Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Solute carrier family 2, facilitated glucose transporter member 14

Gene

SLC2A14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Facilitative glucose transporter (By similarity). May have a specific function related to spermatogenesis.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei339MonosaccharideBy similarity1
Binding sitei410MonosaccharideBy similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Spermatogenesis, Sugar transport, Transport

Enzyme and pathway databases

BioCyciZFISH:ENSG00000173262-MONOMER.
ReactomeiR-HSA-428790. Facilitative Na+-independent glucose transporters.
R-HSA-70153. Glucose transport.

Protein family/group databases

TCDBi2.A.1.1.90. the major facilitator superfamily (mfs).

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier family 2, facilitated glucose transporter member 14
Alternative name(s):
Glucose transporter type 14
Short name:
GLUT-14
Gene namesi
Name:SLC2A14
Synonyms:GLUT14, GLUT3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:18301. SLC2A14.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 29CytoplasmicSequence analysisAdd BLAST29
Transmembranei30 – 50Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini51 – 88ExtracellularSequence analysisAdd BLAST38
Transmembranei89 – 109Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini110 – 117CytoplasmicSequence analysis8
Transmembranei118 – 138Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini139 – 148ExtracellularSequence analysis10
Transmembranei149 – 169Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini170 – 177CytoplasmicSequence analysis8
Transmembranei178 – 198Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini199 – 207ExtracellularSequence analysis9
Transmembranei208 – 228Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini229 – 293CytoplasmicSequence analysisAdd BLAST65
Transmembranei294 – 314Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini315 – 328ExtracellularSequence analysisAdd BLAST14
Transmembranei329 – 349Helical; Name=8Sequence analysisAdd BLAST21
Topological domaini350 – 358CytoplasmicSequence analysis9
Transmembranei359 – 379Helical; Name=9Sequence analysisAdd BLAST21
Topological domaini380 – 392ExtracellularSequence analysisAdd BLAST13
Transmembranei393 – 413Helical; Name=10Sequence analysisAdd BLAST21
Topological domaini414 – 423CytoplasmicSequence analysis10
Transmembranei424 – 444Helical; Name=11Sequence analysisAdd BLAST21
Topological domaini445 – 451ExtracellularSequence analysis7
Transmembranei452 – 472Helical; Name=12Sequence analysisAdd BLAST21
Topological domaini473 – 520CytoplasmicSequence analysisAdd BLAST48

GO - Cellular componenti

  • integral component of membrane Source: UniProtKB-KW
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi144195.
OpenTargetsiENSG00000173262.
PharmGKBiPA134885058.

Polymorphism and mutation databases

BioMutaiSLC2A14.
DMDMi68565598.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000503811 – 520Solute carrier family 2, facilitated glucose transporter member 14Add BLAST520

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi67N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiQ8TDB8.
MaxQBiQ8TDB8.
PaxDbiQ8TDB8.
PeptideAtlasiQ8TDB8.
PRIDEiQ8TDB8.

PTM databases

iPTMnetiQ8TDB8.
PhosphoSitePlusiQ8TDB8.

Expressioni

Tissue specificityi

Expressed mainly in testis.1 Publication

Gene expression databases

BgeeiENSG00000173262.
CleanExiHS_SLC2A14.
ExpressionAtlasiQ8TDB8. baseline and differential.
GenevisibleiQ8TDB8. HS.

Organism-specific databases

HPAiHPA006539.

Interactioni

Protein-protein interaction databases

BioGridi126837. 7 interactors.
STRINGi9606.ENSP00000379834.

Structurei

3D structure databases

ProteinModelPortaliQ8TDB8.
SMRiQ8TDB8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni304 – 310Monosaccharide bindingBy similarity7

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0569. Eukaryota.
COG0477. LUCA.
GeneTreeiENSGT00760000119022.
HOGENOMiHOG000202871.
HOVERGENiHBG014816.
InParanoidiQ8TDB8.
OMAiMAICSII.
OrthoDBiEOG091G0A9K.
PhylomeDBiQ8TDB8.
TreeFamiTF313762.

Family and domain databases

CDDicd06174. MFS. 1 hit.
InterProiIPR002945. Glc_transpt_3.
IPR020846. MFS_dom.
IPR005828. MFS_sugar_transport-like.
IPR003663. Sugar/inositol_transpt.
IPR005829. Sugar_transporter_CS.
[Graphical view]
PfamiPF00083. Sugar_tr. 1 hit.
[Graphical view]
PRINTSiPR01192. GLUCTRSPORT3.
PR00171. SUGRTRNSPORT.
SUPFAMiSSF103473. SSF103473. 2 hits.
TIGRFAMsiTIGR00879. SP. 1 hit.
PROSITEiPS50850. MFS. 1 hit.
PS00216. SUGAR_TRANSPORT_1. 1 hit.
PS00217. SUGAR_TRANSPORT_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TDB8-1) [UniParc]FASTAAdd to basket
Also known as: GLUT14-L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEFHNGGHVS GIGGFLVSLT SRMKPHTLAV TPALIFAITV ATIGSFQFGY
60 70 80 90 100
NTGVINAPET IIKEFINKTL TDKANAPPSE VLLTNLWSLS VAIFSVGGMI
110 120 130 140 150
GSFSVGLFVN RFGRRNSMLI VNLLAATGGC LMGLCKIAES VEMLILGRLV
160 170 180 190 200
IGLFCGLCTG FVPMYIGEIS PTALRGAFGT LNQLGIVIGI LVAQIFGLEL
210 220 230 240 250
ILGSEELWPV LLGFTILPAI LQSAALPCCP ESPRFLLINR KKEENATRIL
260 270 280 290 300
QRLWGTQDVS QDIQEMKDES ARMSQEKQVT VLELFRVSSY RQPIIISIVL
310 320 330 340 350
QLSQQLSGIN AVFYYSTGIF KDAGVQQPIY ATISAGVVNT IFTLLSLFLV
360 370 380 390 400
ERAGRRTLHM IGLGGMAFCS TLMTVSLLLK NHYNGMSFVC IGAILVFVAC
410 420 430 440 450
FEIGPGPIPW FIVAELFSQG PRPAAMAVAG CSNWTSNFLV GLLFPSAAYY
460 470 480 490 500
LGAYVFIIFT GFLITFLAFT FFKVPETRGR TFEDITRAFE GQAHGADRSG
510 520
KDGVMGMNSI EPAKETTTNV
Length:520
Mass (Da):56,320
Last modified:June 1, 2002 - v1
Checksum:iEA304A5189087690
GO
Isoform 2 (identifier: Q8TDB8-2) [UniParc]FASTAAdd to basket
Also known as: GLUT14-S

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MEFHNGGHVSGIGGFLVSLTSRMKPHTLA → MDNRQN

Show »
Length:497
Mass (Da):54,015
Checksum:iFF6DF71A86A6E8A6
GO
Isoform 3 (identifier: Q8TDB8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-359: Missing.

Note: No experimental confirmation available.
Show »
Length:161
Mass (Da):17,378
Checksum:i9C169F3D73A4F34D
GO
Isoform 4 (identifier: Q8TDB8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-113: MEFHNGGHVS...SVGLFVNRFG → MLLR

Note: No experimental confirmation available.
Show »
Length:411
Mass (Da):44,892
Checksum:iF36A98F338E85697
GO
Isoform 5 (identifier: Q8TDB8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MEFHNGGHVSGIGGFLVSLTSRMKPHTLA → MQRLQLLRVEVLLGVKQGDEMRHFFFSSQTSTLEKSQNGGVGEE

Note: No experimental confirmation available.
Show »
Length:535
Mass (Da):58,249
Checksum:i68FA09BC581B6156
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti369C → G in AAQ63763 (Ref. 2) Curated1
Sequence conflicti376 – 377SL → PC in AAQ63763 (Ref. 2) Curated2
Sequence conflicti456F → L in CAB53739 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_059852506G → E.Corresponds to variant rs10845981dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0144491 – 359Missing in isoform 3. 1 PublicationAdd BLAST359
Alternative sequenceiVSP_0552531 – 113MEFHN…VNRFG → MLLR in isoform 4. 1 PublicationAdd BLAST113
Alternative sequenceiVSP_0144501 – 29MEFHN…PHTLA → MDNRQN in isoform 2. 4 PublicationsAdd BLAST29
Alternative sequenceiVSP_0552541 – 29MEFHN…PHTLA → MQRLQLLRVEVLLGVKQGDE MRHFFFSSQTSTLEKSQNGG VGEE in isoform 5. 1 PublicationAdd BLAST29

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF481878 mRNA. Translation: AAL89709.1.
AF481879 mRNA. Translation: AAL89710.1.
AY357941 mRNA. Translation: AAQ63763.1.
AK122783 mRNA. Translation: BAG53727.1.
AK126026 mRNA. Translation: BAG54279.1.
AK302881 mRNA. Translation: BAH13830.1.
AK316238 mRNA. Translation: BAH14609.1.
AL110298 mRNA. Translation: CAB53739.2.
AC006517 Genomic DNA. No translation available.
AC007536 Genomic DNA. No translation available.
AC124891 Genomic DNA. No translation available.
CH471116 Genomic DNA. Translation: EAW88652.1.
CH471116 Genomic DNA. Translation: EAW88653.1.
BC060766 mRNA. Translation: AAH60766.1.
CCDSiCCDS66300.1. [Q8TDB8-4]
CCDS66301.1. [Q8TDB8-2]
CCDS66302.1. [Q8TDB8-5]
CCDS8585.1. [Q8TDB8-1]
RefSeqiNP_001273162.1. NM_001286233.1. [Q8TDB8-1]
NP_001273163.1. NM_001286234.1. [Q8TDB8-2]
NP_001273164.1. NM_001286235.1. [Q8TDB8-2]
NP_001273165.1. NM_001286236.1. [Q8TDB8-4]
NP_001273166.1. NM_001286237.1. [Q8TDB8-5]
NP_703150.1. NM_153449.3. [Q8TDB8-1]
XP_005253372.1. XM_005253315.3. [Q8TDB8-2]
XP_005253374.1. XM_005253317.4. [Q8TDB8-2]
XP_011518864.1. XM_011520562.1. [Q8TDB8-2]
XP_011518865.1. XM_011520563.2. [Q8TDB8-2]
XP_011518866.1. XM_011520564.2. [Q8TDB8-4]
XP_011518867.1. XM_011520565.2. [Q8TDB8-4]
XP_016874335.1. XM_017018846.1. [Q8TDB8-2]
XP_016874336.1. XM_017018847.1. [Q8TDB8-2]
UniGeneiHs.655169.
Hs.739527.

Genome annotation databases

EnsembliENST00000340749; ENSP00000340450; ENSG00000173262. [Q8TDB8-2]
ENST00000396589; ENSP00000379834; ENSG00000173262. [Q8TDB8-1]
ENST00000431042; ENSP00000407287; ENSG00000173262. [Q8TDB8-2]
ENST00000535295; ENSP00000440492; ENSG00000173262. [Q8TDB8-4]
ENST00000539924; ENSP00000445929; ENSG00000173262. [Q8TDB8-5]
ENST00000542505; ENSP00000438484; ENSG00000173262. [Q8TDB8-3]
ENST00000542546; ENSP00000443903; ENSG00000173262. [Q8TDB8-4]
ENST00000543909; ENSP00000440480; ENSG00000173262. [Q8TDB8-1]
ENST00000616981; ENSP00000482927; ENSG00000173262. [Q8TDB8-1]
GeneIDi144195.
KEGGihsa:144195.
UCSCiuc001qtk.5. human. [Q8TDB8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF481878 mRNA. Translation: AAL89709.1.
AF481879 mRNA. Translation: AAL89710.1.
AY357941 mRNA. Translation: AAQ63763.1.
AK122783 mRNA. Translation: BAG53727.1.
AK126026 mRNA. Translation: BAG54279.1.
AK302881 mRNA. Translation: BAH13830.1.
AK316238 mRNA. Translation: BAH14609.1.
AL110298 mRNA. Translation: CAB53739.2.
AC006517 Genomic DNA. No translation available.
AC007536 Genomic DNA. No translation available.
AC124891 Genomic DNA. No translation available.
CH471116 Genomic DNA. Translation: EAW88652.1.
CH471116 Genomic DNA. Translation: EAW88653.1.
BC060766 mRNA. Translation: AAH60766.1.
CCDSiCCDS66300.1. [Q8TDB8-4]
CCDS66301.1. [Q8TDB8-2]
CCDS66302.1. [Q8TDB8-5]
CCDS8585.1. [Q8TDB8-1]
RefSeqiNP_001273162.1. NM_001286233.1. [Q8TDB8-1]
NP_001273163.1. NM_001286234.1. [Q8TDB8-2]
NP_001273164.1. NM_001286235.1. [Q8TDB8-2]
NP_001273165.1. NM_001286236.1. [Q8TDB8-4]
NP_001273166.1. NM_001286237.1. [Q8TDB8-5]
NP_703150.1. NM_153449.3. [Q8TDB8-1]
XP_005253372.1. XM_005253315.3. [Q8TDB8-2]
XP_005253374.1. XM_005253317.4. [Q8TDB8-2]
XP_011518864.1. XM_011520562.1. [Q8TDB8-2]
XP_011518865.1. XM_011520563.2. [Q8TDB8-2]
XP_011518866.1. XM_011520564.2. [Q8TDB8-4]
XP_011518867.1. XM_011520565.2. [Q8TDB8-4]
XP_016874335.1. XM_017018846.1. [Q8TDB8-2]
XP_016874336.1. XM_017018847.1. [Q8TDB8-2]
UniGeneiHs.655169.
Hs.739527.

3D structure databases

ProteinModelPortaliQ8TDB8.
SMRiQ8TDB8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126837. 7 interactors.
STRINGi9606.ENSP00000379834.

Protein family/group databases

TCDBi2.A.1.1.90. the major facilitator superfamily (mfs).

PTM databases

iPTMnetiQ8TDB8.
PhosphoSitePlusiQ8TDB8.

Polymorphism and mutation databases

BioMutaiSLC2A14.
DMDMi68565598.

Proteomic databases

EPDiQ8TDB8.
MaxQBiQ8TDB8.
PaxDbiQ8TDB8.
PeptideAtlasiQ8TDB8.
PRIDEiQ8TDB8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000340749; ENSP00000340450; ENSG00000173262. [Q8TDB8-2]
ENST00000396589; ENSP00000379834; ENSG00000173262. [Q8TDB8-1]
ENST00000431042; ENSP00000407287; ENSG00000173262. [Q8TDB8-2]
ENST00000535295; ENSP00000440492; ENSG00000173262. [Q8TDB8-4]
ENST00000539924; ENSP00000445929; ENSG00000173262. [Q8TDB8-5]
ENST00000542505; ENSP00000438484; ENSG00000173262. [Q8TDB8-3]
ENST00000542546; ENSP00000443903; ENSG00000173262. [Q8TDB8-4]
ENST00000543909; ENSP00000440480; ENSG00000173262. [Q8TDB8-1]
ENST00000616981; ENSP00000482927; ENSG00000173262. [Q8TDB8-1]
GeneIDi144195.
KEGGihsa:144195.
UCSCiuc001qtk.5. human. [Q8TDB8-1]

Organism-specific databases

CTDi144195.
DisGeNETi144195.
GeneCardsiSLC2A14.
HGNCiHGNC:18301. SLC2A14.
HPAiHPA006539.
MIMi611039. gene.
neXtProtiNX_Q8TDB8.
OpenTargetsiENSG00000173262.
PharmGKBiPA134885058.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0569. Eukaryota.
COG0477. LUCA.
GeneTreeiENSGT00760000119022.
HOGENOMiHOG000202871.
HOVERGENiHBG014816.
InParanoidiQ8TDB8.
OMAiMAICSII.
OrthoDBiEOG091G0A9K.
PhylomeDBiQ8TDB8.
TreeFamiTF313762.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000173262-MONOMER.
ReactomeiR-HSA-428790. Facilitative Na+-independent glucose transporters.
R-HSA-70153. Glucose transport.

Miscellaneous databases

GeneWikiiSLC2A14.
GenomeRNAii144195.
PROiQ8TDB8.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000173262.
CleanExiHS_SLC2A14.
ExpressionAtlasiQ8TDB8. baseline and differential.
GenevisibleiQ8TDB8. HS.

Family and domain databases

CDDicd06174. MFS. 1 hit.
InterProiIPR002945. Glc_transpt_3.
IPR020846. MFS_dom.
IPR005828. MFS_sugar_transport-like.
IPR003663. Sugar/inositol_transpt.
IPR005829. Sugar_transporter_CS.
[Graphical view]
PfamiPF00083. Sugar_tr. 1 hit.
[Graphical view]
PRINTSiPR01192. GLUCTRSPORT3.
PR00171. SUGRTRNSPORT.
SUPFAMiSSF103473. SSF103473. 2 hits.
TIGRFAMsiTIGR00879. SP. 1 hit.
PROSITEiPS50850. MFS. 1 hit.
PS00216. SUGAR_TRANSPORT_1. 1 hit.
PS00217. SUGAR_TRANSPORT_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiGTR14_HUMAN
AccessioniPrimary (citable) accession number: Q8TDB8
Secondary accession number(s): B3KVB5
, B3KWW7, B7Z844, B7ZAC3, Q6UY84, Q8TDB9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: June 1, 2002
Last modified: November 30, 2016
This is version 124 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

GLUT14 is a recent (less than 5 M year old) duplication of GLUT3.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.