Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8TE02

- ELP5_HUMAN

UniProt

Q8TE02 - ELP5_HUMAN

Protein

Elongator complex protein 5

Gene

ELP5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 84 (01 Oct 2014)
      Sequence version 2 (20 Mar 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4. Involved in cell migration By similarity. May be involved in TP53-mediated transcriptional regulation.By similarity1 Publication

    GO - Molecular functioni

    1. protein binding Source: IntAct

    GO - Biological processi

    1. chromatin organization Source: Reactome
    2. positive regulation of cell migration Source: UniProtKB
    3. regulation of transcription, DNA-templated Source: UniProtKB-KW
    4. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Biological processi

    Transcription, Transcription regulation

    Enzyme and pathway databases

    ReactomeiREACT_172610. HATs acetylate histones.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Elongator complex protein 5
    Alternative name(s):
    Dermal papilla-derived protein 6
    S-phase 2 protein
    Gene namesi
    Name:ELP5
    Synonyms:C17orf81, DERP6
    ORF Names:HSPC002, MSTP071
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:30617. ELP5.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. Elongator holoenzyme complex Source: UniProtKB
    3. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA143485405.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 316316Elongator complex protein 5PRO_0000280817Add
    BLAST

    Proteomic databases

    MaxQBiQ8TE02.
    PaxDbiQ8TE02.
    PRIDEiQ8TE02.

    PTM databases

    PhosphoSiteiQ8TE02.

    Expressioni

    Tissue specificityi

    Ubiquitously expressed with high levels in heart, brain, liver, skeletal muscle and testis.

    Gene expression databases

    ArrayExpressiQ8TE02.
    BgeeiQ8TE02.
    CleanExiHS_C17orf81.
    GenevestigatoriQ8TE02.

    Organism-specific databases

    HPAiHPA023279.

    Interactioni

    Subunit structurei

    Component of the RNA polymerase II elongator complex (Elongator), which consists of IKBKAP/ELP1, STIP1/ELP2, ELP3, ELP4, ELP5 and ELP6; in the complex, is required for optimal binding of ELP3 to ELP4.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    ATXN1P542532EBI-946189,EBI-930964
    ELP4Q96EB14EBI-946189,EBI-3951755

    Protein-protein interaction databases

    BioGridi117122. 5 interactions.
    IntActiQ8TE02. 5 interactions.
    MINTiMINT-2856032.
    STRINGi9606.ENSP00000346412.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8TE02.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the ELP5 family.Curated

    Phylogenomic databases

    eggNOGiNOG41404.
    HOGENOMiHOG000013029.
    HOVERGENiHBG081433.
    InParanoidiQ8TE02.
    OMAiNSRLVYH.
    OrthoDBiEOG70PBZX.
    PhylomeDBiQ8TE02.
    TreeFamiTF314636.

    Family and domain databases

    InterProiIPR019519. Elp5.
    [Graphical view]
    PfamiPF10483. Elong_Iki1. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8TE02-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTPSEGARAG TGRELEMLDS LLALGGLVLL RDSVEWEGRS LLKALVKKSA    50
    LCGEQVHILG CEVSEEEFRE GFDSDINNRL VYHDFFRDPL NWSKTEEAFP 100
    GGPLGALRAM CKRTDPVPVT IALDSLSWLL LRLPCTTLCQ VLHAVSHQDS 150
    CPGDSSSVGK VSVLGLLHEE LHGPGPVGAL SSLAQTEVTL GGTMGQASAH 200
    ILCRRPRQRP TDQTQWFSIL PDFSLDLQEG PSVESQPYSD PHIPPVDPTT 250
    HLTFNLHLSK KEREARDSLI LPFQFSSEKQ QALLRPRPGQ ATSHIFYEPD 300
    AYDDLDQEDP DDDLDI 316
    Length:316
    Mass (Da):34,841
    Last modified:March 20, 2007 - v2
    Checksum:iC96F86C6B99CE7CE
    GO
    Isoform 2 (identifier: Q8TE02-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         247-316: DPTTHLTFNL...QEDPDDDLDI → SKNAKARTRKCSLVSGHGRENKSCRGWGWGQGF

    Show »
    Length:279
    Mass (Da):30,349
    Checksum:i8178D41F211E8004
    GO
    Isoform 3 (identifier: Q8TE02-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         154-179: DSSSVGKVSVLGLLHEELHGPGPVGA → ETPPSLFPLIHLPLPRSVPLFLSTLE
         180-316: Missing.

    Show »
    Length:179
    Mass (Da):19,719
    Checksum:iD4FD6EDBB859EF3C
    GO
    Isoform 4 (identifier: Q8TE02-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         246-246: V → VHPLYLQV

    Show »
    Length:323
    Mass (Da):35,692
    Checksum:i085D33C458297F9A
    GO

    Sequence cautioni

    The sequence AAD20964.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence AAQ13591.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti151 – 1511C → R in AAM10496. (PubMed:16850183)Curated
    Sequence conflicti175 – 1751G → S in AAM10496. (PubMed:16850183)Curated
    Sequence conflicti181 – 1811S → N in AAM10496. (PubMed:16850183)Curated
    Sequence conflicti228 – 2281Q → K in AAM10496. (PubMed:16850183)Curated
    Sequence conflicti245 – 2451P → R in AAM10496. (PubMed:16850183)Curated
    Isoform 2 (identifier: Q8TE02-2)
    Sequence conflicti263 – 2631H → Q in AAQ13591. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti14 – 141E → K.1 Publication
    Corresponds to variant rs2521988 [ dbSNP | Ensembl ].
    VAR_053882
    Natural varianti303 – 3031D → Y.1 Publication
    Corresponds to variant rs17849664 [ dbSNP | Ensembl ].
    VAR_031205

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei154 – 17926DSSSV…GPVGA → ETPPSLFPLIHLPLPRSVPL FLSTLE in isoform 3. 1 PublicationVSP_023920Add
    BLAST
    Alternative sequencei180 – 316137Missing in isoform 3. 1 PublicationVSP_023921Add
    BLAST
    Alternative sequencei246 – 2461V → VHPLYLQV in isoform 4. 1 PublicationVSP_023922
    Alternative sequencei247 – 31670DPTTH…DDLDI → SKNAKARTRKCSLVSGHGRE NKSCRGWGWGQGF in isoform 2. 2 PublicationsVSP_023923Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF087868 mRNA. Translation: AAM10496.1.
    AB013910 mRNA. Translation: BAB87800.1.
    AK289940 mRNA. Translation: BAF82629.1.
    AC003688 Genomic DNA. No translation available.
    CH471108 Genomic DNA. Translation: EAW90230.1.
    CH471108 Genomic DNA. Translation: EAW90231.1.
    BC002762 mRNA. Translation: AAH02762.2.
    AF070658 mRNA. Translation: AAD20964.1. Different initiation.
    AF163262 mRNA. Translation: AAQ13591.1. Different initiation.
    AL713741 mRNA. Translation: CAH56280.1.
    CCDSiCCDS11094.1. [Q8TE02-1]
    CCDS11095.1. [Q8TE02-2]
    RefSeqiNP_056177.3. NM_015362.4. [Q8TE02-1]
    NP_981958.1. NM_203413.2. [Q8TE02-2]
    NP_981959.1. NM_203414.2. [Q8TE02-1]
    NP_981960.1. NM_203415.1. [Q8TE02-1]
    UniGeneiHs.417029.

    Genome annotation databases

    EnsembliENST00000354429; ENSP00000346412; ENSG00000170291. [Q8TE02-1]
    ENST00000356683; ENSP00000349111; ENSG00000170291. [Q8TE02-2]
    ENST00000396627; ENSP00000379868; ENSG00000170291. [Q8TE02-1]
    ENST00000396628; ENSP00000379869; ENSG00000170291. [Q8TE02-1]
    ENST00000573657; ENSP00000459633; ENSG00000170291. [Q8TE02-3]
    ENST00000574255; ENSP00000461489; ENSG00000170291. [Q8TE02-3]
    ENST00000574993; ENSP00000459835; ENSG00000170291. [Q8TE02-2]
    GeneIDi23587.
    KEGGihsa:23587.
    UCSCiuc002gfg.1. human. [Q8TE02-1]
    uc002gfj.3. human. [Q8TE02-2]
    uc002gfk.1. human. [Q8TE02-3]

    Polymorphism databases

    DMDMi134034093.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF087868 mRNA. Translation: AAM10496.1 .
    AB013910 mRNA. Translation: BAB87800.1 .
    AK289940 mRNA. Translation: BAF82629.1 .
    AC003688 Genomic DNA. No translation available.
    CH471108 Genomic DNA. Translation: EAW90230.1 .
    CH471108 Genomic DNA. Translation: EAW90231.1 .
    BC002762 mRNA. Translation: AAH02762.2 .
    AF070658 mRNA. Translation: AAD20964.1 . Different initiation.
    AF163262 mRNA. Translation: AAQ13591.1 . Different initiation.
    AL713741 mRNA. Translation: CAH56280.1 .
    CCDSi CCDS11094.1. [Q8TE02-1 ]
    CCDS11095.1. [Q8TE02-2 ]
    RefSeqi NP_056177.3. NM_015362.4. [Q8TE02-1 ]
    NP_981958.1. NM_203413.2. [Q8TE02-2 ]
    NP_981959.1. NM_203414.2. [Q8TE02-1 ]
    NP_981960.1. NM_203415.1. [Q8TE02-1 ]
    UniGenei Hs.417029.

    3D structure databases

    ProteinModelPortali Q8TE02.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 117122. 5 interactions.
    IntActi Q8TE02. 5 interactions.
    MINTi MINT-2856032.
    STRINGi 9606.ENSP00000346412.

    PTM databases

    PhosphoSitei Q8TE02.

    Polymorphism databases

    DMDMi 134034093.

    Proteomic databases

    MaxQBi Q8TE02.
    PaxDbi Q8TE02.
    PRIDEi Q8TE02.

    Protocols and materials databases

    DNASUi 23587.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000354429 ; ENSP00000346412 ; ENSG00000170291 . [Q8TE02-1 ]
    ENST00000356683 ; ENSP00000349111 ; ENSG00000170291 . [Q8TE02-2 ]
    ENST00000396627 ; ENSP00000379868 ; ENSG00000170291 . [Q8TE02-1 ]
    ENST00000396628 ; ENSP00000379869 ; ENSG00000170291 . [Q8TE02-1 ]
    ENST00000573657 ; ENSP00000459633 ; ENSG00000170291 . [Q8TE02-3 ]
    ENST00000574255 ; ENSP00000461489 ; ENSG00000170291 . [Q8TE02-3 ]
    ENST00000574993 ; ENSP00000459835 ; ENSG00000170291 . [Q8TE02-2 ]
    GeneIDi 23587.
    KEGGi hsa:23587.
    UCSCi uc002gfg.1. human. [Q8TE02-1 ]
    uc002gfj.3. human. [Q8TE02-2 ]
    uc002gfk.1. human. [Q8TE02-3 ]

    Organism-specific databases

    CTDi 23587.
    GeneCardsi GC17P007154.
    HGNCi HGNC:30617. ELP5.
    HPAi HPA023279.
    MIMi 615019. gene.
    neXtProti NX_Q8TE02.
    PharmGKBi PA143485405.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG41404.
    HOGENOMi HOG000013029.
    HOVERGENi HBG081433.
    InParanoidi Q8TE02.
    OMAi NSRLVYH.
    OrthoDBi EOG70PBZX.
    PhylomeDBi Q8TE02.
    TreeFami TF314636.

    Enzyme and pathway databases

    Reactomei REACT_172610. HATs acetylate histones.

    Miscellaneous databases

    GeneWikii C17orf81.
    GenomeRNAii 23587.
    NextBioi 46212.
    PROi Q8TE02.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8TE02.
    Bgeei Q8TE02.
    CleanExi HS_C17orf81.
    Genevestigatori Q8TE02.

    Family and domain databases

    InterProi IPR019519. Elp5.
    [Graphical view ]
    Pfami PF10483. Elong_Iki1. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of the human gene DERP6, which activates transcriptional activities of p53."
      Yuan J., Tang W., Luo K., Chen X., Gu X., Wan B., Yu L.
      Mol. Biol. Rep. 33:151-158(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION.
    2. "Molecular cloning of a dermal papilla derived gene."
      Ikeda A., Yoshimoto M.
      Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT LYS-14.
      Tissue: Hair follicle dermal papilla.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Hippocampus.
    4. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT TYR-303.
      Tissue: Placenta.
    7. "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
      Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X.
      , Gu J., Chen S.-J., Chen Z.
      Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 10-316 (ISOFORM 3).
      Tissue: Umbilical cord blood.
    8. Zhao B., Xu Y.Y., Liu Y.Q., Wang X.Y., Liu B., Sheng H., Ye J., Song L., Gao Y., Zhang C.L., Zhang J., Gao R.L., Wu Q.Y., Hui R.T.
      Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 24-316 (ISOFORM 2).
      Tissue: Aorta.
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 149-316 (ISOFORM 4).
      Tissue: Amygdala.
    10. "DERP6 (ELP5) and C3ORF75 (ELP6) regulate tumorigenicity and migration of melanoma cells as subunits of Elongator."
      Close P., Gillard M., Ladang A., Jiang Z., Papuga J., Hawkes N., Nguyen L., Chapelle J.P., Bouillenne F., Svejstrup J., Fillet M., Chariot A.
      J. Biol. Chem. 287:32535-32545(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION IN THE RNA POLYMERASE II ELONGATOR COMPLEX, SUBCELLULAR LOCATION, IDENTIFICATION BY MASS SPECTROMETRY.

    Entry informationi

    Entry nameiELP5_HUMAN
    AccessioniPrimary (citable) accession number: Q8TE02
    Secondary accession number(s): A8K1M5
    , D3DTN9, Q659B6, Q7Z2T4, Q8TDR9, Q9BUB2, Q9Y2Q4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 20, 2007
    Last sequence update: March 20, 2007
    Last modified: October 1, 2014
    This is version 84 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Caution

    It is uncertain whether Met-1 or Met-17 is the initiator.Curated

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3