Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8TDB8

- GTR14_HUMAN

UniProt

Q8TDB8 - GTR14_HUMAN

Protein

Solute carrier family 2, facilitated glucose transporter member 14

Gene

SLC2A14

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 105 (01 Oct 2014)
      Sequence version 1 (01 Jun 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Facilitative glucose transporter By similarity. May have a specific function related to spermatogenesis.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei339 – 3391MonosaccharideBy similarity
    Binding sitei410 – 4101MonosaccharideBy similarity

    GO - Molecular functioni

    1. glucose transmembrane transporter activity Source: InterPro

    GO - Biological processi

    1. cell differentiation Source: UniProtKB-KW
    2. multicellular organismal development Source: UniProtKB-KW
    3. spermatogenesis Source: UniProtKB-KW

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Differentiation, Spermatogenesis, Sugar transport, Transport

    Protein family/group databases

    TCDBi2.A.1.1.90. the major facilitator superfamily (mfs).

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Solute carrier family 2, facilitated glucose transporter member 14
    Alternative name(s):
    Glucose transporter type 14
    Short name:
    GLUT-14
    Gene namesi
    Name:SLC2A14
    Synonyms:GLUT14, GLUT3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:18301. SLC2A14.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. nucleus Source: UniProt

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134885058.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 520520Solute carrier family 2, facilitated glucose transporter member 14PRO_0000050381Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi67 – 671N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ8TDB8.
    PRIDEiQ8TDB8.

    PTM databases

    PhosphoSiteiQ8TDB8.

    Expressioni

    Tissue specificityi

    Expressed mainly in testis.1 Publication

    Gene expression databases

    ArrayExpressiQ8TDB8.
    BgeeiQ8TDB8.
    CleanExiHS_SLC2A14.
    GenevestigatoriQ8TDB8.

    Organism-specific databases

    HPAiHPA006539.

    Interactioni

    Protein-protein interaction databases

    BioGridi126837. 2 interactions.
    STRINGi9606.ENSP00000340450.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8TDB8.
    SMRiQ8TDB8. Positions 33-490.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 2929CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini51 – 8838ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini110 – 1178CytoplasmicSequence Analysis
    Topological domaini139 – 14810ExtracellularSequence Analysis
    Topological domaini170 – 1778CytoplasmicSequence Analysis
    Topological domaini199 – 2079ExtracellularSequence Analysis
    Topological domaini229 – 29365CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini315 – 32814ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini350 – 3589CytoplasmicSequence Analysis
    Topological domaini380 – 39213ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini414 – 42310CytoplasmicSequence Analysis
    Topological domaini445 – 4517ExtracellularSequence Analysis
    Topological domaini473 – 52048CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei30 – 5021Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei89 – 10921Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei118 – 13821Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei149 – 16921Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei178 – 19821Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei208 – 22821Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei294 – 31421Helical; Name=7Sequence AnalysisAdd
    BLAST
    Transmembranei329 – 34921Helical; Name=8Sequence AnalysisAdd
    BLAST
    Transmembranei359 – 37921Helical; Name=9Sequence AnalysisAdd
    BLAST
    Transmembranei393 – 41321Helical; Name=10Sequence AnalysisAdd
    BLAST
    Transmembranei424 – 44421Helical; Name=11Sequence AnalysisAdd
    BLAST
    Transmembranei452 – 47221Helical; Name=12Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni304 – 3107Monosaccharide bindingBy similarity

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0477.
    HOGENOMiHOG000202871.
    HOVERGENiHBG014816.
    InParanoidiQ8TDB8.
    OrthoDBiEOG7QVM2R.
    PhylomeDBiQ8TDB8.
    TreeFamiTF313762.

    Family and domain databases

    InterProiIPR002945. Glc_transpt_3.
    IPR020846. MFS_dom.
    IPR016196. MFS_dom_general_subst_transpt.
    IPR005828. Sub_transporter.
    IPR003663. Sugar/inositol_transpt.
    IPR005829. Sugar_transporter_CS.
    [Graphical view]
    PfamiPF00083. Sugar_tr. 1 hit.
    [Graphical view]
    PRINTSiPR01192. GLUCTRSPORT3.
    PR00171. SUGRTRNSPORT.
    SUPFAMiSSF103473. SSF103473. 2 hits.
    TIGRFAMsiTIGR00879. SP. 1 hit.
    PROSITEiPS50850. MFS. 1 hit.
    PS00216. SUGAR_TRANSPORT_1. 1 hit.
    PS00217. SUGAR_TRANSPORT_2. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8TDB8-1) [UniParc]FASTAAdd to Basket

    Also known as: GLUT14-L

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEFHNGGHVS GIGGFLVSLT SRMKPHTLAV TPALIFAITV ATIGSFQFGY    50
    NTGVINAPET IIKEFINKTL TDKANAPPSE VLLTNLWSLS VAIFSVGGMI 100
    GSFSVGLFVN RFGRRNSMLI VNLLAATGGC LMGLCKIAES VEMLILGRLV 150
    IGLFCGLCTG FVPMYIGEIS PTALRGAFGT LNQLGIVIGI LVAQIFGLEL 200
    ILGSEELWPV LLGFTILPAI LQSAALPCCP ESPRFLLINR KKEENATRIL 250
    QRLWGTQDVS QDIQEMKDES ARMSQEKQVT VLELFRVSSY RQPIIISIVL 300
    QLSQQLSGIN AVFYYSTGIF KDAGVQQPIY ATISAGVVNT IFTLLSLFLV 350
    ERAGRRTLHM IGLGGMAFCS TLMTVSLLLK NHYNGMSFVC IGAILVFVAC 400
    FEIGPGPIPW FIVAELFSQG PRPAAMAVAG CSNWTSNFLV GLLFPSAAYY 450
    LGAYVFIIFT GFLITFLAFT FFKVPETRGR TFEDITRAFE GQAHGADRSG 500
    KDGVMGMNSI EPAKETTTNV 520
    Length:520
    Mass (Da):56,320
    Last modified:June 1, 2002 - v1
    Checksum:iEA304A5189087690
    GO
    Isoform 2 (identifier: Q8TDB8-2) [UniParc]FASTAAdd to Basket

    Also known as: GLUT14-S

    The sequence of this isoform differs from the canonical sequence as follows:
         1-29: MEFHNGGHVSGIGGFLVSLTSRMKPHTLA → MDNRQN

    Show »
    Length:497
    Mass (Da):54,015
    Checksum:iFF6DF71A86A6E8A6
    GO
    Isoform 3 (identifier: Q8TDB8-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-359: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:161
    Mass (Da):17,378
    Checksum:i9C169F3D73A4F34D
    GO
    Isoform 4 (identifier: Q8TDB8-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-113: MEFHNGGHVS...SVGLFVNRFG → MLLR

    Note: No experimental confirmation available.

    Show »
    Length:411
    Mass (Da):44,892
    Checksum:iF36A98F338E85697
    GO
    Isoform 5 (identifier: Q8TDB8-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-29: MEFHNGGHVSGIGGFLVSLTSRMKPHTLA → MQRLQLLRVEVLLGVKQGDEMRHFFFSSQTSTLEKSQNGGVGEE

    Note: No experimental confirmation available.

    Show »
    Length:535
    Mass (Da):58,249
    Checksum:i68FA09BC581B6156
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti369 – 3691C → G in AAQ63763. 1 PublicationCurated
    Sequence conflicti376 – 3772SL → PC in AAQ63763. 1 PublicationCurated
    Sequence conflicti456 – 4561F → L in CAB53739. (PubMed:17974005)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti506 – 5061G → E.
    Corresponds to variant rs10845981 [ dbSNP | Ensembl ].
    VAR_059852

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 359359Missing in isoform 3. 1 PublicationVSP_014449Add
    BLAST
    Alternative sequencei1 – 113113MEFHN…VNRFG → MLLR in isoform 4. 1 PublicationVSP_055253Add
    BLAST
    Alternative sequencei1 – 2929MEFHN…PHTLA → MDNRQN in isoform 2. 4 PublicationsVSP_014450Add
    BLAST
    Alternative sequencei1 – 2929MEFHN…PHTLA → MQRLQLLRVEVLLGVKQGDE MRHFFFSSQTSTLEKSQNGG VGEE in isoform 5. 1 PublicationVSP_055254Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF481878 mRNA. Translation: AAL89709.1.
    AF481879 mRNA. Translation: AAL89710.1.
    AY357941 mRNA. Translation: AAQ63763.1.
    AK122783 mRNA. Translation: BAG53727.1.
    AK126026 mRNA. Translation: BAG54279.1.
    AK302881 mRNA. Translation: BAH13830.1.
    AK316238 mRNA. Translation: BAH14609.1.
    AL110298 mRNA. Translation: CAB53739.2.
    AC006517 Genomic DNA. No translation available.
    AC007536 Genomic DNA. No translation available.
    AC124891 Genomic DNA. No translation available.
    CH471116 Genomic DNA. Translation: EAW88652.1.
    CH471116 Genomic DNA. Translation: EAW88653.1.
    BC060766 mRNA. Translation: AAH60766.1.
    CCDSiCCDS66300.1. [Q8TDB8-4]
    CCDS66301.1. [Q8TDB8-2]
    CCDS66302.1. [Q8TDB8-5]
    CCDS8585.1. [Q8TDB8-1]
    RefSeqiNP_001273162.1. NM_001286233.1. [Q8TDB8-1]
    NP_001273163.1. NM_001286234.1. [Q8TDB8-2]
    NP_001273164.1. NM_001286235.1. [Q8TDB8-2]
    NP_001273165.1. NM_001286236.1.
    NP_001273166.1. NM_001286237.1.
    NP_703150.1. NM_153449.3. [Q8TDB8-1]
    XP_005253372.1. XM_005253315.2. [Q8TDB8-2]
    XP_005253374.1. XM_005253317.2. [Q8TDB8-2]
    UniGeneiHs.655169.
    Hs.739527.

    Genome annotation databases

    EnsembliENST00000340749; ENSP00000340450; ENSG00000173262. [Q8TDB8-2]
    ENST00000396589; ENSP00000379834; ENSG00000173262. [Q8TDB8-1]
    ENST00000431042; ENSP00000407287; ENSG00000173262. [Q8TDB8-2]
    ENST00000535295; ENSP00000440492; ENSG00000173262. [Q8TDB8-4]
    ENST00000539924; ENSP00000445929; ENSG00000173262. [Q8TDB8-5]
    ENST00000542505; ENSP00000438484; ENSG00000173262. [Q8TDB8-3]
    ENST00000542546; ENSP00000443903; ENSG00000173262. [Q8TDB8-4]
    ENST00000543909; ENSP00000440480; ENSG00000173262. [Q8TDB8-1]
    GeneIDi144195.
    KEGGihsa:144195.
    UCSCiuc001qtk.3. human. [Q8TDB8-1]
    uc001qtl.3. human. [Q8TDB8-2]

    Polymorphism databases

    DMDMi68565598.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF481878 mRNA. Translation: AAL89709.1 .
    AF481879 mRNA. Translation: AAL89710.1 .
    AY357941 mRNA. Translation: AAQ63763.1 .
    AK122783 mRNA. Translation: BAG53727.1 .
    AK126026 mRNA. Translation: BAG54279.1 .
    AK302881 mRNA. Translation: BAH13830.1 .
    AK316238 mRNA. Translation: BAH14609.1 .
    AL110298 mRNA. Translation: CAB53739.2 .
    AC006517 Genomic DNA. No translation available.
    AC007536 Genomic DNA. No translation available.
    AC124891 Genomic DNA. No translation available.
    CH471116 Genomic DNA. Translation: EAW88652.1 .
    CH471116 Genomic DNA. Translation: EAW88653.1 .
    BC060766 mRNA. Translation: AAH60766.1 .
    CCDSi CCDS66300.1. [Q8TDB8-4 ]
    CCDS66301.1. [Q8TDB8-2 ]
    CCDS66302.1. [Q8TDB8-5 ]
    CCDS8585.1. [Q8TDB8-1 ]
    RefSeqi NP_001273162.1. NM_001286233.1. [Q8TDB8-1 ]
    NP_001273163.1. NM_001286234.1. [Q8TDB8-2 ]
    NP_001273164.1. NM_001286235.1. [Q8TDB8-2 ]
    NP_001273165.1. NM_001286236.1.
    NP_001273166.1. NM_001286237.1.
    NP_703150.1. NM_153449.3. [Q8TDB8-1 ]
    XP_005253372.1. XM_005253315.2. [Q8TDB8-2 ]
    XP_005253374.1. XM_005253317.2. [Q8TDB8-2 ]
    UniGenei Hs.655169.
    Hs.739527.

    3D structure databases

    ProteinModelPortali Q8TDB8.
    SMRi Q8TDB8. Positions 33-490.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 126837. 2 interactions.
    STRINGi 9606.ENSP00000340450.

    Protein family/group databases

    TCDBi 2.A.1.1.90. the major facilitator superfamily (mfs).

    PTM databases

    PhosphoSitei Q8TDB8.

    Polymorphism databases

    DMDMi 68565598.

    Proteomic databases

    PaxDbi Q8TDB8.
    PRIDEi Q8TDB8.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000340749 ; ENSP00000340450 ; ENSG00000173262 . [Q8TDB8-2 ]
    ENST00000396589 ; ENSP00000379834 ; ENSG00000173262 . [Q8TDB8-1 ]
    ENST00000431042 ; ENSP00000407287 ; ENSG00000173262 . [Q8TDB8-2 ]
    ENST00000535295 ; ENSP00000440492 ; ENSG00000173262 . [Q8TDB8-4 ]
    ENST00000539924 ; ENSP00000445929 ; ENSG00000173262 . [Q8TDB8-5 ]
    ENST00000542505 ; ENSP00000438484 ; ENSG00000173262 . [Q8TDB8-3 ]
    ENST00000542546 ; ENSP00000443903 ; ENSG00000173262 . [Q8TDB8-4 ]
    ENST00000543909 ; ENSP00000440480 ; ENSG00000173262 . [Q8TDB8-1 ]
    GeneIDi 144195.
    KEGGi hsa:144195.
    UCSCi uc001qtk.3. human. [Q8TDB8-1 ]
    uc001qtl.3. human. [Q8TDB8-2 ]

    Organism-specific databases

    CTDi 144195.
    GeneCardsi GC12M007965.
    HGNCi HGNC:18301. SLC2A14.
    HPAi HPA006539.
    MIMi 611039. gene.
    neXtProti NX_Q8TDB8.
    PharmGKBi PA134885058.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0477.
    HOGENOMi HOG000202871.
    HOVERGENi HBG014816.
    InParanoidi Q8TDB8.
    OrthoDBi EOG7QVM2R.
    PhylomeDBi Q8TDB8.
    TreeFami TF313762.

    Miscellaneous databases

    ChiTaRSi SLC2A14. human.
    GeneWikii SLC2A14.
    GenomeRNAii 144195.
    NextBioi 35480387.
    PROi Q8TDB8.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8TDB8.
    Bgeei Q8TDB8.
    CleanExi HS_SLC2A14.
    Genevestigatori Q8TDB8.

    Family and domain databases

    InterProi IPR002945. Glc_transpt_3.
    IPR020846. MFS_dom.
    IPR016196. MFS_dom_general_subst_transpt.
    IPR005828. Sub_transporter.
    IPR003663. Sugar/inositol_transpt.
    IPR005829. Sugar_transporter_CS.
    [Graphical view ]
    Pfami PF00083. Sugar_tr. 1 hit.
    [Graphical view ]
    PRINTSi PR01192. GLUCTRSPORT3.
    PR00171. SUGRTRNSPORT.
    SUPFAMi SSF103473. SSF103473. 2 hits.
    TIGRFAMsi TIGR00879. SP. 1 hit.
    PROSITEi PS50850. MFS. 1 hit.
    PS00216. SUGAR_TRANSPORT_1. 1 hit.
    PS00217. SUGAR_TRANSPORT_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "GLUT14, a duplicon of GLUT3, is specifically expressed in testis as alternative splice forms."
      Wu X., Freeze H.H.
      Genomics 80:553-557(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
      Tissue: Testis.
    2. "Cloning of an isoform of SCL2A14 gene related to spermatogenesis."
      Fang X., Wang H., Huo R., Lu L., Xu M., Xu Y.Z., Yin L.L., Li M.J., Zhou M.Z., Sha H.J.
      Submitted (SEP-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Testis.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 4 AND 5).
      Tissue: Testis.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Fetal brain.
    5. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Testis.

    Entry informationi

    Entry nameiGTR14_HUMAN
    AccessioniPrimary (citable) accession number: Q8TDB8
    Secondary accession number(s): B3KVB5
    , B3KWW7, B7Z844, B7ZAC3, Q6UY84, Q8TDB9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 5, 2005
    Last sequence update: June 1, 2002
    Last modified: October 1, 2014
    This is version 105 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    GLUT14 is a recent (less than 5 M year old) duplication of GLUT3.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3