Q8TDQ1 (CLM1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 93.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: CMRF35-like molecule 1 Short name=CLM-1 Alternative name(s): CD300 antigen-like family member F Immune receptor expressed on myeloid cells 1 Short name=IREM-1 Immunoglobulin superfamily member 13 Short name=IgSF13 NK inhibitory receptor CD_antigen=CD300f | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 290 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as an inhibitory receptor for myeloid cells and mast cells. Inhibits osteoclast formation. Ref.2 |
| Subunit structure | Interacts with PTPN6/SHP-1 in a tyrosine phosphorylation dependent manner. Ref.1 Ref.2 |
| Subcellular location | Cell membrane; Single-pass type I membrane protein Potential. |
| Tissue specificity | Highly expressed in spleen, peripheral blood leukocyte and monocyte, and lung. Weakly expressed in thymus, heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, testis, ovary, small intestine or colon. Expressed selectively in monocytes and monocyte-related cells. Ref.1 Ref.2 |
| Post-translational modification | Phosphorylated on tyrosine. Ref.1 |
| Sequence similarities | Belongs to the CD300 family. Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Immunity |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Immunoglobulin domain Signal Transmembrane Transmembrane helix |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8TDQ1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8TDQ1-2) The sequence of this isoform differs from the canonical sequence as follows: 1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ 128-128: A → ASTPAPTTPTSTTFTA 187-221: AAGMSPEQVLQPLEGDLCYADLTLQLAGTSPQKAT → GTAAPGGRPLLCRPDPAAGRNLPAKGYHEAFLCPG 222-290: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8TDQ1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ 150-162: HKLLKLSVLLPLI → YCSPWRATSAMQT 163-290: Missing. | ||||||
| Isoform 4 (identifier: Q8TDQ1-4) The sequence of this isoform differs from the canonical sequence as follows: 1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ 149-191: RHKLLKLSVL...KYQQKAAGMS → SSRDVPRAGT...GYHEAFLCPG 192-290: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q8TDQ1-5) The sequence of this isoform differs from the canonical sequence as follows: 150-244: HKLLKLSVLL...EYVTMASLPK → SEGSQAANYR...GYHEAFLCPG 245-290: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: Q8TDQ1-6) The sequence of this isoform differs from the canonical sequence as follows: 1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 19 | 19 | Ref.8 | ||||||||||||||||||||||||||||||
| Chain | 20 – 290 | 271 | CMRF35-like molecule 1 | PRO_0000247825 | |||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||
| Topological domain | 20 – 156 | 137 | Extracellular Potential | ||||||||||||||||||||||||||||||
| Transmembrane | 157 – 177 | 21 | Helical; Potential | ||||||||||||||||||||||||||||||
| Topological domain | 178 – 290 | 113 | Cytoplasmic Potential | ||||||||||||||||||||||||||||||
| Domain | 20 – 126 | 107 | Ig-like V-type | ||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||
| Site | 205 | 1 | Phosphatase-binding | ||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||
| Glycosylation | 88 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||
| Disulfide bond | 40 ↔ 108 | Ref.9 | |||||||||||||||||||||||||||||||
| Disulfide bond | 54 ↔ 62 | Ref.9 | |||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 14 | 14 | MPLLT…LFWLS → MWLPQLDLMRVISAKSQ in isoform 2, isoform 3, isoform 4 and isoform 6. | VSP_020056 | |||||||||||||||||||||||||||||
| Alternative sequence | 128 | 1 | A → ASTPAPTTPTSTTFTA in isoform 2. | VSP_020057 | |||||||||||||||||||||||||||||
| Alternative sequence | 149 – 191 | 43 | RHKLL…AAGMS → SSRDVPRAGTAAPGGRPLLC RPDPAAGRNLPAKGYHEAFL CPG in isoform 4. | VSP_020058 | |||||||||||||||||||||||||||||
| Alternative sequence | 150 – 244 | 95 | HKLLK…ASLPK → SEGSQAANYRPAAHQAQAPE AQCPPAPHLHHIAAAFGGRL TLGLEDDEVPAESSRDVPRA GTAAPGGRPLLCRPDPAAGR NLPAKGYHEAFLCPG in isoform 5. | VSP_020059 | |||||||||||||||||||||||||||||
| Alternative sequence | 150 – 162 | 13 | HKLLK…LLPLI → YCSPWRATSAMQT in isoform 3. | VSP_020060 | |||||||||||||||||||||||||||||
| Alternative sequence | 163 – 290 | 128 | Missing in isoform 3. | VSP_020061 | |||||||||||||||||||||||||||||
| Alternative sequence | 187 – 221 | 35 | AAGMS…PQKAT → GTAAPGGRPLLCRPDPAAGR NLPAKGYHEAFLCPG in isoform 2. | VSP_020062 | |||||||||||||||||||||||||||||
| Alternative sequence | 192 – 290 | 99 | Missing in isoform 4. | VSP_020063 | |||||||||||||||||||||||||||||
| Alternative sequence | 222 – 290 | 69 | Missing in isoform 2. | VSP_020064 | |||||||||||||||||||||||||||||
| Alternative sequence | 245 – 290 | 46 | Missing in isoform 5. | VSP_020065 | |||||||||||||||||||||||||||||
| Natural variant | 19 | 1 | V → A. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Ref.7 Corresponds to variant rs35489971 [ dbSNP | Ensembl ]. | VAR_039128 | |||||||||||||||||||||||||||||
| Natural variant | 218 | 1 | Q → R. Ref.1 Ref.2 Ref.3 Ref.4 Corresponds to variant rs2034310 [ dbSNP | Ensembl ]. | VAR_027152 | |||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||
| Mutagenesis | 205 | 1 | Y → F: No interaction with PTPN6. Ref.2 | ||||||||||||||||||||||||||||||
| Mutagenesis | 249 | 1 | Y → F: Interaction with PTPN6. Ref.2 | ||||||||||||||||||||||||||||||
| Mutagenesis | 284 | 1 | Y → F: Interaction with PTPN6. Ref.2 | ||||||||||||||||||||||||||||||
| Sequence conflict | 37 | 1 | T → A in AAZ81566. Ref.5 | ||||||||||||||||||||||||||||||
| Sequence conflict | 64 | 1 | I → V in AAZ81566. Ref.5 | ||||||||||||||||||||||||||||||
| Sequence conflict | 78 | 1 | D → N in AAP42153. Ref.2 | ||||||||||||||||||||||||||||||
| Sequence conflict | 135 | 1 | T → I in AAP42152. Ref.2 | ||||||||||||||||||||||||||||||
| Sequence conflict | 138 | 1 | S → F in AAM19099. Ref.1 | ||||||||||||||||||||||||||||||
| Sequence conflict | 212 | 1 | L → Q in AAP42152. Ref.2 | ||||||||||||||||||||||||||||||
| Sequence conflict | 268 | 1 | H → R in AAP57942. Ref.2 | ||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||
| Beta strand | 21 – 23 | 3 | |||||||||||||||||||||||||||||||
| Beta strand | 26 – 31 | 6 | |||||||||||||||||||||||||||||||
| Beta strand | 36 – 42 | 7 | |||||||||||||||||||||||||||||||
| Beta strand | 49 – 59 | 11 | |||||||||||||||||||||||||||||||
| Beta strand | 63 – 67 | 5 | |||||||||||||||||||||||||||||||
| Beta strand | 70 – 72 | 3 | |||||||||||||||||||||||||||||||
| Beta strand | 75 – 77 | 3 | |||||||||||||||||||||||||||||||
| Beta strand | 80 – 85 | 6 | |||||||||||||||||||||||||||||||
| Turn | 86 – 89 | 4 | |||||||||||||||||||||||||||||||
| Beta strand | 90 – 95 | 6 | |||||||||||||||||||||||||||||||
| Helix | 100 – 102 | 3 | |||||||||||||||||||||||||||||||
| Beta strand | 104 – 112 | 9 | |||||||||||||||||||||||||||||||
| Beta strand | 115 – 126 | 12 | |||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "IgSF13, a novel human inhibitory receptor of the immunoglobulin superfamily, is preferentially expressed in dendritic cells and monocytes." Sui L., Li N., Liu Q., Zhang W., Wan T., Wang B., Luo K., Sun H., Cao X. Biochem. Biophys. Res. Commun. 319:920-928(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, INTERACTION WITH PTPN6, PHOSPHORYLATION, VARIANTS ALA-19 AND ARG-218. |
| [2] | "IREM-1 is a novel inhibitory receptor expressed by myeloid cells." Alvarez-Errico D., Aguilar H., Kitzig F., Brckalo T., Sayos J., Lopez-Botet M. Eur. J. Immunol. 34:3690-3701(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 6), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH PTPN6, SITE, MUTAGENESIS OF TYR-205; TYR-249 AND TYR-284, VARIANTS ALA-19 AND ARG-218. |
| [3] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ALA-19 AND ARG-218. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), VARIANTS ALA-19 AND ARG-218. Tissue: Small intestine and Umbilical cord blood. |
| [5] | Lin L., Nong W., Zhou G., Ke R., Shen C., Zhong G., Zheng Z., Liang M., Tang Z., Wen S., Li H., Yang S. Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ALA-19. |
| [6] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT ALA-19. Tissue: Lung. |
| [8] | "Signal peptide prediction based on analysis of experimentally verified cleavage sites." Zhang Z., Henzel W.J. Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 20-34. |
| [9] | "The crystal structure of the extracellular domain of the inhibitor receptor expressed on myeloid cells IREM-1." Marquez J.A., Galfre E., Dupeux F., Flot D., Moran O., Dimasi N. J. Mol. Biol. 367:310-318(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 21-140, DISULFIDE BONDS. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF251706 mRNA. Translation: AAM19099.1. AF375480 mRNA. Translation: AAP42152.1. AF375481 mRNA. Translation: AAP42153.1. AY303545 mRNA. Translation: AAP57942.1. AY358545 mRNA. Translation: AAQ88909.1. AK092757 mRNA. Translation: BAC03966.1. AK315165 mRNA. Translation: BAG37609.1. DQ153249 mRNA. Translation: AAZ81566.1. AC016888 Genomic DNA. No translation available. AC064805 Genomic DNA. No translation available. BC028199 mRNA. Translation: AAH28199.1. | ||||||||||||
| IPI | IPI00167988. IPI00182205. IPI00385550. IPI00419649. IPI00651716. IPI00783431. | ||||||||||||
| RefSeq | NP_620587.2. NM_139018.3. | ||||||||||||
| UniGene | Hs.567706. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q8TDQ1. | ||||||||||||
| SMR | Q8TDQ1. Positions 19-129. | ||||||||||||
| ModBase | Search... | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q8TDQ1. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 296439398. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q8TDQ1. | ||||||||||||
| PRIDE | Q8TDQ1. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 146722. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000301573; ENSP00000301573; ENSG00000186074. ENST00000326165; ENSP00000327075; ENSG00000186074. ENST00000343125; ENSP00000343751; ENSG00000186074. ENST00000361254; ENSP00000355294; ENSG00000186074. ENST00000462044; ENSP00000464223; ENSG00000186074. ENST00000464910; ENSP00000464257; ENSG00000186074. ENST00000469092; ENSP00000463743; ENSG00000186074. ENST00000581500; ENSP00000464610; ENSG00000186074. | ||||||||||||
| GeneID | 146722. | ||||||||||||
| KEGG | hsa:146722. | ||||||||||||
| UCSC | uc002jlf.3. human. uc002jlg.3. human. uc002jlh.3. human. uc002jli.3. human. uc002jlj.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 146722. | ||||||||||||
| GeneCards | GC17M072690. | ||||||||||||
| H-InvDB | HIX0021633. | ||||||||||||
| HGNC | HGNC:29883. CD300LF. | ||||||||||||
| HPA | HPA013712. | ||||||||||||
| MIM | 609807. gene. | ||||||||||||
| neXtProt | NX_Q8TDQ1. | ||||||||||||
| PharmGKB | PA142672153. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG75577. | ||||||||||||
| HOVERGEN | HBG050999. | ||||||||||||
| InParanoid | Q8TDQ1. | ||||||||||||
| OMA | PQLDLMR. | ||||||||||||
| OrthoDB | EOG479F8P. | ||||||||||||
Gene expression databases | |||||||||||||
| Bgee | Q8TDQ1. | ||||||||||||
| Genevestigator | Q8TDQ1. | ||||||||||||
| GermOnline | ENSG00000186074. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 2.60.40.10. 1 hit. | ||||||||||||
| InterPro | IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR003599. Ig_sub. IPR013106. Ig_V-set. [Graphical view] | ||||||||||||
| Pfam | PF07686. V-set. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00409. IG. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50835. IG_LIKE. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q8TDQ1. | ||||||||||||
| GenomeRNAi | 146722. | ||||||||||||
| NextBio | 85431. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | CLM1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8TDQ1 Secondary accession number(s): B2RCL2 Q8NAF5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
