GO
Isoform 3 (identifier: Q8TE02-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-179: DSSSVGKVSVLGLLHEELHGPGPVGA → ETPPSLFPLIHLPLPRSVPLFLSTLE
     180-316: Missing.

Show »
Length:179
Mass (Da):19,719
Checksum:iD4FD6EDBB859EF3C
GO
Isoform 4 (identifier: Q8TE02-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     246-246: V → VHPLYLQV

Show »
Length:323
Mass (Da):35,692
Checksum:i085D33C458297F9A
GO

Sequence cautioni

The sequence AAD20964 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAQ13591 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti151C → R in AAM10496 (PubMed:16850183).Curated1
Sequence conflicti175G → S in AAM10496 (PubMed:16850183).Curated1
Sequence conflicti181S → N in AAM10496 (PubMed:16850183).Curated1
Sequence conflicti228Q → K in AAM10496 (PubMed:16850183).Curated1
Sequence conflicti245P → R in AAM10496 (PubMed:16850183).Curated1
Isoform 2 (identifier: Q8TE02-2)
Sequence conflicti263H → Q in AAQ13591 (Ref. 8) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05388214E → K.1 PublicationCorresponds to variant rs2521988dbSNPEnsembl.1
Natural variantiVAR_031205303D → Y.1 PublicationCorresponds to variant rs17849664dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_023920154 – 179DSSSV…GPVGA → ETPPSLFPLIHLPLPRSVPL FLSTLE in isoform 3. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_023921180 – 316Missing in isoform 3. 1 PublicationAdd BLAST137
Alternative sequenceiVSP_023922246V → VHPLYLQV in isoform 4. 1 Publication1
Alternative sequenceiVSP_023923247 – 316DPTTH…DDLDI → SKNAKARTRKCSLVSGHGRE NKSCRGWGWGQGF in isoform 2. 2 PublicationsAdd BLAST70

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087868 mRNA. Translation: AAM10496.1.
AB013910 mRNA. Translation: BAB87800.1.
AK289940 mRNA. Translation: BAF82629.1.
AC003688 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90230.1.
CH471108 Genomic DNA. Translation: EAW90231.1.
BC002762 mRNA. Translation: AAH02762.2.
AF070658 mRNA. Translation: AAD20964.1. Different initiation.
AF163262 mRNA. Translation: AAQ13591.1. Different initiation.
AL713741 mRNA. Translation: CAH56280.1.
CCDSiCCDS11094.1. [Q8TE02-1]
CCDS11095.1. [Q8TE02-2]
RefSeqiNP_056177.3. NM_015362.4. [Q8TE02-1]
NP_981958.1. NM_203413.2. [Q8TE02-2]
NP_981959.1. NM_203414.2. [Q8TE02-1]
NP_981960.1. NM_203415.1. [Q8TE02-1]
XP_011522081.1. XM_011523779.2. [Q8TE02-1]
UniGeneiHs.417029.

Genome annotation databases

EnsembliENST00000354429; ENSP00000346412; ENSG00000170291. [Q8TE02-1]
ENST00000356683; ENSP00000349111; ENSG00000170291. [Q8TE02-2]
ENST00000396627; ENSP00000379868; ENSG00000170291. [Q8TE02-1]
ENST00000396628; ENSP00000379869; ENSG00000170291. [Q8TE02-1]
ENST00000573657; ENSP00000459633; ENSG00000170291. [Q8TE02-3]
ENST00000574255; ENSP00000461489; ENSG00000170291. [Q8TE02-3]
ENST00000574993; ENSP00000459835; ENSG00000170291. [Q8TE02-2]
GeneIDi23587.
KEGGihsa:23587.
UCSCiuc002gfg.2. human. [Q8TE02-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087868 mRNA. Translation: AAM10496.1.
AB013910 mRNA. Translation: BAB87800.1.
AK289940 mRNA. Translation: BAF82629.1.
AC003688 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90230.1.
CH471108 Genomic DNA. Translation: EAW90231.1.
BC002762 mRNA. Translation: AAH02762.2.
AF070658 mRNA. Translation: AAD20964.1. Different initiation.
AF163262 mRNA. Translation: AAQ13591.1. Different initiation.
AL713741 mRNA. Translation: CAH56280.1.
CCDSiCCDS11094.1. [Q8TE02-1]
CCDS11095.1. [Q8TE02-2]
RefSeqiNP_056177.3. NM_015362.4. [Q8TE02-1]
NP_981958.1. NM_203413.2. [Q8TE02-2]
NP_981959.1. NM_203414.2. [Q8TE02-1]
NP_981960.1. NM_203415.1. [Q8TE02-1]
XP_011522081.1. XM_011523779.2. [Q8TE02-1]
UniGeneiHs.417029.

3D structure databases

ProteinModelPortaliQ8TE02.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117122. 10 interactors.
IntActiQ8TE02. 5 interactors.
MINTiMINT-2856032.
STRINGi9606.ENSP00000346412.

PTM databases

iPTMnetiQ8TE02.
PhosphoSitePlusiQ8TE02.

Polymorphism and mutation databases

BioMutaiELP5.
DMDMi134034093.

Proteomic databases

EPDiQ8TE02.
MaxQBiQ8TE02.
PaxDbiQ8TE02.
PeptideAtlasiQ8TE02.
PRIDEiQ8TE02.

Protocols and materials databases

DNASUi23587.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000354429; ENSP00000346412; ENSG00000170291. [Q8TE02-1]
ENST00000356683; ENSP00000349111; ENSG00000170291. [Q8TE02-2]
ENST00000396627; ENSP00000379868; ENSG00000170291. [Q8TE02-1]
ENST00000396628; ENSP00000379869; ENSG00000170291. [Q8TE02-1]
ENST00000573657; ENSP00000459633; ENSG00000170291. [Q8TE02-3]
ENST00000574255; ENSP00000461489; ENSG00000170291. [Q8TE02-3]
ENST00000574993; ENSP00000459835; ENSG00000170291. [Q8TE02-2]
GeneIDi23587.
KEGGihsa:23587.
UCSCiuc002gfg.2. human. [Q8TE02-1]

Organism-specific databases

CTDi23587.
GeneCardsiELP5.
HGNCiHGNC:30617. ELP5.
HPAiHPA023279.
MIMi615019. gene.
neXtProtiNX_Q8TE02.
OpenTargetsiENSG00000170291.
PharmGKBiPA143485405.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IZJG. Eukaryota.
ENOG411201Y. LUCA.
GeneTreeiENSGT00390000009210.
HOGENOMiHOG000013029.
HOVERGENiHBG081433.
InParanoidiQ8TE02.
OMAiNSRLVYH.
OrthoDBiEOG091G13RW.
PhylomeDBiQ8TE02.
TreeFamiTF314636.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000170291-MONOMER.
ReactomeiR-HSA-3214847. HATs acetylate histones.

Miscellaneous databases

GeneWikiiC17orf81.
GenomeRNAii23587.
PROiQ8TE02.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000170291.
CleanExiHS_C17orf81.
ExpressionAtlasiQ8TE02. baseline and differential.
GenevisibleiQ8TE02. HS.

Family and domain databases

InterProiIPR019519. Elp5.
[Graphical view]
PANTHERiPTHR15641. PTHR15641. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiELP5_HUMAN
AccessioniPrimary (citable) accession number: Q8TE02
Secondary accession number(s): A8K1M5
, D3DTN9, Q659B6, Q7Z2T4, Q8TDR9, Q9BUB2, Q9Y2Q4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 20, 2007
Last modified: November 2, 2016
This is version 102 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

It is uncertain whether Met-1 or Met-17 is the initiator.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.