Q8TDZ2 (MICA1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 119.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein-methionine sulfoxide oxidase MICAL1 EC=1.14.13.- Alternative name(s): Molecule interacting with CasL protein 1 Short name=MICAL-1 NEDD9-interacting protein with calponin homology and LIM domains | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1067 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Monooxygenase that promotes depolymerization of F-actin by mediating oxidation of specific methionine residues on actin. Acts by modifying actin subunits through the addition of oxygen to form methionine-sulfoxide, leading to promote actin filament severing and prevent repolymerization Probable. Acts as a cytoskeletal regulator that connects NEDD9 to intermediate filaments. Also acts as a negative regulator of apoptosis via its interaction with STK38 and STK38L; acts by antagonizing STK38 and STK38L activation by MST1/STK4. Ref.12 Ref.14 |
| Catalytic activity | [protein]-methionine + NADPH + O2 = [protein]-methionine-sulfoxide + NADP+ + H2O. |
| Cofactor | FAD. Ref.14 |
| Subunit structure | Interacts with STK38 and STK38L By similarity. Associates with the SH3 domain of NEDD9. Interacts with VIM and PLXNA3. Interacts with RAB1B. Ref.1 Ref.8 Ref.9 Ref.10 |
| Subcellular location | |
| Tissue specificity | Expressed in the thymus, lung, spleen, kidney, testis and hematopoietic cells. Ref.1 |
| Domain | The C-terminal coiled coil part contains the plexin-interacting region. |
| Sequence similarities | Belongs to the Mical family. Contains 1 CH (calponin-homology) domain. Contains 1 LIM zinc-binding domain. |
| Biophysicochemical properties | Kinetic parameters: KM=4.7 µM for F-actin (at saturing NADPH concentration) Ref.14 |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8TDZ2-1) Also known as: MICAL-1a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8TDZ2-2) Also known as: MICAL-1b; The sequence of this isoform differs from the canonical sequence as follows: 312-397: Missing. | ||||||
| Isoform 3 (identifier: Q8TDZ2-3) The sequence of this isoform differs from the canonical sequence as follows: 1-735: Missing. 736-768: YEQHPGDGHFYCLQHLPQTDHKAEGSDRGPESP → MPRLTFAPKGWPHPPTSLHPGQVTDQTTWWLFQ | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q8TDZ2-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MSCLSHSSLPSCCPPQEASM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1067 | 1067 | Protein-methionine sulfoxide oxidase MICAL1 | PRO_0000075842 | |||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||
| Domain | 508 – 609 | 102 | CH | ||||||||||||||||||||||||||||||||||||
| Domain | 695 – 757 | 63 | LIM zinc-binding | ||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 95 – 123 | 29 | FAD By similarity | ||||||||||||||||||||||||||||||||||||
| Region | 1 – 489 | 489 | Monooxygenase domain By similarity | ||||||||||||||||||||||||||||||||||||
| Coiled coil | 646 – 666 | 21 | Potential | ||||||||||||||||||||||||||||||||||||
| Coiled coil | 919 – 962 | 44 | Potential | ||||||||||||||||||||||||||||||||||||
| Coiled coil | 999 – 1027 | 29 | Potential | ||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||
| Binding site | 95 | 1 | FAD By similarity | ||||||||||||||||||||||||||||||||||||
| Binding site | 114 | 1 | FAD By similarity | ||||||||||||||||||||||||||||||||||||
| Binding site | 116 | 1 | FAD By similarity | ||||||||||||||||||||||||||||||||||||
| Binding site | 121 | 1 | FAD By similarity | ||||||||||||||||||||||||||||||||||||
| Binding site | 123 | 1 | FAD By similarity | ||||||||||||||||||||||||||||||||||||
| Binding site | 393 | 1 | FAD By similarity | ||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 617 | 1 | Phosphoserine Ref.13 | ||||||||||||||||||||||||||||||||||||
| Modified residue | 872 | 1 | Phosphoserine Ref.11 Ref.16 | ||||||||||||||||||||||||||||||||||||
| Modified residue | 875 | 1 | Phosphoserine Ref.13 Ref.16 | ||||||||||||||||||||||||||||||||||||
| Modified residue | 876 | 1 | Phosphoserine Ref.13 Ref.16 | ||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 735 | 735 | Missing in isoform 3. | VSP_009637 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MSCLSHSSLPSCCPPQEASM in isoform 4. | VSP_042590 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 312 – 397 | 86 | Missing in isoform 2. | VSP_009639 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 736 – 768 | 33 | YEQHP…GPESP → MPRLTFAPKGWPHPPTSLHP GQVTDQTTWWLFQ in isoform 3. | VSP_009638 | |||||||||||||||||||||||||||||||||||
| Natural variant | 12 | 1 | A → S. Corresponds to variant rs4946977 [ dbSNP | Ensembl ]. | VAR_067063 | |||||||||||||||||||||||||||||||||||
| Natural variant | 12 | 1 | A → T. Corresponds to variant rs4946977 [ dbSNP | Ensembl ]. | VAR_050153 | |||||||||||||||||||||||||||||||||||
| Natural variant | 153 | 1 | D → A. Corresponds to variant rs34726911 [ dbSNP | Ensembl ]. | VAR_050154 | |||||||||||||||||||||||||||||||||||
| Natural variant | 195 | 1 | R → H. Corresponds to variant rs34699467 [ dbSNP | Ensembl ]. | VAR_067064 | |||||||||||||||||||||||||||||||||||
| Natural variant | 309 | 1 | L → M in a breast cancer sample; somatic mutation. Ref.20 | VAR_036191 | |||||||||||||||||||||||||||||||||||
| Natural variant | 453 | 1 | R → C. Ref.6 Corresponds to variant rs17854785 [ dbSNP | Ensembl ]. | VAR_067065 | |||||||||||||||||||||||||||||||||||
| Natural variant | 624 | 1 | A → T. Ref.6 Corresponds to variant rs17850590 [ dbSNP | Ensembl ]. | VAR_067066 | |||||||||||||||||||||||||||||||||||
| Natural variant | 758 | 1 | A → E. Corresponds to variant rs9320288 [ dbSNP | Ensembl ]. | VAR_017903 | |||||||||||||||||||||||||||||||||||
| Natural variant | 758 | 1 | A → K Requires 2 nucleotide substitutions. Ref.1 Ref.3 Ref.6 Corresponds to variant rs35260632 [ dbSNP | Ensembl ]. | VAR_067067 | |||||||||||||||||||||||||||||||||||
| Natural variant | 758 | 1 | A → S. Corresponds to variant rs59056467 [ dbSNP | Ensembl ]. | VAR_067068 | |||||||||||||||||||||||||||||||||||
| Natural variant | 758 | 1 | A → T. Corresponds to variant rs59056467 [ dbSNP | Ensembl ]. | VAR_061355 | |||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 767 | 1 | S → C in BAB15124. Ref.3 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 816 | 1 | L → S in BAH12301. Ref.3 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 877 | 1 | E → V in BAH12301. Ref.3 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 887 | 1 | S → L in CAB59266. Ref.7 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 981 | 1 | K → N in BAB13949. Ref.3 | ||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||
| Helix | 511 – 524 | 14 | |||||||||||||||||||||||||||||||||||||
| Turn | 533 – 538 | 6 | |||||||||||||||||||||||||||||||||||||
| Helix | 541 – 550 | 10 | |||||||||||||||||||||||||||||||||||||
| Helix | 552 – 554 | 3 | |||||||||||||||||||||||||||||||||||||
| Helix | 560 – 562 | 3 | |||||||||||||||||||||||||||||||||||||
| Helix | 565 – 578 | 14 | |||||||||||||||||||||||||||||||||||||
| Helix | 588 – 593 | 6 | |||||||||||||||||||||||||||||||||||||
| Helix | 597 – 610 | 14 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 698 – 700 | 3 | |||||||||||||||||||||||||||||||||||||
| Turn | 706 – 708 | 3 | |||||||||||||||||||||||||||||||||||||
| Turn | 719 – 721 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 725 – 727 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 735 – 737 | 3 | |||||||||||||||||||||||||||||||||||||
| Turn | 740 – 742 | 3 | |||||||||||||||||||||||||||||||||||||
| Turn | 748 – 750 | 3 | |||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "MICAL, a novel CasL interacting molecule, associates with vimentin." Suzuki T., Nakamoto T., Ogawa S., Seo S., Matsumura T., Tachibana K., Morimoto C., Hirai H. J. Biol. Chem. 277:14933-14941(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH NEDD9 AND VIM, VARIANT LYS-758. |
| [2] | "Characterization of long cDNA clones from human adult spleen." Hattori A., Okumura K., Nagase T., Kikuno R., Hirosawa M., Ohara O. DNA Res. 7:357-366(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Spleen. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANTS LYS-758 AND LYS-758. Tissue: Colon mucosa, Embryo, Spleen and Thalamus. |
| [4] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS CYS-453; THR-624 AND LYS-758. Tissue: Blood, Lymph and Uterus. |
| [7] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 422-1067 (ISOFORMS 1/2). Tissue: Testis. |
| [8] | "MICALs, a family of conserved flavoprotein oxidoreductases, function in plexin-mediated axonal repulsion." Terman J.R., Mao T., Pasterkamp R.J., Yu H.-H., Kolodkin A.L. Cell 109:887-900(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PLXNA3. |
| [9] | "MICAL-1 isoforms, novel rab1 interacting proteins." Weide T., Teuber J., Bayer M., Barnekow A. Biochem. Biophys. Res. Commun. 306:79-86(2003) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, INTERACTION WITH VIM. |
| [10] | "The MICAL proteins and rab1: a possible link to the cytoskeleton?" Fischer J., Weide T., Barnekow A. Biochem. Biophys. Res. Commun. 328:415-423(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RAB1B, SUBCELLULAR LOCATION. |
| [11] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-872, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Release of MICAL autoinhibition by semaphorin-plexin signaling promotes interaction with collapsin response mediator protein." Schmidt E.F., Shim S.O., Strittmatter S.M. J. Neurosci. 28:2287-2297(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [13] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-617; SER-875 AND SER-876, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [14] | "Kinetic and spectroscopic characterization of the putative monooxygenase domain of human MICAL-1." Zucchini D., Caprini G., Pasterkamp R.J., Tedeschi G., Vanoni M.A. Arch. Biochem. Biophys. 515:1-13(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, COFACTOR, BIOPHYSICOCHEMICAL PROPERTIES. |
| [15] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [16] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-872; SER-875 AND SER-876, MASS SPECTROMETRY. |
| [17] | "Solution structure of the CH domain of human NEDD9-interacting protein with calponin homology and LIM domains." RIKEN structural genomics initiative (RSGI) Submitted (AUG-2005) to the PDB data bank Cited for: STRUCTURE BY NMR OF 506-613. |
| [18] | "Solution structure of calponin homology domain of Human MICAL-1." Sun H., Dai H., Zhang J., Jin X., Xiong S., Xu J., Wu J., Shi Y. J. Biomol. NMR 36:295-300(2006) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 506-614. |
| [19] | "Investigation of the four cooperative unfolding units existing in the MICAL-1 CH domain." Jin X., Zhang J., Dai H., Sun H., Wang D., Wu J., Shi Y. Biophys. Chem. 129:269-278(2007) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 506-614. |
| [20] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] MET-309. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AB048948 mRNA. Translation: BAB86289.1. AK024500 mRNA. Translation: BAB15790.1. AK021999 mRNA. Translation: BAB13949.1. AK025392 mRNA. Translation: BAB15124.1. AK296284 mRNA. Translation: BAH12301.1. AL109947 Genomic DNA. Translation: CAI23343.1. CH471051 Genomic DNA. Translation: EAW48344.1. CH471051 Genomic DNA. Translation: EAW48345.1. BC009972 mRNA. Translation: AAH09972.2. BC042144 mRNA. Translation: AAH42144.1. BC052983 mRNA. Translation: AAH52983.1. AL122098 mRNA. Translation: CAB59266.1. | ||||||||||||||||||||||||
| IPI | IPI00386301. IPI00647681. IPI01014373. | ||||||||||||||||||||||||
| PIR | T34532. | ||||||||||||||||||||||||
| RefSeq | NP_001152763.1. NM_001159291.1. NP_073602.3. NM_022765.3. | ||||||||||||||||||||||||
| UniGene | Hs.33476. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q8TDZ2. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| MINT | MINT-1343875. | ||||||||||||||||||||||||
| STRING | 9606.ENSP00000351664. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q8TDZ2. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 45593495. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q8TDZ2. | ||||||||||||||||||||||||
| PRIDE | Q8TDZ2. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000358577; ENSP00000351385; ENSG00000135596. ENST00000358807; ENSP00000351664; ENSG00000135596. ENST00000368952; ENSP00000357948; ENSG00000135596. | ||||||||||||||||||||||||
| GeneID | 64780. | ||||||||||||||||||||||||
| KEGG | hsa:64780. | ||||||||||||||||||||||||
| UCSC | uc003ptj.3. human. uc010kdr.3. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 64780. | ||||||||||||||||||||||||
| GeneCards | GC06M109766. | ||||||||||||||||||||||||
| HGNC | HGNC:20619. MICAL1. | ||||||||||||||||||||||||
| HPA | HPA030178. | ||||||||||||||||||||||||
| MIM | 607129. gene. | ||||||||||||||||||||||||
| neXtProt | NX_Q8TDZ2. | ||||||||||||||||||||||||
| PharmGKB | PA134900249. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | COG5069. | ||||||||||||||||||||||||
| HOGENOM | HOG000047263. | ||||||||||||||||||||||||
| HOVERGEN | HBG052474. | ||||||||||||||||||||||||
| InParanoid | Q8TDZ2. | ||||||||||||||||||||||||
| OMA | QEKHGAR. | ||||||||||||||||||||||||
| OrthoDB | EOG4GF3DN. | ||||||||||||||||||||||||
| PhylomeDB | Q8TDZ2. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q8TDZ2. | ||||||||||||||||||||||||
| Bgee | Q8TDZ2. | ||||||||||||||||||||||||
| CleanEx | HS_MICAL1. | ||||||||||||||||||||||||
| Genevestigator | Q8TDZ2. | ||||||||||||||||||||||||
| GermOnline | ENSG00000135596. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| Gene3D | 1.10.418.10. 1 hit. 2.10.110.10. 1 hit. | ||||||||||||||||||||||||
| InterPro | IPR001715. CH-domain. IPR022735. DUF3585. IPR002938. mOase_FAD-bd. IPR001781. Znf_LIM. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF00307. CH. 1 hit. PF12130. DUF3585. 1 hit. PF01494. FAD_binding_3. 1 hit. PF00412. LIM. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SMART | SM00033. CH. 1 hit. SM00132. LIM. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF47576. Calponin-homology. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS50021. CH. 1 hit. PS00478. LIM_DOMAIN_1. 1 hit. PS50023. LIM_DOMAIN_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| ChiTaRS | MICAL1. human. | ||||||||||||||||||||||||
| EvolutionaryTrace | Q8TDZ2. | ||||||||||||||||||||||||
| GenomeRNAi | 64780. | ||||||||||||||||||||||||
| NextBio | 66810. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | MICA1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8TDZ2 Secondary accession number(s): B7Z3R5 Q9UFF7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
