Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8TDQ1

- CLM1_HUMAN

UniProt

Q8TDQ1 - CLM1_HUMAN

Protein

CMRF35-like molecule 1

Gene

CD300LF

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 105 (01 Oct 2014)
      Sequence version 3 (18 May 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as an inhibitory receptor for myeloid cells and mast cells. Inhibits osteoclast formation.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei205 – 2051Phosphatase-binding

    GO - Biological processi

    1. immune system process Source: UniProtKB-KW

    Keywords - Molecular functioni

    Receptor

    Keywords - Biological processi

    Immunity

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    CMRF35-like molecule 1
    Short name:
    CLM-1
    Alternative name(s):
    CD300 antigen-like family member F
    Immune receptor expressed on myeloid cells 1
    Short name:
    IREM-1
    Immunoglobulin superfamily member 13
    Short name:
    IgSF13
    NK inhibitory receptor
    CD_antigen: CD300f
    Gene namesi
    Name:CD300LF
    Synonyms:CD300F, CLM1, IGSF13, IREM1, NKIR
    ORF Names:UNQ3105/PRO10111
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:29883. CD300LF.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi205 – 2051Y → F: No interaction with PTPN6. 1 Publication
    Mutagenesisi249 – 2491Y → F: Interaction with PTPN6. 1 Publication
    Mutagenesisi284 – 2841Y → F: Interaction with PTPN6. 1 Publication

    Organism-specific databases

    PharmGKBiPA142672153.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 19191 PublicationAdd
    BLAST
    Chaini20 – 290271CMRF35-like molecule 1PRO_0000247825Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi40 ↔ 1081 PublicationPROSITE-ProRule annotation
    Disulfide bondi54 ↔ 621 PublicationPROSITE-ProRule annotation
    Glycosylationi88 – 881N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    Phosphorylated on tyrosine.1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiQ8TDQ1.
    PRIDEiQ8TDQ1.

    PTM databases

    PhosphoSiteiQ8TDQ1.

    Expressioni

    Tissue specificityi

    Highly expressed in spleen, peripheral blood leukocyte and monocyte, and lung. Weakly expressed in thymus, heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, testis, ovary, small intestine or colon. Expressed selectively in monocytes and monocyte-related cells.2 Publications

    Gene expression databases

    ArrayExpressiQ8TDQ1.
    BgeeiQ8TDQ1.
    GenevestigatoriQ8TDQ1.

    Organism-specific databases

    HPAiHPA013712.

    Interactioni

    Subunit structurei

    Interacts with PTPN6/SHP-1 in a tyrosine phosphorylation dependent manner.2 Publications

    Protein-protein interaction databases

    BioGridi127005. 1 interaction.
    IntActiQ8TDQ1. 1 interaction.
    MINTiMINT-8020158.

    Structurei

    Secondary structure

    1
    290
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi21 – 233
    Beta strandi26 – 316
    Beta strandi36 – 427
    Beta strandi49 – 5911
    Beta strandi63 – 675
    Beta strandi70 – 723
    Beta strandi75 – 773
    Beta strandi80 – 856
    Turni86 – 894
    Beta strandi90 – 956
    Helixi100 – 1023
    Beta strandi104 – 1129
    Beta strandi115 – 12612

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2NMSX-ray2.60A21-140[»]
    ProteinModelPortaliQ8TDQ1.
    SMRiQ8TDQ1. Positions 19-129.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ8TDQ1.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini20 – 156137ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini178 – 290113CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei157 – 17721HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini20 – 126107Ig-like V-typeAdd
    BLAST

    Sequence similaritiesi

    Belongs to the CD300 family.Curated

    Keywords - Domaini

    Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG75577.
    HOVERGENiHBG050999.
    InParanoidiQ8TDQ1.
    OMAiWRATSAM.
    OrthoDBiEOG78PVBM.
    PhylomeDBiQ8TDQ1.
    TreeFamiTF334441.

    Family and domain databases

    Gene3Di2.60.40.10. 1 hit.
    InterProiIPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR013106. Ig_V-set.
    [Graphical view]
    PfamiPF07686. V-set. 1 hit.
    [Graphical view]
    SMARTiSM00409. IG. 1 hit.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8TDQ1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPLLTLYLLL FWLSGYSIVT QITGPTTVNG LERGSLTVQC VYRSGWETYL    50
    KWWCRGAIWR DCKILVKTSG SEQEVKRDRV SIKDNQKNRT FTVTMEDLMK 100
    TDADTYWCGI EKTGNDLGVT VQVTIDPAPV TQEETSSSPT LTGHHLDNRH 150
    KLLKLSVLLP LIFTILLLLL VAASLLAWRM MKYQQKAAGM SPEQVLQPLE 200
    GDLCYADLTL QLAGTSPQKA TTKLSSAQVD QVEVEYVTMA SLPKEDISYA 250
    SLTLGAEDQE PTYCNMGHLS SHLPGRGPEE PTEYSTISRP 290
    Length:290
    Mass (Da):32,335
    Last modified:May 18, 2010 - v3
    Checksum:i27AA95664B82B945
    GO
    Isoform 2 (identifier: Q8TDQ1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ
         128-128: A → ASTPAPTTPTSTTFTA
         187-221: AAGMSPEQVLQPLEGDLCYADLTLQLAGTSPQKAT → GTAAPGGRPLLCRPDPAAGRNLPAKGYHEAFLCPG
         222-290: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:239
    Mass (Da):26,480
    Checksum:iC67579996CFFA382
    GO
    Isoform 3 (identifier: Q8TDQ1-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ
         150-162: HKLLKLSVLLPLI → YCSPWRATSAMQT
         163-290: Missing.

    Show »
    Length:165
    Mass (Da):18,684
    Checksum:i8D46CA836B7E8AAE
    GO
    Isoform 4 (identifier: Q8TDQ1-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ
         149-191: RHKLLKLSVL...KYQQKAAGMS → SSRDVPRAGT...GYHEAFLCPG
         192-290: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:194
    Mass (Da):21,427
    Checksum:i9274E383F4A98236
    GO
    Isoform 5 (identifier: Q8TDQ1-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         150-244: HKLLKLSVLL...EYVTMASLPK → SEGSQAANYR...GYHEAFLCPG
         245-290: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:244
    Mass (Da):26,671
    Checksum:i8CB8B81FCB47821A
    GO
    Isoform 6 (identifier: Q8TDQ1-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-14: MPLLTLYLLLFWLS → MWLPQLDLMRVISAKSQ

    Show »
    Length:293
    Mass (Da):32,628
    Checksum:iC8AC14CA781BCFC4
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti37 – 371T → A in AAZ81566. 1 PublicationCurated
    Sequence conflicti64 – 641I → V in AAZ81566. 1 PublicationCurated
    Sequence conflicti78 – 781D → N in AAP42153. (PubMed:15549731)Curated
    Sequence conflicti135 – 1351T → I in AAP42152. (PubMed:15549731)Curated
    Sequence conflicti138 – 1381S → F in AAM19099. (PubMed:15184070)Curated
    Sequence conflicti212 – 2121L → Q in AAP42152. (PubMed:15549731)Curated
    Sequence conflicti268 – 2681H → R in AAP57942. (PubMed:15549731)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti19 – 191V → A.6 Publications
    Corresponds to variant rs35489971 [ dbSNP | Ensembl ].
    VAR_039128
    Natural varianti218 – 2181Q → R.4 Publications
    Corresponds to variant rs2034310 [ dbSNP | Ensembl ].
    VAR_027152

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1414MPLLT…LFWLS → MWLPQLDLMRVISAKSQ in isoform 2, isoform 3, isoform 4 and isoform 6. 3 PublicationsVSP_020056Add
    BLAST
    Alternative sequencei128 – 1281A → ASTPAPTTPTSTTFTA in isoform 2. 1 PublicationVSP_020057
    Alternative sequencei149 – 19143RHKLL…AAGMS → SSRDVPRAGTAAPGGRPLLC RPDPAAGRNLPAKGYHEAFL CPG in isoform 4. 1 PublicationVSP_020058Add
    BLAST
    Alternative sequencei150 – 24495HKLLK…ASLPK → SEGSQAANYRPAAHQAQAPE AQCPPAPHLHHIAAAFGGRL TLGLEDDEVPAESSRDVPRA GTAAPGGRPLLCRPDPAAGR NLPAKGYHEAFLCPG in isoform 5. 1 PublicationVSP_020059Add
    BLAST
    Alternative sequencei150 – 16213HKLLK…LLPLI → YCSPWRATSAMQT in isoform 3. 1 PublicationVSP_020060Add
    BLAST
    Alternative sequencei163 – 290128Missing in isoform 3. 1 PublicationVSP_020061Add
    BLAST
    Alternative sequencei187 – 22135AAGMS…PQKAT → GTAAPGGRPLLCRPDPAAGR NLPAKGYHEAFLCPG in isoform 2. 1 PublicationVSP_020062Add
    BLAST
    Alternative sequencei192 – 29099Missing in isoform 4. 1 PublicationVSP_020063Add
    BLAST
    Alternative sequencei222 – 29069Missing in isoform 2. 1 PublicationVSP_020064Add
    BLAST
    Alternative sequencei245 – 29046Missing in isoform 5. 1 PublicationVSP_020065Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF251706 mRNA. Translation: AAM19099.1.
    AF375480 mRNA. Translation: AAP42152.1.
    AF375481 mRNA. Translation: AAP42153.1.
    AY303545 mRNA. Translation: AAP57942.1.
    AY358545 mRNA. Translation: AAQ88909.1.
    AK092757 mRNA. Translation: BAC03966.1.
    AK315165 mRNA. Translation: BAG37609.1.
    DQ153249 mRNA. Translation: AAZ81566.1.
    AC016888 Genomic DNA. No translation available.
    AC064805 Genomic DNA. No translation available.
    BC028199 mRNA. Translation: AAH28199.1.
    CCDSiCCDS11704.1. [Q8TDQ1-1]
    RefSeqiNP_001276011.1. NM_001289082.1. [Q8TDQ1-4]
    NP_001276012.1. NM_001289083.1. [Q8TDQ1-5]
    NP_001276013.1. NM_001289084.1.
    NP_001276014.1. NM_001289085.1. [Q8TDQ1-6]
    NP_001276015.1. NM_001289086.1. [Q8TDQ1-2]
    NP_001276016.1. NM_001289087.1.
    NP_620587.2. NM_139018.4. [Q8TDQ1-1]
    UniGeneiHs.567706.

    Genome annotation databases

    EnsembliENST00000301573; ENSP00000301573; ENSG00000186074. [Q8TDQ1-5]
    ENST00000326165; ENSP00000327075; ENSG00000186074. [Q8TDQ1-1]
    ENST00000343125; ENSP00000343751; ENSG00000186074. [Q8TDQ1-4]
    ENST00000361254; ENSP00000355294; ENSG00000186074. [Q8TDQ1-2]
    ENST00000462044; ENSP00000464223; ENSG00000186074. [Q8TDQ1-3]
    ENST00000464910; ENSP00000464257; ENSG00000186074. [Q8TDQ1-6]
    ENST00000469092; ENSP00000463743; ENSG00000186074. [Q8TDQ1-4]
    ENST00000581500; ENSP00000464610; ENSG00000186074. [Q8TDQ1-2]
    GeneIDi146722.
    KEGGihsa:146722.
    UCSCiuc002jlf.3. human. [Q8TDQ1-6]
    uc002jlg.3. human. [Q8TDQ1-1]
    uc002jlh.3. human. [Q8TDQ1-5]
    uc002jli.3. human. [Q8TDQ1-4]
    uc002jlj.1. human. [Q8TDQ1-2]

    Polymorphism databases

    DMDMi296439398.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF251706 mRNA. Translation: AAM19099.1 .
    AF375480 mRNA. Translation: AAP42152.1 .
    AF375481 mRNA. Translation: AAP42153.1 .
    AY303545 mRNA. Translation: AAP57942.1 .
    AY358545 mRNA. Translation: AAQ88909.1 .
    AK092757 mRNA. Translation: BAC03966.1 .
    AK315165 mRNA. Translation: BAG37609.1 .
    DQ153249 mRNA. Translation: AAZ81566.1 .
    AC016888 Genomic DNA. No translation available.
    AC064805 Genomic DNA. No translation available.
    BC028199 mRNA. Translation: AAH28199.1 .
    CCDSi CCDS11704.1. [Q8TDQ1-1 ]
    RefSeqi NP_001276011.1. NM_001289082.1. [Q8TDQ1-4 ]
    NP_001276012.1. NM_001289083.1. [Q8TDQ1-5 ]
    NP_001276013.1. NM_001289084.1.
    NP_001276014.1. NM_001289085.1. [Q8TDQ1-6 ]
    NP_001276015.1. NM_001289086.1. [Q8TDQ1-2 ]
    NP_001276016.1. NM_001289087.1.
    NP_620587.2. NM_139018.4. [Q8TDQ1-1 ]
    UniGenei Hs.567706.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2NMS X-ray 2.60 A 21-140 [» ]
    ProteinModelPortali Q8TDQ1.
    SMRi Q8TDQ1. Positions 19-129.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 127005. 1 interaction.
    IntActi Q8TDQ1. 1 interaction.
    MINTi MINT-8020158.

    PTM databases

    PhosphoSitei Q8TDQ1.

    Polymorphism databases

    DMDMi 296439398.

    Proteomic databases

    PaxDbi Q8TDQ1.
    PRIDEi Q8TDQ1.

    Protocols and materials databases

    DNASUi 146722.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000301573 ; ENSP00000301573 ; ENSG00000186074 . [Q8TDQ1-5 ]
    ENST00000326165 ; ENSP00000327075 ; ENSG00000186074 . [Q8TDQ1-1 ]
    ENST00000343125 ; ENSP00000343751 ; ENSG00000186074 . [Q8TDQ1-4 ]
    ENST00000361254 ; ENSP00000355294 ; ENSG00000186074 . [Q8TDQ1-2 ]
    ENST00000462044 ; ENSP00000464223 ; ENSG00000186074 . [Q8TDQ1-3 ]
    ENST00000464910 ; ENSP00000464257 ; ENSG00000186074 . [Q8TDQ1-6 ]
    ENST00000469092 ; ENSP00000463743 ; ENSG00000186074 . [Q8TDQ1-4 ]
    ENST00000581500 ; ENSP00000464610 ; ENSG00000186074 . [Q8TDQ1-2 ]
    GeneIDi 146722.
    KEGGi hsa:146722.
    UCSCi uc002jlf.3. human. [Q8TDQ1-6 ]
    uc002jlg.3. human. [Q8TDQ1-1 ]
    uc002jlh.3. human. [Q8TDQ1-5 ]
    uc002jli.3. human. [Q8TDQ1-4 ]
    uc002jlj.1. human. [Q8TDQ1-2 ]

    Organism-specific databases

    CTDi 146722.
    GeneCardsi GC17M072690.
    H-InvDB HIX0021633.
    HGNCi HGNC:29883. CD300LF.
    HPAi HPA013712.
    MIMi 609807. gene.
    neXtProti NX_Q8TDQ1.
    PharmGKBi PA142672153.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG75577.
    HOVERGENi HBG050999.
    InParanoidi Q8TDQ1.
    OMAi WRATSAM.
    OrthoDBi EOG78PVBM.
    PhylomeDBi Q8TDQ1.
    TreeFami TF334441.

    Miscellaneous databases

    EvolutionaryTracei Q8TDQ1.
    GeneWikii CD300LF.
    GenomeRNAii 146722.
    NextBioi 85431.
    PROi Q8TDQ1.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8TDQ1.
    Bgeei Q8TDQ1.
    Genevestigatori Q8TDQ1.

    Family and domain databases

    Gene3Di 2.60.40.10. 1 hit.
    InterProi IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR013106. Ig_V-set.
    [Graphical view ]
    Pfami PF07686. V-set. 1 hit.
    [Graphical view ]
    SMARTi SM00409. IG. 1 hit.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "IgSF13, a novel human inhibitory receptor of the immunoglobulin superfamily, is preferentially expressed in dendritic cells and monocytes."
      Sui L., Li N., Liu Q., Zhang W., Wan T., Wang B., Luo K., Sun H., Cao X.
      Biochem. Biophys. Res. Commun. 319:920-928(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, INTERACTION WITH PTPN6, PHOSPHORYLATION, VARIANTS ALA-19 AND ARG-218.
    2. "IREM-1 is a novel inhibitory receptor expressed by myeloid cells."
      Alvarez-Errico D., Aguilar H., Kitzig F., Brckalo T., Sayos J., Lopez-Botet M.
      Eur. J. Immunol. 34:3690-3701(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 6), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH PTPN6, SITE, MUTAGENESIS OF TYR-205; TYR-249 AND TYR-284, VARIANTS ALA-19 AND ARG-218.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ALA-19 AND ARG-218.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), VARIANTS ALA-19 AND ARG-218.
      Tissue: Small intestine and Umbilical cord blood.
    5. Lin L., Nong W., Zhou G., Ke R., Shen C., Zhong G., Zheng Z., Liang M., Tang Z., Wen S., Li H., Yang S.
      Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ALA-19.
    6. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT ALA-19.
      Tissue: Lung.
    8. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
      Zhang Z., Henzel W.J.
      Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 20-34.
    9. "The crystal structure of the extracellular domain of the inhibitor receptor expressed on myeloid cells IREM-1."
      Marquez J.A., Galfre E., Dupeux F., Flot D., Moran O., Dimasi N.
      J. Mol. Biol. 367:310-318(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 21-140, DISULFIDE BONDS.

    Entry informationi

    Entry nameiCLM1_HUMAN
    AccessioniPrimary (citable) accession number: Q8TDQ1
    Secondary accession number(s): B2RCL2
    , C9JDN3, Q3Y6P0, Q6UX24, Q7Z6A6, Q7Z7I4, Q7Z7I5, Q8N6D0, Q8NAF5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 25, 2006
    Last sequence update: May 18, 2010
    Last modified: October 1, 2014
    This is version 105 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    2. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    7. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3