Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CMRF35-like molecule 1

Gene

CD300LF

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as an inhibitory receptor for myeloid cells and mast cells. Inhibits osteoclast formation.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei205Phosphatase-binding1

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Immunity

Enzyme and pathway databases

ReactomeiR-HSA-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

Names & Taxonomyi

Protein namesi
Recommended name:
CMRF35-like molecule 1
Short name:
CLM-1
Alternative name(s):
CD300 antigen-like family member F
Immune receptor expressed on myeloid cells 1
Short name:
IREM-1
Immunoglobulin superfamily member 13
Short name:
IgSF13
NK inhibitory receptor
CD_antigen: CD300f
Gene namesi
Name:CD300LF
Synonyms:CD300F, CLM1, IGSF13, IREM1, NKIR
ORF Names:UNQ3105/PRO10111
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:29883. CD300LF.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini20 – 156ExtracellularSequence analysisAdd BLAST137
Transmembranei157 – 177HelicalSequence analysisAdd BLAST21
Topological domaini178 – 290CytoplasmicSequence analysisAdd BLAST113

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi205Y → F: No interaction with PTPN6. 1 Publication1
Mutagenesisi249Y → F: Interaction with PTPN6. 1 Publication1
Mutagenesisi284Y → F: Interaction with PTPN6. 1 Publication1

Organism-specific databases

DisGeNETi146722.
OpenTargetsiENSG00000186074.
PharmGKBiPA142672153.

Polymorphism and mutation databases

BioMutaiCD300LF.
DMDMi296439398.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 191 PublicationAdd BLAST19
ChainiPRO_000024782520 – 290CMRF35-like molecule 1Add BLAST271

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi40 ↔ 108PROSITE-ProRule annotation1 Publication
Disulfide bondi54 ↔ 62PROSITE-ProRule annotation1 Publication
Glycosylationi88N-linked (GlcNAc...)Sequence analysis1

Post-translational modificationi

Phosphorylated on tyrosine.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ8TDQ1.
PeptideAtlasiQ8TDQ1.
PRIDEiQ8TDQ1.
TopDownProteomicsiQ8TDQ1-4. [Q8TDQ1-4]

PTM databases

iPTMnetiQ8TDQ1.
PhosphoSitePlusiQ8TDQ1.

Expressioni

Tissue specificityi

Highly expressed in spleen, peripheral blood leukocyte and monocyte, and lung. Weakly expressed in thymus, heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, testis, ovary, small intestine or colon. Expressed selectively in monocytes and monocyte-related cells.2 Publications

Gene expression databases

BgeeiENSG00000186074.
ExpressionAtlasiQ8TDQ1. baseline and differential.
GenevisibleiQ8TDQ1. HS.

Interactioni

Subunit structurei

Interacts with PTPN6/SHP-1 in a tyrosine phosphorylation dependent manner.2 Publications

Protein-protein interaction databases

BioGridi127005. 1 interactor.
IntActiQ8TDQ1. 1 interactor.
MINTiMINT-8020158.
STRINGi9606.ENSP00000327075.

Structurei

Secondary structure

1290
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi21 – 23Combined sources3
Beta strandi26 – 31Combined sources6
Beta strandi36 – 42Combined sources7
Beta strandi49 – 59Combined sources11
Beta strandi63 – 67Combined sources5
Beta strandi70 – 72Combined sources3
Beta strandi75 – 77Combined sources3
Beta strandi80 – 85Combined sources6
Turni86 – 89Combined sources4
Beta strandi90 – 95Combined sources6
Helixi100 – 102Combined sources3
Beta strandi104 – 112Combined sources9
Beta strandi115 – 126Combined sources12

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2NMSX-ray2.60A21-140[»]
ProteinModelPortaliQ8TDQ1.
SMRiQ8TDQ1.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8TDQ1.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini20 – 126Ig-like V-typeAdd BLAST107

Sequence similaritiesi

Belongs to the CD300 family.Curated

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IZ4I. Eukaryota.
ENOG410YT8T. LUCA.
GeneTreeiENSGT00470000042273.
HOVERGENiHBG050999.
InParanoidiQ8TDQ1.
KOiK20395.
PhylomeDBiQ8TDQ1.
TreeFamiTF334441.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TDQ1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPLLTLYLLL FWLSGYSIVT QITGPTTVNG LERGSLTVQC VYRSGWETYL
60 70 80 90 100
KWWCRGAIWR DCKILVKTSG SEQEVKRDRV SIKDNQKNRT FTVTMEDLMK
110 120 130 140 150
TDADTYWCGI EKTGNDLGVT VQVTIDPAPV TQEETSSSPT LTGHHLDNRH
160 170 180 190 200
KLLKLSVLLP LIFTILLLLL VAASLLAWRM MKYQQKAAGM SPEQVLQPLE
210 220 230 240 250
GDLCYADLTL QLAGTSPQKA TTKLSSAQVD QVEVEYVTMA SLPKEDISYA
260 270 280 290
SLTLGAEDQE PTYCNMGHLS SHLPGRGPEE PTEYSTISRP
Length:290
Mass (Da):32,335
Last modified:May 18, 2010 - v3
Checksum:i27AA95664B82B945
GO
Isoform 2 (identifier: Q8TDQ1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ
     128-128: A → ASTPAPTTPTSTTFTA
     187-221: AAGMSPEQVLQPLEGDLCYADLTLQLAGTSPQKAT → GTAAPGGRPLLCRPDPAAGRNLPAKGYHEAFLCPG
     222-290: Missing.

Note: No experimental confirmation available.
Show »
Length:239
Mass (Da):26,480
Checksum:iC67579996CFFA382
GO
Isoform 3 (identifier: Q8TDQ1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ
     150-162: HKLLKLSVLLPLI → YCSPWRATSAMQT
     163-290: Missing.

Show »
Length:165
Mass (Da):18,684
Checksum:i8D46CA836B7E8AAE
GO
Isoform 4 (identifier: Q8TDQ1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ
     149-191: RHKLLKLSVL...KYQQKAAGMS → SSRDVPRAGT...GYHEAFLCPG
     192-290: Missing.

Note: No experimental confirmation available.
Show »
Length:194
Mass (Da):21,427
Checksum:i9274E383F4A98236
GO
Isoform 5 (identifier: Q8TDQ1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-244: HKLLKLSVLL...EYVTMASLPK → SEGSQAANYR...GYHEAFLCPG
     245-290: Missing.

Note: No experimental confirmation available.
Show »
Length:244
Mass (Da):26,671
Checksum:i8CB8B81FCB47821A
GO
Isoform 6 (identifier: Q8TDQ1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ

Show »
Length:293
Mass (Da):32,628
Checksum:iC8AC14CA781BCFC4
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti37T → A in AAZ81566 (Ref. 5) Curated1
Sequence conflicti64I → V in AAZ81566 (Ref. 5) Curated1
Sequence conflicti78D → N in AAP42153 (PubMed:15549731).Curated1
Sequence conflicti135T → I in AAP42152 (PubMed:15549731).Curated1
Sequence conflicti138S → F in AAM19099 (PubMed:15184070).Curated1
Sequence conflicti212L → Q in AAP42152 (PubMed:15549731).Curated1
Sequence conflicti268H → R in AAP57942 (PubMed:15549731).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03912819V → A.6 PublicationsCorresponds to variant rs35489971dbSNPEnsembl.1
Natural variantiVAR_027152218Q → R.4 PublicationsCorresponds to variant rs2034310dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0200561 – 14MPLLT…LFWLS → MWLPQLDLMRVISAKSQ in isoform 2, isoform 3, isoform 4 and isoform 6. 3 PublicationsAdd BLAST14
Alternative sequenceiVSP_020057128A → ASTPAPTTPTSTTFTA in isoform 2. 1 Publication1
Alternative sequenceiVSP_020058149 – 191RHKLL…AAGMS → SSRDVPRAGTAAPGGRPLLC RPDPAAGRNLPAKGYHEAFL CPG in isoform 4. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_020059150 – 244HKLLK…ASLPK → SEGSQAANYRPAAHQAQAPE AQCPPAPHLHHIAAAFGGRL TLGLEDDEVPAESSRDVPRA GTAAPGGRPLLCRPDPAAGR NLPAKGYHEAFLCPG in isoform 5. 1 PublicationAdd BLAST95
Alternative sequenceiVSP_020060150 – 162HKLLK…LLPLI → YCSPWRATSAMQT in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_020061163 – 290Missing in isoform 3. 1 PublicationAdd BLAST128
Alternative sequenceiVSP_020062187 – 221AAGMS…PQKAT → GTAAPGGRPLLCRPDPAAGR NLPAKGYHEAFLCPG in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_020063192 – 290Missing in isoform 4. 1 PublicationAdd BLAST99
Alternative sequenceiVSP_020064222 – 290Missing in isoform 2. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_020065245 – 290Missing in isoform 5. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF251706 mRNA. Translation: AAM19099.1.
AF375480 mRNA. Translation: AAP42152.1.
AF375481 mRNA. Translation: AAP42153.1.
AY303545 mRNA. Translation: AAP57942.1.
AY358545 mRNA. Translation: AAQ88909.1.
AK092757 mRNA. Translation: BAC03966.1.
AK315165 mRNA. Translation: BAG37609.1.
DQ153249 mRNA. Translation: AAZ81566.1.
AC016888 Genomic DNA. No translation available.
AC064805 Genomic DNA. No translation available.
BC028199 mRNA. Translation: AAH28199.1.
CCDSiCCDS11704.1. [Q8TDQ1-1]
CCDS74148.1. [Q8TDQ1-4]
CCDS74149.1. [Q8TDQ1-6]
CCDS74150.1. [Q8TDQ1-2]
CCDS74151.1. [Q8TDQ1-5]
RefSeqiNP_001276011.1. NM_001289082.1. [Q8TDQ1-4]
NP_001276012.1. NM_001289083.1. [Q8TDQ1-5]
NP_001276013.1. NM_001289084.1.
NP_001276014.1. NM_001289085.1. [Q8TDQ1-6]
NP_001276015.1. NM_001289086.1. [Q8TDQ1-2]
NP_001276016.1. NM_001289087.1.
NP_620587.2. NM_139018.4. [Q8TDQ1-1]
UniGeneiHs.567706.

Genome annotation databases

EnsembliENST00000301573; ENSP00000301573; ENSG00000186074. [Q8TDQ1-5]
ENST00000326165; ENSP00000327075; ENSG00000186074. [Q8TDQ1-1]
ENST00000343125; ENSP00000343751; ENSG00000186074. [Q8TDQ1-4]
ENST00000361254; ENSP00000355294; ENSG00000186074. [Q8TDQ1-2]
ENST00000462044; ENSP00000464223; ENSG00000186074. [Q8TDQ1-3]
ENST00000464910; ENSP00000464257; ENSG00000186074. [Q8TDQ1-6]
ENST00000469092; ENSP00000463743; ENSG00000186074. [Q8TDQ1-4]
ENST00000581500; ENSP00000464610; ENSG00000186074. [Q8TDQ1-2]
GeneIDi146722.
KEGGihsa:146722.
UCSCiuc002jlg.5. human. [Q8TDQ1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF251706 mRNA. Translation: AAM19099.1.
AF375480 mRNA. Translation: AAP42152.1.
AF375481 mRNA. Translation: AAP42153.1.
AY303545 mRNA. Translation: AAP57942.1.
AY358545 mRNA. Translation: AAQ88909.1.
AK092757 mRNA. Translation: BAC03966.1.
AK315165 mRNA. Translation: BAG37609.1.
DQ153249 mRNA. Translation: AAZ81566.1.
AC016888 Genomic DNA. No translation available.
AC064805 Genomic DNA. No translation available.
BC028199 mRNA. Translation: AAH28199.1.
CCDSiCCDS11704.1. [Q8TDQ1-1]
CCDS74148.1. [Q8TDQ1-4]
CCDS74149.1. [Q8TDQ1-6]
CCDS74150.1. [Q8TDQ1-2]
CCDS74151.1. [Q8TDQ1-5]
RefSeqiNP_001276011.1. NM_001289082.1. [Q8TDQ1-4]
NP_001276012.1. NM_001289083.1. [Q8TDQ1-5]
NP_001276013.1. NM_001289084.1.
NP_001276014.1. NM_001289085.1. [Q8TDQ1-6]
NP_001276015.1. NM_001289086.1. [Q8TDQ1-2]
NP_001276016.1. NM_001289087.1.
NP_620587.2. NM_139018.4. [Q8TDQ1-1]
UniGeneiHs.567706.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2NMSX-ray2.60A21-140[»]
ProteinModelPortaliQ8TDQ1.
SMRiQ8TDQ1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127005. 1 interactor.
IntActiQ8TDQ1. 1 interactor.
MINTiMINT-8020158.
STRINGi9606.ENSP00000327075.

PTM databases

iPTMnetiQ8TDQ1.
PhosphoSitePlusiQ8TDQ1.

Polymorphism and mutation databases

BioMutaiCD300LF.
DMDMi296439398.

Proteomic databases

PaxDbiQ8TDQ1.
PeptideAtlasiQ8TDQ1.
PRIDEiQ8TDQ1.
TopDownProteomicsiQ8TDQ1-4. [Q8TDQ1-4]

Protocols and materials databases

DNASUi146722.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000301573; ENSP00000301573; ENSG00000186074. [Q8TDQ1-5]
ENST00000326165; ENSP00000327075; ENSG00000186074. [Q8TDQ1-1]
ENST00000343125; ENSP00000343751; ENSG00000186074. [Q8TDQ1-4]
ENST00000361254; ENSP00000355294; ENSG00000186074. [Q8TDQ1-2]
ENST00000462044; ENSP00000464223; ENSG00000186074. [Q8TDQ1-3]
ENST00000464910; ENSP00000464257; ENSG00000186074. [Q8TDQ1-6]
ENST00000469092; ENSP00000463743; ENSG00000186074. [Q8TDQ1-4]
ENST00000581500; ENSP00000464610; ENSG00000186074. [Q8TDQ1-2]
GeneIDi146722.
KEGGihsa:146722.
UCSCiuc002jlg.5. human. [Q8TDQ1-1]

Organism-specific databases

CTDi146722.
DisGeNETi146722.
GeneCardsiCD300LF.
H-InvDBHIX0021633.
HGNCiHGNC:29883. CD300LF.
MIMi609807. gene.
neXtProtiNX_Q8TDQ1.
OpenTargetsiENSG00000186074.
PharmGKBiPA142672153.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IZ4I. Eukaryota.
ENOG410YT8T. LUCA.
GeneTreeiENSGT00470000042273.
HOVERGENiHBG050999.
InParanoidiQ8TDQ1.
KOiK20395.
PhylomeDBiQ8TDQ1.
TreeFamiTF334441.

Enzyme and pathway databases

ReactomeiR-HSA-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

Miscellaneous databases

EvolutionaryTraceiQ8TDQ1.
GeneWikiiCD300LF.
GenomeRNAii146722.
PROiQ8TDQ1.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000186074.
ExpressionAtlasiQ8TDQ1. baseline and differential.
GenevisibleiQ8TDQ1. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCLM1_HUMAN
AccessioniPrimary (citable) accession number: Q8TDQ1
Secondary accession number(s): B2RCL2
, C9JDN3, Q3Y6P0, Q6UX24, Q7Z6A6, Q7Z7I4, Q7Z7I5, Q8N6D0, Q8NAF5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: May 18, 2010
Last modified: November 2, 2016
This is version 123 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.