SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8TDB8

- GTR14_HUMAN

UniProt

Q8TDB8 - GTR14_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Solute carrier family 2, facilitated glucose transporter member 14

Gene
SLC2A14, GLUT14, GLUT3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Facilitative glucose transporter By similarity. May have a specific function related to spermatogenesis.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei339 – 3391Monosaccharide By similarity
Binding sitei410 – 4101Monosaccharide By similarity

GO - Molecular functioni

  1. glucose transmembrane transporter activity Source: InterPro
  2. substrate-specific transmembrane transporter activity Source: InterPro

GO - Biological processi

  1. cell differentiation Source: UniProtKB-KW
  2. multicellular organismal development Source: UniProtKB-KW
  3. spermatogenesis Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Spermatogenesis, Sugar transport, Transport

Protein family/group databases

TCDBi2.A.1.1.90. the major facilitator superfamily (mfs).

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier family 2, facilitated glucose transporter member 14
Alternative name(s):
Glucose transporter type 14
Short name:
GLUT-14
Gene namesi
Name:SLC2A14
Synonyms:GLUT14, GLUT3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:18301. SLC2A14.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 2929Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei30 – 5021Helical; Name=1; Reviewed predictionAdd
BLAST
Topological domaini51 – 8838Extracellular Reviewed predictionAdd
BLAST
Transmembranei89 – 10921Helical; Name=2; Reviewed predictionAdd
BLAST
Topological domaini110 – 1178Cytoplasmic Reviewed prediction
Transmembranei118 – 13821Helical; Name=3; Reviewed predictionAdd
BLAST
Topological domaini139 – 14810Extracellular Reviewed prediction
Transmembranei149 – 16921Helical; Name=4; Reviewed predictionAdd
BLAST
Topological domaini170 – 1778Cytoplasmic Reviewed prediction
Transmembranei178 – 19821Helical; Name=5; Reviewed predictionAdd
BLAST
Topological domaini199 – 2079Extracellular Reviewed prediction
Transmembranei208 – 22821Helical; Name=6; Reviewed predictionAdd
BLAST
Topological domaini229 – 29365Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei294 – 31421Helical; Name=7; Reviewed predictionAdd
BLAST
Topological domaini315 – 32814Extracellular Reviewed predictionAdd
BLAST
Transmembranei329 – 34921Helical; Name=8; Reviewed predictionAdd
BLAST
Topological domaini350 – 3589Cytoplasmic Reviewed prediction
Transmembranei359 – 37921Helical; Name=9; Reviewed predictionAdd
BLAST
Topological domaini380 – 39213Extracellular Reviewed predictionAdd
BLAST
Transmembranei393 – 41321Helical; Name=10; Reviewed predictionAdd
BLAST
Topological domaini414 – 42310Cytoplasmic Reviewed prediction
Transmembranei424 – 44421Helical; Name=11; Reviewed predictionAdd
BLAST
Topological domaini445 – 4517Extracellular Reviewed prediction
Transmembranei452 – 47221Helical; Name=12; Reviewed predictionAdd
BLAST
Topological domaini473 – 52048Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. nucleus Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134885058.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 520520Solute carrier family 2, facilitated glucose transporter member 14PRO_0000050381Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi67 – 671N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ8TDB8.
PRIDEiQ8TDB8.

PTM databases

PhosphoSiteiQ8TDB8.

Expressioni

Tissue specificityi

Expressed mainly in testis.1 Publication

Gene expression databases

ArrayExpressiQ8TDB8.
BgeeiQ8TDB8.
CleanExiHS_SLC2A14.
GenevestigatoriQ8TDB8.

Organism-specific databases

HPAiHPA006539.

Interactioni

Protein-protein interaction databases

BioGridi126837. 2 interactions.
STRINGi9606.ENSP00000340450.

Structurei

3D structure databases

ProteinModelPortaliQ8TDB8.
SMRiQ8TDB8. Positions 33-490.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni304 – 3107Monosaccharide binding By similarity

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0477.
HOGENOMiHOG000202871.
HOVERGENiHBG014816.
InParanoidiQ8TDB8.
OrthoDBiEOG7QVM2R.
PhylomeDBiQ8TDB8.
TreeFamiTF313762.

Family and domain databases

InterProiIPR002945. Glc_transpt_3.
IPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
IPR005828. Sub_transporter.
IPR003663. Sugar/inositol_transpt.
IPR005829. Sugar_transporter_CS.
[Graphical view]
PfamiPF00083. Sugar_tr. 1 hit.
[Graphical view]
PRINTSiPR01192. GLUCTRSPORT3.
PR00171. SUGRTRNSPORT.
SUPFAMiSSF103473. SSF103473. 2 hits.
TIGRFAMsiTIGR00879. SP. 1 hit.
PROSITEiPS50850. MFS. 1 hit.
PS00216. SUGAR_TRANSPORT_1. 1 hit.
PS00217. SUGAR_TRANSPORT_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8TDB8-1) [UniParc]FASTAAdd to Basket

Also known as: GLUT14-L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEFHNGGHVS GIGGFLVSLT SRMKPHTLAV TPALIFAITV ATIGSFQFGY    50
NTGVINAPET IIKEFINKTL TDKANAPPSE VLLTNLWSLS VAIFSVGGMI 100
GSFSVGLFVN RFGRRNSMLI VNLLAATGGC LMGLCKIAES VEMLILGRLV 150
IGLFCGLCTG FVPMYIGEIS PTALRGAFGT LNQLGIVIGI LVAQIFGLEL 200
ILGSEELWPV LLGFTILPAI LQSAALPCCP ESPRFLLINR KKEENATRIL 250
QRLWGTQDVS QDIQEMKDES ARMSQEKQVT VLELFRVSSY RQPIIISIVL 300
QLSQQLSGIN AVFYYSTGIF KDAGVQQPIY ATISAGVVNT IFTLLSLFLV 350
ERAGRRTLHM IGLGGMAFCS TLMTVSLLLK NHYNGMSFVC IGAILVFVAC 400
FEIGPGPIPW FIVAELFSQG PRPAAMAVAG CSNWTSNFLV GLLFPSAAYY 450
LGAYVFIIFT GFLITFLAFT FFKVPETRGR TFEDITRAFE GQAHGADRSG 500
KDGVMGMNSI EPAKETTTNV 520
Length:520
Mass (Da):56,320
Last modified:June 1, 2002 - v1
Checksum:iEA304A5189087690
GO
Isoform 2 (identifier: Q8TDB8-2) [UniParc]FASTAAdd to Basket

Also known as: GLUT14-S

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MEFHNGGHVSGIGGFLVSLTSRMKPHTLA → MDNRQN

Show »
Length:497
Mass (Da):54,015
Checksum:iFF6DF71A86A6E8A6
GO
Isoform 3 (identifier: Q8TDB8-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-359: Missing.

Note: No experimental confirmation available.

Show »
Length:161
Mass (Da):17,378
Checksum:i9C169F3D73A4F34D
GO
Isoform 4 (identifier: Q8TDB8-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-113: MEFHNGGHVS...SVGLFVNRFG → MLLR

Note: No experimental confirmation available.

Show »
Length:411
Mass (Da):44,892
Checksum:iF36A98F338E85697
GO
Isoform 5 (identifier: Q8TDB8-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MEFHNGGHVSGIGGFLVSLTSRMKPHTLA → MQRLQLLRVEVLLGVKQGDEMRHFFFSSQTSTLEKSQNGGVGEE

Note: No experimental confirmation available.

Show »
Length:535
Mass (Da):58,249
Checksum:i68FA09BC581B6156
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti506 – 5061G → E.
Corresponds to variant rs10845981 [ dbSNP | Ensembl ].
VAR_059852

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 359359Missing in isoform 3. VSP_014449Add
BLAST
Alternative sequencei1 – 113113MEFHN…VNRFG → MLLR in isoform 4. VSP_055253Add
BLAST
Alternative sequencei1 – 2929MEFHN…PHTLA → MDNRQN in isoform 2. VSP_014450Add
BLAST
Alternative sequencei1 – 2929MEFHN…PHTLA → MQRLQLLRVEVLLGVKQGDE MRHFFFSSQTSTLEKSQNGG VGEE in isoform 5. VSP_055254Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti369 – 3691C → G in AAQ63763. 1 Publication
Sequence conflicti376 – 3772SL → PC in AAQ63763. 1 Publication
Sequence conflicti456 – 4561F → L in CAB53739. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF481878 mRNA. Translation: AAL89709.1.
AF481879 mRNA. Translation: AAL89710.1.
AY357941 mRNA. Translation: AAQ63763.1.
AK122783 mRNA. Translation: BAG53727.1.
AK126026 mRNA. Translation: BAG54279.1.
AK302881 mRNA. Translation: BAH13830.1.
AK316238 mRNA. Translation: BAH14609.1.
AL110298 mRNA. Translation: CAB53739.2.
AC006517 Genomic DNA. No translation available.
AC007536 Genomic DNA. No translation available.
AC124891 Genomic DNA. No translation available.
CH471116 Genomic DNA. Translation: EAW88652.1.
CH471116 Genomic DNA. Translation: EAW88653.1.
BC060766 mRNA. Translation: AAH60766.1.
CCDSiCCDS66301.1. [Q8TDB8-2]
CCDS8585.1. [Q8TDB8-1]
RefSeqiNP_001273162.1. NM_001286233.1. [Q8TDB8-1]
NP_001273163.1. NM_001286234.1. [Q8TDB8-2]
NP_001273164.1. NM_001286235.1. [Q8TDB8-2]
NP_001273165.1. NM_001286236.1.
NP_001273166.1. NM_001286237.1.
NP_703150.1. NM_153449.3. [Q8TDB8-1]
XP_005253372.1. XM_005253315.2. [Q8TDB8-2]
XP_005253374.1. XM_005253317.2. [Q8TDB8-2]
UniGeneiHs.655169.
Hs.739527.

Genome annotation databases

EnsembliENST00000340749; ENSP00000340450; ENSG00000173262. [Q8TDB8-2]
ENST00000396589; ENSP00000379834; ENSG00000173262. [Q8TDB8-1]
ENST00000431042; ENSP00000407287; ENSG00000173262. [Q8TDB8-2]
ENST00000535295; ENSP00000440492; ENSG00000173262.
ENST00000539924; ENSP00000445929; ENSG00000173262.
ENST00000542505; ENSP00000438484; ENSG00000173262. [Q8TDB8-3]
ENST00000543909; ENSP00000440480; ENSG00000173262. [Q8TDB8-1]
GeneIDi144195.
KEGGihsa:144195.
UCSCiuc001qtk.3. human. [Q8TDB8-1]
uc001qtl.3. human. [Q8TDB8-2]

Polymorphism databases

DMDMi68565598.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF481878 mRNA. Translation: AAL89709.1 .
AF481879 mRNA. Translation: AAL89710.1 .
AY357941 mRNA. Translation: AAQ63763.1 .
AK122783 mRNA. Translation: BAG53727.1 .
AK126026 mRNA. Translation: BAG54279.1 .
AK302881 mRNA. Translation: BAH13830.1 .
AK316238 mRNA. Translation: BAH14609.1 .
AL110298 mRNA. Translation: CAB53739.2 .
AC006517 Genomic DNA. No translation available.
AC007536 Genomic DNA. No translation available.
AC124891 Genomic DNA. No translation available.
CH471116 Genomic DNA. Translation: EAW88652.1 .
CH471116 Genomic DNA. Translation: EAW88653.1 .
BC060766 mRNA. Translation: AAH60766.1 .
CCDSi CCDS66301.1. [Q8TDB8-2 ]
CCDS8585.1. [Q8TDB8-1 ]
RefSeqi NP_001273162.1. NM_001286233.1. [Q8TDB8-1 ]
NP_001273163.1. NM_001286234.1. [Q8TDB8-2 ]
NP_001273164.1. NM_001286235.1. [Q8TDB8-2 ]
NP_001273165.1. NM_001286236.1.
NP_001273166.1. NM_001286237.1.
NP_703150.1. NM_153449.3. [Q8TDB8-1 ]
XP_005253372.1. XM_005253315.2. [Q8TDB8-2 ]
XP_005253374.1. XM_005253317.2. [Q8TDB8-2 ]
UniGenei Hs.655169.
Hs.739527.

3D structure databases

ProteinModelPortali Q8TDB8.
SMRi Q8TDB8. Positions 33-490.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 126837. 2 interactions.
STRINGi 9606.ENSP00000340450.

Protein family/group databases

TCDBi 2.A.1.1.90. the major facilitator superfamily (mfs).

PTM databases

PhosphoSitei Q8TDB8.

Polymorphism databases

DMDMi 68565598.

Proteomic databases

PaxDbi Q8TDB8.
PRIDEi Q8TDB8.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000340749 ; ENSP00000340450 ; ENSG00000173262 . [Q8TDB8-2 ]
ENST00000396589 ; ENSP00000379834 ; ENSG00000173262 . [Q8TDB8-1 ]
ENST00000431042 ; ENSP00000407287 ; ENSG00000173262 . [Q8TDB8-2 ]
ENST00000535295 ; ENSP00000440492 ; ENSG00000173262 .
ENST00000539924 ; ENSP00000445929 ; ENSG00000173262 .
ENST00000542505 ; ENSP00000438484 ; ENSG00000173262 . [Q8TDB8-3 ]
ENST00000543909 ; ENSP00000440480 ; ENSG00000173262 . [Q8TDB8-1 ]
GeneIDi 144195.
KEGGi hsa:144195.
UCSCi uc001qtk.3. human. [Q8TDB8-1 ]
uc001qtl.3. human. [Q8TDB8-2 ]

Organism-specific databases

CTDi 144195.
GeneCardsi GC12M007965.
HGNCi HGNC:18301. SLC2A14.
HPAi HPA006539.
MIMi 611039. gene.
neXtProti NX_Q8TDB8.
PharmGKBi PA134885058.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0477.
HOGENOMi HOG000202871.
HOVERGENi HBG014816.
InParanoidi Q8TDB8.
OrthoDBi EOG7QVM2R.
PhylomeDBi Q8TDB8.
TreeFami TF313762.

Miscellaneous databases

ChiTaRSi SLC2A14. human.
GeneWikii SLC2A14.
GenomeRNAii 144195.
NextBioi 35480387.
PROi Q8TDB8.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8TDB8.
Bgeei Q8TDB8.
CleanExi HS_SLC2A14.
Genevestigatori Q8TDB8.

Family and domain databases

InterProi IPR002945. Glc_transpt_3.
IPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
IPR005828. Sub_transporter.
IPR003663. Sugar/inositol_transpt.
IPR005829. Sugar_transporter_CS.
[Graphical view ]
Pfami PF00083. Sugar_tr. 1 hit.
[Graphical view ]
PRINTSi PR01192. GLUCTRSPORT3.
PR00171. SUGRTRNSPORT.
SUPFAMi SSF103473. SSF103473. 2 hits.
TIGRFAMsi TIGR00879. SP. 1 hit.
PROSITEi PS50850. MFS. 1 hit.
PS00216. SUGAR_TRANSPORT_1. 1 hit.
PS00217. SUGAR_TRANSPORT_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "GLUT14, a duplicon of GLUT3, is specifically expressed in testis as alternative splice forms."
    Wu X., Freeze H.H.
    Genomics 80:553-557(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
    Tissue: Testis.
  2. "Cloning of an isoform of SCL2A14 gene related to spermatogenesis."
    Fang X., Wang H., Huo R., Lu L., Xu M., Xu Y.Z., Yin L.L., Li M.J., Zhou M.Z., Sha H.J.
    Submitted (SEP-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Testis.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 4 AND 5).
    Tissue: Testis.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Fetal brain.
  5. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.

Entry informationi

Entry nameiGTR14_HUMAN
AccessioniPrimary (citable) accession number: Q8TDB8
Secondary accession number(s): B3KVB5
, B3KWW7, B7Z844, B7ZAC3, Q6UY84, Q8TDB9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: June 1, 2002
Last modified: September 3, 2014
This is version 104 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

GLUT14 is a recent (less than 5 M year old) duplication of GLUT3.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi