Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Solute carrier family 2, facilitated glucose transporter member 14

Gene

SLC2A14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Facilitative glucose transporter (By similarity). May have a specific function related to spermatogenesis.By similarity

Miscellaneous

GLUT14 is a recent (less than 5 M year old) duplication of GLUT3.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei339MonosaccharideBy similarity1
Binding sitei410MonosaccharideBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Spermatogenesis, Sugar transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-189200 Cellular hexose transport

Protein family/group databases

TCDBi2.A.1.1.90 the major facilitator superfamily (mfs)

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier family 2, facilitated glucose transporter member 14
Alternative name(s):
Glucose transporter type 14
Short name:
GLUT-14
Gene namesi
Name:SLC2A14
Synonyms:GLUT14, GLUT3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000173262.11
HGNCiHGNC:18301 SLC2A14
MIMi611039 gene
neXtProtiNX_Q8TDB8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 29CytoplasmicSequence analysisAdd BLAST29
Transmembranei30 – 50Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini51 – 88ExtracellularSequence analysisAdd BLAST38
Transmembranei89 – 109Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini110 – 117CytoplasmicSequence analysis8
Transmembranei118 – 138Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini139 – 148ExtracellularSequence analysis10
Transmembranei149 – 169Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini170 – 177CytoplasmicSequence analysis8
Transmembranei178 – 198Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini199 – 207ExtracellularSequence analysis9
Transmembranei208 – 228Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini229 – 293CytoplasmicSequence analysisAdd BLAST65
Transmembranei294 – 314Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini315 – 328ExtracellularSequence analysisAdd BLAST14
Transmembranei329 – 349Helical; Name=8Sequence analysisAdd BLAST21
Topological domaini350 – 358CytoplasmicSequence analysis9
Transmembranei359 – 379Helical; Name=9Sequence analysisAdd BLAST21
Topological domaini380 – 392ExtracellularSequence analysisAdd BLAST13
Transmembranei393 – 413Helical; Name=10Sequence analysisAdd BLAST21
Topological domaini414 – 423CytoplasmicSequence analysis10
Transmembranei424 – 444Helical; Name=11Sequence analysisAdd BLAST21
Topological domaini445 – 451ExtracellularSequence analysis7
Transmembranei452 – 472Helical; Name=12Sequence analysisAdd BLAST21
Topological domaini473 – 520CytoplasmicSequence analysisAdd BLAST48

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi144195
OpenTargetsiENSG00000173262
PharmGKBiPA134885058

Polymorphism and mutation databases

BioMutaiSLC2A14
DMDMi68565598

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000503811 – 520Solute carrier family 2, facilitated glucose transporter member 14Add BLAST520

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi67N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiQ8TDB8
MaxQBiQ8TDB8
PaxDbiQ8TDB8
PeptideAtlasiQ8TDB8
PRIDEiQ8TDB8

PTM databases

iPTMnetiQ8TDB8
PhosphoSitePlusiQ8TDB8

Expressioni

Tissue specificityi

Expressed mainly in testis.1 Publication

Gene expression databases

BgeeiENSG00000173262
CleanExiHS_SLC2A14
ExpressionAtlasiQ8TDB8 baseline and differential
GenevisibleiQ8TDB8 HS

Organism-specific databases

HPAiHPA006539

Interactioni

Protein-protein interaction databases

BioGridi126837, 11 interactors
STRINGi9606.ENSP00000379834

Structurei

3D structure databases

ProteinModelPortaliQ8TDB8
SMRiQ8TDB8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni304 – 310Monosaccharide bindingBy similarity7

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0569 Eukaryota
COG0477 LUCA
GeneTreeiENSGT00760000119022
HOGENOMiHOG000202871
HOVERGENiHBG014816
InParanoidiQ8TDB8
OMAiKMVVIFQ
OrthoDBiEOG091G0A9K
PhylomeDBiQ8TDB8
TreeFamiTF313762

Family and domain databases

CDDicd06174 MFS, 1 hit
InterProiView protein in InterPro
IPR002945 Glc_transpt_3
IPR020846 MFS_dom
IPR005828 MFS_sugar_transport-like
IPR036259 MFS_trans_sf
IPR003663 Sugar/inositol_transpt
IPR005829 Sugar_transporter_CS
PfamiView protein in Pfam
PF00083 Sugar_tr, 1 hit
PRINTSiPR01192 GLUCTRSPORT3
PR00171 SUGRTRNSPORT
SUPFAMiSSF103473 SSF103473, 2 hits
TIGRFAMsiTIGR00879 SP, 1 hit
PROSITEiView protein in PROSITE
PS50850 MFS, 1 hit
PS00216 SUGAR_TRANSPORT_1, 1 hit
PS00217 SUGAR_TRANSPORT_2, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TDB8-1) [UniParc]FASTAAdd to basket
Also known as: GLUT14-L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEFHNGGHVS GIGGFLVSLT SRMKPHTLAV TPALIFAITV ATIGSFQFGY
60 70 80 90 100
NTGVINAPET IIKEFINKTL TDKANAPPSE VLLTNLWSLS VAIFSVGGMI
110 120 130 140 150
GSFSVGLFVN RFGRRNSMLI VNLLAATGGC LMGLCKIAES VEMLILGRLV
160 170 180 190 200
IGLFCGLCTG FVPMYIGEIS PTALRGAFGT LNQLGIVIGI LVAQIFGLEL
210 220 230 240 250
ILGSEELWPV LLGFTILPAI LQSAALPCCP ESPRFLLINR KKEENATRIL
260 270 280 290 300
QRLWGTQDVS QDIQEMKDES ARMSQEKQVT VLELFRVSSY RQPIIISIVL
310 320 330 340 350
QLSQQLSGIN AVFYYSTGIF KDAGVQQPIY ATISAGVVNT IFTLLSLFLV
360 370 380 390 400
ERAGRRTLHM IGLGGMAFCS TLMTVSLLLK NHYNGMSFVC IGAILVFVAC
410 420 430 440 450
FEIGPGPIPW FIVAELFSQG PRPAAMAVAG CSNWTSNFLV GLLFPSAAYY
460 470 480 490 500
LGAYVFIIFT GFLITFLAFT FFKVPETRGR TFEDITRAFE GQAHGADRSG
510 520
KDGVMGMNSI EPAKETTTNV
Length:520
Mass (Da):56,320
Last modified:June 1, 2002 - v1
Checksum:iEA304A5189087690
GO
Isoform 2 (identifier: Q8TDB8-2) [UniParc]FASTAAdd to basket
Also known as: GLUT14-S

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MEFHNGGHVSGIGGFLVSLTSRMKPHTLA → MDNRQN

Show »
Length:497
Mass (Da):54,015
Checksum:iFF6DF71A86A6E8A6
GO
Isoform 3 (identifier: Q8TDB8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-359: Missing.

Note: No experimental confirmation available.
Show »
Length:161
Mass (Da):17,378
Checksum:i9C169F3D73A4F34D
GO
Isoform 4 (identifier: Q8TDB8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-113: MEFHNGGHVS...SVGLFVNRFG → MLLR

Note: No experimental confirmation available.
Show »
Length:411
Mass (Da):44,892
Checksum:iF36A98F338E85697
GO
Isoform 5 (identifier: Q8TDB8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MEFHNGGHVSGIGGFLVSLTSRMKPHTLA → MQRLQLLRVEVLLGVKQGDEMRHFFFSSQTSTLEKSQNGGVGEE

Note: No experimental confirmation available.
Show »
Length:535
Mass (Da):58,249
Checksum:i68FA09BC581B6156
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti369C → G in AAQ63763 (Ref. 2) Curated1
Sequence conflicti376 – 377SL → PC in AAQ63763 (Ref. 2) Curated2
Sequence conflicti456F → L in CAB53739 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_059852506G → E. Corresponds to variant dbSNP:rs10845981Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0144491 – 359Missing in isoform 3. 1 PublicationAdd BLAST359
Alternative sequenceiVSP_0552531 – 113MEFHN…VNRFG → MLLR in isoform 4. 1 PublicationAdd BLAST113
Alternative sequenceiVSP_0144501 – 29MEFHN…PHTLA → MDNRQN in isoform 2. 4 PublicationsAdd BLAST29
Alternative sequenceiVSP_0552541 – 29MEFHN…PHTLA → MQRLQLLRVEVLLGVKQGDE MRHFFFSSQTSTLEKSQNGG VGEE in isoform 5. 1 PublicationAdd BLAST29

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF481878 mRNA Translation: AAL89709.1
AF481879 mRNA Translation: AAL89710.1
AY357941 mRNA Translation: AAQ63763.1
AK122783 mRNA Translation: BAG53727.1
AK126026 mRNA Translation: BAG54279.1
AK302881 mRNA Translation: BAH13830.1
AK316238 mRNA Translation: BAH14609.1
AL110298 mRNA Translation: CAB53739.2
AC006517 Genomic DNA No translation available.
AC007536 Genomic DNA No translation available.
AC124891 Genomic DNA No translation available.
CH471116 Genomic DNA Translation: EAW88652.1
CH471116 Genomic DNA Translation: EAW88653.1
BC060766 mRNA Translation: AAH60766.1
CCDSiCCDS66300.1 [Q8TDB8-4]
CCDS66301.1 [Q8TDB8-2]
CCDS66302.1 [Q8TDB8-5]
CCDS8585.1 [Q8TDB8-1]
RefSeqiNP_001273162.1, NM_001286233.1 [Q8TDB8-1]
NP_001273163.1, NM_001286234.1 [Q8TDB8-2]
NP_001273164.1, NM_001286235.1 [Q8TDB8-2]
NP_001273165.1, NM_001286236.1 [Q8TDB8-4]
NP_001273166.1, NM_001286237.1 [Q8TDB8-5]
NP_703150.1, NM_153449.3 [Q8TDB8-1]
XP_005253372.1, XM_005253315.3 [Q8TDB8-2]
XP_005253374.1, XM_005253317.4 [Q8TDB8-2]
XP_011518864.1, XM_011520562.1 [Q8TDB8-2]
XP_011518865.1, XM_011520563.2 [Q8TDB8-2]
XP_011518866.1, XM_011520564.2 [Q8TDB8-4]
XP_011518867.1, XM_011520565.2 [Q8TDB8-4]
XP_016874335.1, XM_017018846.1 [Q8TDB8-2]
XP_016874336.1, XM_017018847.1 [Q8TDB8-2]
UniGeneiHs.655169
Hs.739527

Genome annotation databases

EnsembliENST00000340749; ENSP00000340450; ENSG00000173262 [Q8TDB8-2]
ENST00000396589; ENSP00000379834; ENSG00000173262 [Q8TDB8-1]
ENST00000431042; ENSP00000407287; ENSG00000173262 [Q8TDB8-2]
ENST00000535295; ENSP00000440492; ENSG00000173262 [Q8TDB8-4]
ENST00000539924; ENSP00000445929; ENSG00000173262 [Q8TDB8-5]
ENST00000542505; ENSP00000438484; ENSG00000173262 [Q8TDB8-3]
ENST00000542546; ENSP00000443903; ENSG00000173262 [Q8TDB8-4]
ENST00000543909; ENSP00000440480; ENSG00000173262 [Q8TDB8-1]
ENST00000616981; ENSP00000482927; ENSG00000173262 [Q8TDB8-1]
GeneIDi144195
KEGGihsa:144195
UCSCiuc001qtk.5 human [Q8TDB8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiGTR14_HUMAN
AccessioniPrimary (citable) accession number: Q8TDB8
Secondary accession number(s): B3KVB5
, B3KWW7, B7Z844, B7ZAC3, Q6UY84, Q8TDB9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: June 1, 2002
Last modified: May 23, 2018
This is version 136 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health