Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8TDB8 (GTR14_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 103. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Solute carrier family 2, facilitated glucose transporter member 14
Alternative name(s):
Glucose transporter type 14
Short name=GLUT-14
Gene names
Name:SLC2A14
Synonyms:GLUT14, GLUT3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length520 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Facilitative glucose transporter By similarity. May have a specific function related to spermatogenesis.

Subcellular location

Membrane; Multi-pass membrane protein.

Tissue specificity

Expressed mainly in testis. Ref.1

Miscellaneous

GLUT14 is a recent (less than 5 M year old) duplication of GLUT3.

Sequence similarities

Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily. [View classification]

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8TDB8-1)

Also known as: GLUT14-L;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8TDB8-2)

Also known as: GLUT14-S;

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MEFHNGGHVSGIGGFLVSLTSRMKPHTLA → MDNRQN
Isoform 3 (identifier: Q8TDB8-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-359: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q8TDB8-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-113: MEFHNGGHVS...SVGLFVNRFG → MLLR
Note: No experimental confirmation available.
Isoform 5 (identifier: Q8TDB8-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MEFHNGGHVSGIGGFLVSLTSRMKPHTLA → MQRLQLLRVEVLLGVKQGDEMRHFFFSSQTSTLEKSQNGGVGEE
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 520520Solute carrier family 2, facilitated glucose transporter member 14
PRO_0000050381

Regions

Topological domain1 – 2929Cytoplasmic Potential
Transmembrane30 – 5021Helical; Name=1; Potential
Topological domain51 – 8838Extracellular Potential
Transmembrane89 – 10921Helical; Name=2; Potential
Topological domain110 – 1178Cytoplasmic Potential
Transmembrane118 – 13821Helical; Name=3; Potential
Topological domain139 – 14810Extracellular Potential
Transmembrane149 – 16921Helical; Name=4; Potential
Topological domain170 – 1778Cytoplasmic Potential
Transmembrane178 – 19821Helical; Name=5; Potential
Topological domain199 – 2079Extracellular Potential
Transmembrane208 – 22821Helical; Name=6; Potential
Topological domain229 – 29365Cytoplasmic Potential
Transmembrane294 – 31421Helical; Name=7; Potential
Topological domain315 – 32814Extracellular Potential
Transmembrane329 – 34921Helical; Name=8; Potential
Topological domain350 – 3589Cytoplasmic Potential
Transmembrane359 – 37921Helical; Name=9; Potential
Topological domain380 – 39213Extracellular Potential
Transmembrane393 – 41321Helical; Name=10; Potential
Topological domain414 – 42310Cytoplasmic Potential
Transmembrane424 – 44421Helical; Name=11; Potential
Topological domain445 – 4517Extracellular Potential
Transmembrane452 – 47221Helical; Name=12; Potential
Topological domain473 – 52048Cytoplasmic Potential
Region301 – 3033Defines substrate specificity By similarity

Amino acid modifications

Glycosylation671N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 359359Missing in isoform 3.
VSP_014449
Alternative sequence1 – 113113MEFHN…VNRFG → MLLR in isoform 4.
VSP_055253
Alternative sequence1 – 2929MEFHN…PHTLA → MDNRQN in isoform 2.
VSP_014450
Alternative sequence1 – 2929MEFHN…PHTLA → MQRLQLLRVEVLLGVKQGDE MRHFFFSSQTSTLEKSQNGG VGEE in isoform 5.
VSP_055254
Natural variant5061G → E.
Corresponds to variant rs10845981 [ dbSNP | Ensembl ].
VAR_059852

Experimental info

Sequence conflict3691C → G in AAQ63763. Ref.2
Sequence conflict376 – 3772SL → PC in AAQ63763. Ref.2
Sequence conflict4561F → L in CAB53739. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (GLUT14-L) [UniParc].

Last modified June 1, 2002. Version 1.
Checksum: EA304A5189087690

FASTA52056,320
        10         20         30         40         50         60 
MEFHNGGHVS GIGGFLVSLT SRMKPHTLAV TPALIFAITV ATIGSFQFGY NTGVINAPET 

        70         80         90        100        110        120 
IIKEFINKTL TDKANAPPSE VLLTNLWSLS VAIFSVGGMI GSFSVGLFVN RFGRRNSMLI 

       130        140        150        160        170        180 
VNLLAATGGC LMGLCKIAES VEMLILGRLV IGLFCGLCTG FVPMYIGEIS PTALRGAFGT 

       190        200        210        220        230        240 
LNQLGIVIGI LVAQIFGLEL ILGSEELWPV LLGFTILPAI LQSAALPCCP ESPRFLLINR 

       250        260        270        280        290        300 
KKEENATRIL QRLWGTQDVS QDIQEMKDES ARMSQEKQVT VLELFRVSSY RQPIIISIVL 

       310        320        330        340        350        360 
QLSQQLSGIN AVFYYSTGIF KDAGVQQPIY ATISAGVVNT IFTLLSLFLV ERAGRRTLHM 

       370        380        390        400        410        420 
IGLGGMAFCS TLMTVSLLLK NHYNGMSFVC IGAILVFVAC FEIGPGPIPW FIVAELFSQG 

       430        440        450        460        470        480 
PRPAAMAVAG CSNWTSNFLV GLLFPSAAYY LGAYVFIIFT GFLITFLAFT FFKVPETRGR 

       490        500        510        520 
TFEDITRAFE GQAHGADRSG KDGVMGMNSI EPAKETTTNV 

« Hide

Isoform 2 (GLUT14-S) [UniParc].

Checksum: FF6DF71A86A6E8A6
Show »

FASTA49754,015
Isoform 3 [UniParc].

Checksum: 9C169F3D73A4F34D
Show »

FASTA16117,378
Isoform 4 [UniParc].

Checksum: F36A98F338E85697
Show »

FASTA41144,892
Isoform 5 [UniParc].

Checksum: 68FA09BC581B6156
Show »

FASTA53558,249

References

« Hide 'large scale' references
[1]"GLUT14, a duplicon of GLUT3, is specifically expressed in testis as alternative splice forms."
Wu X., Freeze H.H.
Genomics 80:553-557(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
Tissue: Testis.
[2]"Cloning of an isoform of SCL2A14 gene related to spermatogenesis."
Fang X., Wang H., Huo R., Lu L., Xu M., Xu Y.Z., Yin L.L., Li M.J., Zhou M.Z., Sha H.J.
Submitted (SEP-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Tissue: Testis.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 4 AND 5).
Tissue: Testis.
[4]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Fetal brain.
[5]"The finished DNA sequence of human chromosome 12."
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. expand/collapse author list , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Testis.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF481878 mRNA. Translation: AAL89709.1.
AF481879 mRNA. Translation: AAL89710.1.
AY357941 mRNA. Translation: AAQ63763.1.
AK122783 mRNA. Translation: BAG53727.1.
AK126026 mRNA. Translation: BAG54279.1.
AK302881 mRNA. Translation: BAH13830.1.
AK316238 mRNA. Translation: BAH14609.1.
AL110298 mRNA. Translation: CAB53739.2.
AC006517 Genomic DNA. No translation available.
AC007536 Genomic DNA. No translation available.
AC124891 Genomic DNA. No translation available.
CH471116 Genomic DNA. Translation: EAW88652.1.
CH471116 Genomic DNA. Translation: EAW88653.1.
BC060766 mRNA. Translation: AAH60766.1.
CCDSCCDS66301.1. [Q8TDB8-2]
CCDS8585.1. [Q8TDB8-1]
RefSeqNP_001273162.1. NM_001286233.1. [Q8TDB8-1]
NP_001273163.1. NM_001286234.1. [Q8TDB8-2]
NP_001273164.1. NM_001286235.1. [Q8TDB8-2]
NP_001273165.1. NM_001286236.1.
NP_001273166.1. NM_001286237.1.
NP_703150.1. NM_153449.3. [Q8TDB8-1]
XP_005253372.1. XM_005253315.2. [Q8TDB8-2]
XP_005253374.1. XM_005253317.2. [Q8TDB8-2]
UniGeneHs.655169.
Hs.739527.

3D structure databases

ProteinModelPortalQ8TDB8.
SMRQ8TDB8. Positions 33-490.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid126837. 2 interactions.
STRING9606.ENSP00000340450.

Protein family/group databases

TCDB2.A.1.1.90. the major facilitator superfamily (mfs).

PTM databases

PhosphoSiteQ8TDB8.

Polymorphism databases

DMDM68565598.

Proteomic databases

PaxDbQ8TDB8.
PRIDEQ8TDB8.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000340749; ENSP00000340450; ENSG00000173262. [Q8TDB8-2]
ENST00000396589; ENSP00000379834; ENSG00000173262. [Q8TDB8-1]
ENST00000431042; ENSP00000407287; ENSG00000173262. [Q8TDB8-2]
ENST00000535295; ENSP00000440492; ENSG00000173262.
ENST00000539924; ENSP00000445929; ENSG00000173262.
ENST00000542505; ENSP00000438484; ENSG00000173262. [Q8TDB8-3]
ENST00000543909; ENSP00000440480; ENSG00000173262. [Q8TDB8-1]
GeneID144195.
KEGGhsa:144195.
UCSCuc001qtk.3. human. [Q8TDB8-1]
uc001qtl.3. human. [Q8TDB8-2]

Organism-specific databases

CTD144195.
GeneCardsGC12M007965.
HGNCHGNC:18301. SLC2A14.
HPAHPA006539.
MIM611039. gene.
neXtProtNX_Q8TDB8.
PharmGKBPA134885058.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0477.
HOGENOMHOG000202871.
HOVERGENHBG014816.
InParanoidQ8TDB8.
OrthoDBEOG7QVM2R.
PhylomeDBQ8TDB8.
TreeFamTF313762.

Gene expression databases

ArrayExpressQ8TDB8.
BgeeQ8TDB8.
CleanExHS_SLC2A14.
GenevestigatorQ8TDB8.

Family and domain databases

InterProIPR002945. Glc_transpt_3.
IPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
IPR005828. Sub_transporter.
IPR003663. Sugar/inositol_transpt.
IPR005829. Sugar_transporter_CS.
[Graphical view]
PfamPF00083. Sugar_tr. 1 hit.
[Graphical view]
PRINTSPR01192. GLUCTRSPORT3.
PR00171. SUGRTRNSPORT.
SUPFAMSSF103473. SSF103473. 2 hits.
TIGRFAMsTIGR00879. SP. 1 hit.
PROSITEPS50850. MFS. 1 hit.
PS00216. SUGAR_TRANSPORT_1. 1 hit.
PS00217. SUGAR_TRANSPORT_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSSLC2A14. human.
GeneWikiSLC2A14.
GenomeRNAi144195.
NextBio84858.
PROQ8TDB8.
SOURCESearch...

Entry information

Entry nameGTR14_HUMAN
AccessionPrimary (citable) accession number: Q8TDB8
Secondary accession number(s): B3KVB5 expand/collapse secondary AC list , B3KWW7, B7Z844, B7ZAC3, Q6UY84, Q8TDB9
Entry history
Integrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: June 1, 2002
Last modified: July 9, 2014
This is version 103 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM