Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8TDQ1

- CLM1_HUMAN

UniProt

Q8TDQ1 - CLM1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

CMRF35-like molecule 1

Gene

CD300LF

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Acts as an inhibitory receptor for myeloid cells and mast cells. Inhibits osteoclast formation.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei205 – 2051Phosphatase-binding

GO - Biological processi

  1. immune system process Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Immunity

Names & Taxonomyi

Protein namesi
Recommended name:
CMRF35-like molecule 1
Short name:
CLM-1
Alternative name(s):
CD300 antigen-like family member F
Immune receptor expressed on myeloid cells 1
Short name:
IREM-1
Immunoglobulin superfamily member 13
Short name:
IgSF13
NK inhibitory receptor
CD_antigen: CD300f
Gene namesi
Name:CD300LF
Synonyms:CD300F, CLM1, IGSF13, IREM1, NKIR
ORF Names:UNQ3105/PRO10111
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:29883. CD300LF.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini20 – 156137ExtracellularSequence AnalysisAdd
BLAST
Transmembranei157 – 17721HelicalSequence AnalysisAdd
BLAST
Topological domaini178 – 290113CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi205 – 2051Y → F: No interaction with PTPN6. 1 Publication
Mutagenesisi249 – 2491Y → F: Interaction with PTPN6. 1 Publication
Mutagenesisi284 – 2841Y → F: Interaction with PTPN6. 1 Publication

Organism-specific databases

PharmGKBiPA142672153.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 19191 PublicationAdd
BLAST
Chaini20 – 290271CMRF35-like molecule 1PRO_0000247825Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi40 ↔ 1081 PublicationPROSITE-ProRule annotation
Disulfide bondi54 ↔ 621 PublicationPROSITE-ProRule annotation
Glycosylationi88 – 881N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

Phosphorylated on tyrosine.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ8TDQ1.
PRIDEiQ8TDQ1.

PTM databases

PhosphoSiteiQ8TDQ1.

Expressioni

Tissue specificityi

Highly expressed in spleen, peripheral blood leukocyte and monocyte, and lung. Weakly expressed in thymus, heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, testis, ovary, small intestine or colon. Expressed selectively in monocytes and monocyte-related cells.2 Publications

Gene expression databases

BgeeiQ8TDQ1.
ExpressionAtlasiQ8TDQ1. baseline and differential.
GenevestigatoriQ8TDQ1.

Organism-specific databases

HPAiHPA013712.

Interactioni

Subunit structurei

Interacts with PTPN6/SHP-1 in a tyrosine phosphorylation dependent manner.2 Publications

Protein-protein interaction databases

BioGridi127005. 1 interaction.
IntActiQ8TDQ1. 1 interaction.
MINTiMINT-8020158.

Structurei

Secondary structure

1
290
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi21 – 233Combined sources
Beta strandi26 – 316Combined sources
Beta strandi36 – 427Combined sources
Beta strandi49 – 5911Combined sources
Beta strandi63 – 675Combined sources
Beta strandi70 – 723Combined sources
Beta strandi75 – 773Combined sources
Beta strandi80 – 856Combined sources
Turni86 – 894Combined sources
Beta strandi90 – 956Combined sources
Helixi100 – 1023Combined sources
Beta strandi104 – 1129Combined sources
Beta strandi115 – 12612Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2NMSX-ray2.60A21-140[»]
ProteinModelPortaliQ8TDQ1.
SMRiQ8TDQ1. Positions 19-129.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8TDQ1.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini20 – 126107Ig-like V-typeAdd
BLAST

Sequence similaritiesi

Belongs to the CD300 family.Curated

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG75577.
GeneTreeiENSGT00470000042273.
HOVERGENiHBG050999.
InParanoidiQ8TDQ1.
OMAiWRATSAM.
OrthoDBiEOG78PVBM.
PhylomeDBiQ8TDQ1.
TreeFamiTF334441.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8TDQ1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPLLTLYLLL FWLSGYSIVT QITGPTTVNG LERGSLTVQC VYRSGWETYL
60 70 80 90 100
KWWCRGAIWR DCKILVKTSG SEQEVKRDRV SIKDNQKNRT FTVTMEDLMK
110 120 130 140 150
TDADTYWCGI EKTGNDLGVT VQVTIDPAPV TQEETSSSPT LTGHHLDNRH
160 170 180 190 200
KLLKLSVLLP LIFTILLLLL VAASLLAWRM MKYQQKAAGM SPEQVLQPLE
210 220 230 240 250
GDLCYADLTL QLAGTSPQKA TTKLSSAQVD QVEVEYVTMA SLPKEDISYA
260 270 280 290
SLTLGAEDQE PTYCNMGHLS SHLPGRGPEE PTEYSTISRP
Length:290
Mass (Da):32,335
Last modified:May 18, 2010 - v3
Checksum:i27AA95664B82B945
GO
Isoform 2 (identifier: Q8TDQ1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ
     128-128: A → ASTPAPTTPTSTTFTA
     187-221: AAGMSPEQVLQPLEGDLCYADLTLQLAGTSPQKAT → GTAAPGGRPLLCRPDPAAGRNLPAKGYHEAFLCPG
     222-290: Missing.

Note: No experimental confirmation available.

Show »
Length:239
Mass (Da):26,480
Checksum:iC67579996CFFA382
GO
Isoform 3 (identifier: Q8TDQ1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ
     150-162: HKLLKLSVLLPLI → YCSPWRATSAMQT
     163-290: Missing.

Show »
Length:165
Mass (Da):18,684
Checksum:i8D46CA836B7E8AAE
GO
Isoform 4 (identifier: Q8TDQ1-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ
     149-191: RHKLLKLSVL...KYQQKAAGMS → SSRDVPRAGT...GYHEAFLCPG
     192-290: Missing.

Note: No experimental confirmation available.

Show »
Length:194
Mass (Da):21,427
Checksum:i9274E383F4A98236
GO
Isoform 5 (identifier: Q8TDQ1-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-244: HKLLKLSVLL...EYVTMASLPK → SEGSQAANYR...GYHEAFLCPG
     245-290: Missing.

Note: No experimental confirmation available.

Show »
Length:244
Mass (Da):26,671
Checksum:i8CB8B81FCB47821A
GO
Isoform 6 (identifier: Q8TDQ1-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ

Show »
Length:293
Mass (Da):32,628
Checksum:iC8AC14CA781BCFC4
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti37 – 371T → A in AAZ81566. 1 PublicationCurated
Sequence conflicti64 – 641I → V in AAZ81566. 1 PublicationCurated
Sequence conflicti78 – 781D → N in AAP42153. (PubMed:15549731)Curated
Sequence conflicti135 – 1351T → I in AAP42152. (PubMed:15549731)Curated
Sequence conflicti138 – 1381S → F in AAM19099. (PubMed:15184070)Curated
Sequence conflicti212 – 2121L → Q in AAP42152. (PubMed:15549731)Curated
Sequence conflicti268 – 2681H → R in AAP57942. (PubMed:15549731)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti19 – 191V → A.6 Publications
Corresponds to variant rs35489971 [ dbSNP | Ensembl ].
VAR_039128
Natural varianti218 – 2181Q → R.4 Publications
Corresponds to variant rs2034310 [ dbSNP | Ensembl ].
VAR_027152

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1414MPLLT…LFWLS → MWLPQLDLMRVISAKSQ in isoform 2, isoform 3, isoform 4 and isoform 6. 3 PublicationsVSP_020056Add
BLAST
Alternative sequencei128 – 1281A → ASTPAPTTPTSTTFTA in isoform 2. 1 PublicationVSP_020057
Alternative sequencei149 – 19143RHKLL…AAGMS → SSRDVPRAGTAAPGGRPLLC RPDPAAGRNLPAKGYHEAFL CPG in isoform 4. 1 PublicationVSP_020058Add
BLAST
Alternative sequencei150 – 24495HKLLK…ASLPK → SEGSQAANYRPAAHQAQAPE AQCPPAPHLHHIAAAFGGRL TLGLEDDEVPAESSRDVPRA GTAAPGGRPLLCRPDPAAGR NLPAKGYHEAFLCPG in isoform 5. 1 PublicationVSP_020059Add
BLAST
Alternative sequencei150 – 16213HKLLK…LLPLI → YCSPWRATSAMQT in isoform 3. 1 PublicationVSP_020060Add
BLAST
Alternative sequencei163 – 290128Missing in isoform 3. 1 PublicationVSP_020061Add
BLAST
Alternative sequencei187 – 22135AAGMS…PQKAT → GTAAPGGRPLLCRPDPAAGR NLPAKGYHEAFLCPG in isoform 2. 1 PublicationVSP_020062Add
BLAST
Alternative sequencei192 – 29099Missing in isoform 4. 1 PublicationVSP_020063Add
BLAST
Alternative sequencei222 – 29069Missing in isoform 2. 1 PublicationVSP_020064Add
BLAST
Alternative sequencei245 – 29046Missing in isoform 5. 1 PublicationVSP_020065Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF251706 mRNA. Translation: AAM19099.1.
AF375480 mRNA. Translation: AAP42152.1.
AF375481 mRNA. Translation: AAP42153.1.
AY303545 mRNA. Translation: AAP57942.1.
AY358545 mRNA. Translation: AAQ88909.1.
AK092757 mRNA. Translation: BAC03966.1.
AK315165 mRNA. Translation: BAG37609.1.
DQ153249 mRNA. Translation: AAZ81566.1.
AC016888 Genomic DNA. No translation available.
AC064805 Genomic DNA. No translation available.
BC028199 mRNA. Translation: AAH28199.1.
CCDSiCCDS11704.1. [Q8TDQ1-1]
CCDS74148.1. [Q8TDQ1-4]
CCDS74149.1. [Q8TDQ1-6]
CCDS74150.1. [Q8TDQ1-2]
CCDS74151.1. [Q8TDQ1-5]
RefSeqiNP_001276011.1. NM_001289082.1. [Q8TDQ1-4]
NP_001276012.1. NM_001289083.1. [Q8TDQ1-5]
NP_001276013.1. NM_001289084.1.
NP_001276014.1. NM_001289085.1. [Q8TDQ1-6]
NP_001276015.1. NM_001289086.1. [Q8TDQ1-2]
NP_001276016.1. NM_001289087.1.
NP_620587.2. NM_139018.4. [Q8TDQ1-1]
UniGeneiHs.567706.

Genome annotation databases

EnsembliENST00000301573; ENSP00000301573; ENSG00000186074. [Q8TDQ1-5]
ENST00000326165; ENSP00000327075; ENSG00000186074. [Q8TDQ1-1]
ENST00000343125; ENSP00000343751; ENSG00000186074. [Q8TDQ1-4]
ENST00000361254; ENSP00000355294; ENSG00000186074. [Q8TDQ1-2]
ENST00000462044; ENSP00000464223; ENSG00000186074. [Q8TDQ1-3]
ENST00000464910; ENSP00000464257; ENSG00000186074. [Q8TDQ1-6]
ENST00000469092; ENSP00000463743; ENSG00000186074. [Q8TDQ1-4]
ENST00000581500; ENSP00000464610; ENSG00000186074. [Q8TDQ1-2]
GeneIDi146722.
KEGGihsa:146722.
UCSCiuc002jlf.3. human. [Q8TDQ1-6]
uc002jlg.3. human. [Q8TDQ1-1]
uc002jlh.3. human. [Q8TDQ1-5]
uc002jli.3. human. [Q8TDQ1-4]
uc002jlj.1. human. [Q8TDQ1-2]

Polymorphism databases

DMDMi296439398.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF251706 mRNA. Translation: AAM19099.1 .
AF375480 mRNA. Translation: AAP42152.1 .
AF375481 mRNA. Translation: AAP42153.1 .
AY303545 mRNA. Translation: AAP57942.1 .
AY358545 mRNA. Translation: AAQ88909.1 .
AK092757 mRNA. Translation: BAC03966.1 .
AK315165 mRNA. Translation: BAG37609.1 .
DQ153249 mRNA. Translation: AAZ81566.1 .
AC016888 Genomic DNA. No translation available.
AC064805 Genomic DNA. No translation available.
BC028199 mRNA. Translation: AAH28199.1 .
CCDSi CCDS11704.1. [Q8TDQ1-1 ]
CCDS74148.1. [Q8TDQ1-4 ]
CCDS74149.1. [Q8TDQ1-6 ]
CCDS74150.1. [Q8TDQ1-2 ]
CCDS74151.1. [Q8TDQ1-5 ]
RefSeqi NP_001276011.1. NM_001289082.1. [Q8TDQ1-4 ]
NP_001276012.1. NM_001289083.1. [Q8TDQ1-5 ]
NP_001276013.1. NM_001289084.1.
NP_001276014.1. NM_001289085.1. [Q8TDQ1-6 ]
NP_001276015.1. NM_001289086.1. [Q8TDQ1-2 ]
NP_001276016.1. NM_001289087.1.
NP_620587.2. NM_139018.4. [Q8TDQ1-1 ]
UniGenei Hs.567706.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2NMS X-ray 2.60 A 21-140 [» ]
ProteinModelPortali Q8TDQ1.
SMRi Q8TDQ1. Positions 19-129.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 127005. 1 interaction.
IntActi Q8TDQ1. 1 interaction.
MINTi MINT-8020158.

PTM databases

PhosphoSitei Q8TDQ1.

Polymorphism databases

DMDMi 296439398.

Proteomic databases

PaxDbi Q8TDQ1.
PRIDEi Q8TDQ1.

Protocols and materials databases

DNASUi 146722.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000301573 ; ENSP00000301573 ; ENSG00000186074 . [Q8TDQ1-5 ]
ENST00000326165 ; ENSP00000327075 ; ENSG00000186074 . [Q8TDQ1-1 ]
ENST00000343125 ; ENSP00000343751 ; ENSG00000186074 . [Q8TDQ1-4 ]
ENST00000361254 ; ENSP00000355294 ; ENSG00000186074 . [Q8TDQ1-2 ]
ENST00000462044 ; ENSP00000464223 ; ENSG00000186074 . [Q8TDQ1-3 ]
ENST00000464910 ; ENSP00000464257 ; ENSG00000186074 . [Q8TDQ1-6 ]
ENST00000469092 ; ENSP00000463743 ; ENSG00000186074 . [Q8TDQ1-4 ]
ENST00000581500 ; ENSP00000464610 ; ENSG00000186074 . [Q8TDQ1-2 ]
GeneIDi 146722.
KEGGi hsa:146722.
UCSCi uc002jlf.3. human. [Q8TDQ1-6 ]
uc002jlg.3. human. [Q8TDQ1-1 ]
uc002jlh.3. human. [Q8TDQ1-5 ]
uc002jli.3. human. [Q8TDQ1-4 ]
uc002jlj.1. human. [Q8TDQ1-2 ]

Organism-specific databases

CTDi 146722.
GeneCardsi GC17M072690.
H-InvDB HIX0021633.
HGNCi HGNC:29883. CD300LF.
HPAi HPA013712.
MIMi 609807. gene.
neXtProti NX_Q8TDQ1.
PharmGKBi PA142672153.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG75577.
GeneTreei ENSGT00470000042273.
HOVERGENi HBG050999.
InParanoidi Q8TDQ1.
OMAi WRATSAM.
OrthoDBi EOG78PVBM.
PhylomeDBi Q8TDQ1.
TreeFami TF334441.

Miscellaneous databases

EvolutionaryTracei Q8TDQ1.
GeneWikii CD300LF.
GenomeRNAii 146722.
NextBioi 85431.
PROi Q8TDQ1.
SOURCEi Search...

Gene expression databases

Bgeei Q8TDQ1.
ExpressionAtlasi Q8TDQ1. baseline and differential.
Genevestigatori Q8TDQ1.

Family and domain databases

Gene3Di 2.60.40.10. 1 hit.
InterProi IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view ]
Pfami PF07686. V-set. 1 hit.
[Graphical view ]
SMARTi SM00409. IG. 1 hit.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "IgSF13, a novel human inhibitory receptor of the immunoglobulin superfamily, is preferentially expressed in dendritic cells and monocytes."
    Sui L., Li N., Liu Q., Zhang W., Wan T., Wang B., Luo K., Sun H., Cao X.
    Biochem. Biophys. Res. Commun. 319:920-928(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, INTERACTION WITH PTPN6, PHOSPHORYLATION, VARIANTS ALA-19 AND ARG-218.
  2. "IREM-1 is a novel inhibitory receptor expressed by myeloid cells."
    Alvarez-Errico D., Aguilar H., Kitzig F., Brckalo T., Sayos J., Lopez-Botet M.
    Eur. J. Immunol. 34:3690-3701(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 6), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH PTPN6, SITE, MUTAGENESIS OF TYR-205; TYR-249 AND TYR-284, VARIANTS ALA-19 AND ARG-218.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ALA-19 AND ARG-218.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), VARIANTS ALA-19 AND ARG-218.
    Tissue: Small intestine and Umbilical cord blood.
  5. Lin L., Nong W., Zhou G., Ke R., Shen C., Zhong G., Zheng Z., Liang M., Tang Z., Wen S., Li H., Yang S.
    Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ALA-19.
  6. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT ALA-19.
    Tissue: Lung.
  8. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
    Zhang Z., Henzel W.J.
    Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 20-34.
  9. "The crystal structure of the extracellular domain of the inhibitor receptor expressed on myeloid cells IREM-1."
    Marquez J.A., Galfre E., Dupeux F., Flot D., Moran O., Dimasi N.
    J. Mol. Biol. 367:310-318(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 21-140, DISULFIDE BONDS.

Entry informationi

Entry nameiCLM1_HUMAN
AccessioniPrimary (citable) accession number: Q8TDQ1
Secondary accession number(s): B2RCL2
, C9JDN3, Q3Y6P0, Q6UX24, Q7Z6A6, Q7Z7I4, Q7Z7I5, Q8N6D0, Q8NAF5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: May 18, 2010
Last modified: November 26, 2014
This is version 107 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3