SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8TD57

- DYH3_HUMAN

UniProt

Q8TD57 - DYH3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Dynein heavy chain 3, axonemal
Gene
DNAH3, DNAHC3B
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Involved in sperm motility; implicated in sperm flagellar assembly By similarity.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi1429 – 14368ATP Reviewed prediction
Nucleotide bindingi1710 – 17178ATP Reviewed prediction
Nucleotide bindingi2074 – 20818ATP Reviewed prediction
Nucleotide bindingi2434 – 24418ATP Reviewed prediction

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. microtubule motor activity Source: UniProtKB

GO - Biological processi

  1. cilium or flagellum-dependent cell motility Source: UniProtKB
  2. metabolic process Source: GOC
  3. microtubule-based movement Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Motor protein

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Dynein heavy chain 3, axonemal
Alternative name(s):
Axonemal beta dynein heavy chain 3
Short name:
HsADHC3
Ciliary dynein heavy chain 3
Dnahc3-b
Gene namesi
Name:DNAH3
Synonyms:DNAHC3B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:2949. DNAH3.

Subcellular locationi

Cytoplasmcytoskeletoncilium axoneme Reviewed prediction

GO - Cellular componenti

  1. axonemal dynein complex Source: UniProtKB
  2. microtubule Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Dynein, Microtubule

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27402.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 41164116Dynein heavy chain 3, axonemal
PRO_0000322544Add
BLAST

Proteomic databases

MaxQBiQ8TD57.
PaxDbiQ8TD57.
PRIDEiQ8TD57.

PTM databases

PhosphoSiteiQ8TD57.

Expressioni

Tissue specificityi

Expressed primarily in trachea and testis, 2 tissues containing axonemal structures. Also expressed in lung.1 Publication

Gene expression databases

BgeeiQ8TD57.
GenevestigatoriQ8TD57.

Organism-specific databases

HPAiHPA062493.

Interactioni

Subunit structurei

Consists of at least two heavy chains and a number of intermediate and light chains.

Protein-protein interaction databases

BioGridi120722. 1 interaction.
IntActiQ8TD57. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ8TD57.
SMRiQ8TD57. Positions 1001-1852, 2430-2457, 2757-2911, 3562-3769.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 13901390Stem By similarity
Add
BLAST
Regioni1391 – 1612222AAA 1 By similarity
Add
BLAST
Regioni1672 – 1903232AAA 2 By similarity
Add
BLAST
Regioni2036 – 2284249AAA 3 By similarity
Add
BLAST
Regioni2395 – 2646252AAA 4 By similarity
Add
BLAST
Regioni2661 – 2960300Stalk By similarity
Add
BLAST
Regioni3045 – 3275231AAA 5 By similarity
Add
BLAST
Regioni3488 – 3712225AAA 6 By similarity
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili785 – 85268 Reviewed prediction
Add
BLAST

Domaini

Dynein heavy chains probably consist of an N-terminal stem (which binds cargo and interacts with other dynein components), and the head or motor domain. The motor contains six tandemly-linked AAA domains in the head, which form a ring. A stalk-like structure (formed by two of the coiled coil domains) protrudes between AAA 4 and AAA 5 and terminates in a microtubule-binding site. A seventh domain may also contribute to this ring; it is not clear whether the N-terminus or the C-terminus forms this extra domain. There are four well-conserved and two non-conserved ATPase sites, one per AAA domain. Probably only one of these (within AAA 1) actually hydrolyzes ATP, the others may serve a regulatory function By similarity.

Sequence similaritiesi

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiCOG5245.
HOVERGENiHBG107830.
InParanoidiQ8TD57.
KOiK10408.
OMAiLQCKFVV.
OrthoDBiEOG7BW0HH.
PhylomeDBiQ8TD57.
TreeFamiTF316836.

Family and domain databases

Gene3Di3.40.50.300. 5 hits.
InterProiIPR003593. AAA+_ATPase.
IPR026983. DHC_fam.
IPR024743. Dynein_HC_stalk.
IPR024317. Dynein_heavy_chain_D4_dom.
IPR004273. Dynein_heavy_dom.
IPR013602. Dynein_heavy_dom-2.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR10676. PTHR10676. 1 hit.
PfamiPF12780. AAA_8. 1 hit.
PF08393. DHC_N2. 1 hit.
PF03028. Dynein_heavy. 1 hit.
PF12777. MT. 1 hit.
[Graphical view]
SMARTiSM00382. AAA. 2 hits.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 5 hits.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8TD57-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGATGRLELT LAAPPHPGPA FQRSKARETQ GEEEGSEMQI AKSDSIHHMS     50
HSQGQPELPP LPASANEEPS GLYQTVMSHS FYPPLMQRTS WTLAAPFKEQ 100
HHHRGPSDSI ANNYSLMAQD LKLKDLLKVY QPATISVPRD RTGQGLPSSG 150
NRSSSEPMRK KTKFSSRNKE DSTRIKLAFK TSIFSPMKKE VKTSLTFPGS 200
RPMSPEQQLD VMLQQEMEME SKEKKPSESD LERYYYYLTN GIRKDMIAPE 250
EGEVMVRISK LISNTLLTSP FLEPLMVVLV QEKENDYYCS LMKSIVDYIL 300
MDPMERKRLF IESIPRLFPQ RVIRAPVPWH SVYRSAKKWN EEHLHTVNPM 350
MLRLKELWFA EFRDLRFVRT AEILAGKLPL QPQEFWDVIQ KHCLEAHQTL 400
LNKWIPTCAQ LFTSRKEHWI HFAPKSNYDS SRNIEEYFAS VASFMSLQLR 450
ELVIKSLEDL VSLFMIHKDG NDFKEPYQEM KFFIPQLIMI KLEVSEPIIV 500
FNPSFDGCWE LIRDSFLEII KNSNGIPKLK YIPLKFSFTA AAADRQCVKA 550
AEPGEPSMHA AATAMAELKG YNLLLGTVNA EEKLVSDFLI QTFKVFQKNQ 600
VGPCKYLNVY KKYVDLLDNT AEQNIAAFLK ENHDIDDFVT KINAIKKRRN 650
EIASMNITVP LAMFCLDATA LNHDLCERAQ NLKDHLIQFQ VDVNRDTNTS 700
ICNQYSHIAD KVSEVPANTK ELVSLIEFLK KSSAVTVFKL RRQLRDASER 750
LEFLMDYADL PYQIEDIFDN SRNLLLHKRD QAEMDLIKRC SEFELRLEGY 800
HRELESFRKR EVMTTEEMKH NVEKLNELSK NLNRAFAEFE LINKEEELLE 850
KEKSTYPLLQ AMLKNKVPYE QLWSTAYEFS IKSEEWMNGP LFLLNAEQIA 900
EEIGNMWRTT YKLIKTLSDV PAPRRLAENV KIKIDKFKQY IPILSISCNP 950
GMKDRHWQQI SEIVGYEIKP TETTCLSNML EFGFGKFVEK LEPIGAAASK 1000
EYSLEKNLDR MKLDWVNVTF SFVKYRDTDT NILCAIDDIQ MLLDDHVIKT 1050
QTMCGSPFIK PIEAECRKWE EKLIRIQDNL DAWLKCQATW LYLEPIFSSE 1100
DIIAQMPEEG RKFGIVDSYW KSLMSQAVKD NRILVAADQP RMAEKLQEAN 1150
FLLEDIQKGL NDYLEKKRLF FPRFFFLSND ELLEILSETK DPLRVQPHLK 1200
KCFEGIAKLE FTDNLEIVGM ISSEKETVPF IQKIYPANAK GMVEKWLQQV 1250
EQMMLASMRE VIGLGIEAYV KVPRNHWVLQ WPGQVVICVS SIFWTQEVSQ 1300
ALAENTLLDF LKKSNDQIAQ IVQLVRGKLS SGARLTLGAL TVIDVHARDV 1350
VAKLSEDRVS DLNDFQWISQ LRYYWVAKDV QVQIITTEAL YGYEYLGNSP 1400
RLVITPLTDR CYRTLMGALK LNLGGAPEGP AGTGKTETTK DLAKALAKQC 1450
VVFNCSDGLD YKAMGKFFKG LAQAGAWACF DEFNRIEVEV LSVVAQQILS 1500
IQQAIIRKLK TFIFEGTELS LNPTCAVFIT MNPGYAGRAE LPDNLKALFR 1550
TVAMMVPDYA LIGEISLYSM GFLDSRSLAQ KIVATYRLCS EQLSSQHHYD 1600
YGMRAVKSVL TAAGNLKLKY PEENESVLLL RALLDVNLAK FLAQDVPLFQ 1650
GIISDLFPGV VLPKPDYEVF LKVLNDNIKK MKLQPVPWFI GKIIQIYEMM 1700
LVRHGYMIVG DPMGGKTSAY KVLAAALGDL HAANQMEEFA VEYKIINPKA 1750
ITMGQLYGCF DQVSHEWMDG VLANAFREQA SSLSDDRKWI IFDGPVDAIW 1800
IENMNTVLDD NKKLCLMSGE IIQMNSKMSL IFEPADLEQA SPATVSRCGM 1850
IYMEPHQLGW KPLKDSYMDT LPSSLTKEHK ELVNDMFMWL VQPCLEFGRL 1900
HCKFVVQTSP IHLAFSMMRL YSSLLDEIRA VEEEEMELGE GLSSQQIFLW 1950
LQGLFLFSLV WTVAGTINAD SRKKFDVFFR NLIMGMDDNH PRPKSVKLTK 2000
NNIFPERGSI YDFYFIKQAS GHWETWTQYI TKEEEKVPAG AKVSELIIPT 2050
METARQSFFL KTYLDHEIPM LFVGPTGTGK SAITNNFLLH LPKNTYLPNC 2100
INFSARTSAN QTQDIIMSKL DRRRKGLFGP PIGKKAVVFV DDLNMPAKEV 2150
YGAQPPIELL RQWIDHGYWF DKKDTTRLDI VDMLLVTAMG PPGGGRNDIT 2200
GRFTRHLNII SINAFEDDIL TKIFSSIVDW HFGKGFDVMF LRYGKMLVQA 2250
TKTIYRDAVE NFLPTPSKSH YVFNLRDFSR VIQGVLLCPH THLQDVEKCI 2300
RLWIHEVYRV FYDRLIDKED RQVFFNMVKE TTSNCFKQTI EKVLIHLSPT 2350
GKIVDDNIRS LFFGDYFKPE SDQKIYDEIT DLKQLTVVME HYLEEFNNIS 2400
KAPMSLVMFR FAIEHISRIC RVLKQDKGHL LLVGIGGSGR QSAAKLSTFM 2450
NAYELYQIEI TKNYAGNDWR EDLKKIILQV GVATKSTVFL FADNQIKDES 2500
FVEDINMLLN TGDVPNIFPA DEKADIVEKM QTAARTQGEK VEVTPLSMYN 2550
FFIERVINKI SFSLAMSPIG DAFRNRLRMF PSLINCCTID WFQSWPTDAL 2600
ELVANKFLED VELDDNIRVE VVSMCKYFQE SVKKLSLDYY NKLRRHNYVT 2650
PTSYLELILT FKTLLNSKRQ EVAMMRNRYL TGLQKLDFAA SQVAVMQREL 2700
TALQPQLILT SEETAKMMVK IEAETREADG KKLLVQADEK EANVAAAIAQ 2750
GIKNECEGDL AEAMPALEAA LAALDTLNPA DISLVKSMQN PPGPVKLVME 2800
SICIMKGMKP ERKPDPSGSG KMIEDYWGVS KKILGDLKFL ESLKTYDKDN 2850
IPPLTMKRIR ERFINHPEFQ PAVIKNVSSA CEGLCKWVRA MEVYDRVAKV 2900
VAPKRERLRE AEGKLAAQMQ KLNQKRAELK LVVDRLQALN DDFEEMNTKK 2950
KDLEENIEIC SQKLVRAEKL ISGLGGEKDR WTEAARQLGI RYTNLTGDVL 3000
LSSGTVAYLG AFTVDYRVQC QNQWLAECKD KVIPGFSDFS LSHTLGDPIK 3050
IRAWQIAGLP VDSFSIDNGI IVSNSRRWAL MIDPHGQANK WIKNMEKANK 3100
LAVIKFSDSN YMRMLENALQ LGTPVLIENI GEELDASIEP ILLKATFKQQ 3150
GVEYMRLGEN IIEYSRDFKL YITTRLRNPH YLPEVAVKVC LLNFMITPLG 3200
LQDQLLGIVA AKEKPELEEK KNQLIVESAK NKKHLKEIED KILEVLSMSK 3250
GNILEDETAI KVLSSSKVLS EEISEKQKVA SMTETQIDET RMGYKPVAVH 3300
SATIFFCISD LANIEPMYQY SLTWFINLYM HSLTHSTKSE ELNLRIKYII 3350
DHFTLSIYNN VCRSLFEKDK LLFSLLLTIG IMKQKKEITE EVWYFLLTGG 3400
IALDNPYPNP APQWLSEKAW AEIVRASALP KLHGLMEHLE QNLGEWKLIY 3450
DSAWPHEEQL PGSWKFSQGL EKMVILRCLR PDKMVPAVRE FIAEHMGKLY 3500
IEAPTFDLQG SYNDSSCCAP LIFVLSPSAD PMAGLLKFAD DLGMGGTRTQ 3550
TISLGQGQGP IAAKMINNAI KDGTWVVLQN CHLAASWMPT LEKICEEVIV 3600
PESTNARFRL WLTSYPSEKF PVSILQNGIK MTNEPPKGLR ANLLRSYLND 3650
PISDPVFFQS CAKAVMWQKM LFGLCFFHAV VQERRNFGPL GWNIPYEFNE 3700
SDLRISMWQI QMFLNDYKEV PFDALTYLTG ECNYGGRVTD DKDRRLLLSL 3750
LSMFYCKEIE EDYYSLAPGD TYYIPPHGSY QSYIDYLRNL PITAHPEVFG 3800
LHENADITKD NQETNQLFEG VLLTLPRQSG GSGKSPQEVV EELAQDILSK 3850
LPRDFDLEEV MKLYPVVYEE SMNTVLRQEL IRFNRLTKVV RRSLINLGRA 3900
IKGQVLMSSE LEEVFNSMLV GKVPAMWAAK SYPSLKPLGG YVADLLARLT 3950
FFQEWIDKGP PVVFWISGFY FTQSFLTGVS QNYARKYTIP IDHIGFEFEV 4000
TPQETVMENN PEDGAYIKGL FLEGARWDRK TMQIGESLPK ILYDPLPIIW 4050
LKPGESAMFL HQDIYVCPVY KTSARRGTLS TTGHSTNYVL SIELPTDMPQ 4100
KHWINRGVAS LCQLDN 4116
Length:4,116
Mass (Da):470,771
Last modified:June 1, 2002 - v1
Checksum:iAF387246540D9DF2
GO
Isoform 2 (identifier: Q8TD57-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MGATGRLELTLAAPPHPGPAFQRSKARETQGEEEGSEMQ → MGDMDCSSQK
     528-566: KLKYIPLKFSFTAAAADRQCVKAAEPGEPSMHAAATAMA → KVESVLFP
     762-762: Y → YEDIKLNSTLFLWPD
     790-799: CSEFELRLEG → YRESLGLSWK
     800-4116: Missing.

Note: No experimental confirmation available.

Show »
Length:753
Mass (Da):87,501
Checksum:i0BDED2AED898AD0C
GO
Isoform 3 (identifier: Q8TD57-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1883-1887: VNDMF → MKSGQ
     1888-4116: Missing.

Note: No experimental confirmation available.

Show »
Length:1,887
Mass (Da):216,078
Checksum:iDC3B4B00F469AD22
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti484 – 4841I → L in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_039412
Natural varianti545 – 5451R → W.
Corresponds to variant rs16970910 [ dbSNP | Ensembl ].
VAR_039413
Natural varianti1565 – 15651I → M.
Corresponds to variant rs330150 [ dbSNP | Ensembl ].
VAR_039414
Natural varianti1583 – 15831V → I.
Corresponds to variant rs16970832 [ dbSNP | Ensembl ].
VAR_039415
Natural varianti1608 – 16081S → F in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_039416
Natural varianti1752 – 17521T → M.
Corresponds to variant rs13332291 [ dbSNP | Ensembl ].
VAR_039417
Natural varianti2399 – 23991I → N.
Corresponds to variant rs34179606 [ dbSNP | Ensembl ].
VAR_039418
Natural varianti2804 – 28041I → V.
Corresponds to variant rs12929546 [ dbSNP | Ensembl ].
VAR_039419
Natural varianti2949 – 29491K → T.
Corresponds to variant rs33928718 [ dbSNP | Ensembl ].
VAR_039420
Natural varianti3457 – 34571E → K.
Corresponds to variant rs3743695 [ dbSNP | Ensembl ].
VAR_039421
Natural varianti3639 – 36391L → I.
Corresponds to variant rs34771199 [ dbSNP | Ensembl ].
VAR_039422
Natural varianti3645 – 36451R → C.
Corresponds to variant rs12924551 [ dbSNP | Ensembl ].
VAR_039423
Natural varianti3744 – 37441R → W.
Corresponds to variant rs2301620 [ dbSNP | Ensembl ].
VAR_039424

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3939MGATG…GSEMQ → MGDMDCSSQK in isoform 2.
VSP_031919Add
BLAST
Alternative sequencei528 – 56639KLKYI…ATAMA → KVESVLFP in isoform 2.
VSP_031920Add
BLAST
Alternative sequencei762 – 7621Y → YEDIKLNSTLFLWPD in isoform 2.
VSP_031921
Alternative sequencei790 – 79910CSEFELRLEG → YRESLGLSWK in isoform 2.
VSP_031922
Alternative sequencei800 – 41163317Missing in isoform 2.
VSP_031923Add
BLAST
Alternative sequencei1883 – 18875VNDMF → MKSGQ in isoform 3.
VSP_031924
Alternative sequencei1888 – 41162229Missing in isoform 3.
VSP_031925Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1393 – 13931Y → F in CAA10558. 1 Publication
Sequence conflicti1441 – 14411D → V in CAB06059. 1 Publication
Sequence conflicti1601 – 16044YGMR → FGLH in CAB06059. 1 Publication
Sequence conflicti3828 – 38281Q → M in CAB46377. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF494040 mRNA. Translation: AAM12861.1.
AK056509 mRNA. Translation: BAE46616.1.
CH471228 Genomic DNA. Translation: EAW66851.1.
AJ132085 mRNA. Translation: CAA10558.1.
AJ132092 Genomic DNA. Translation: CAA10565.1.
Z83805 mRNA. Translation: CAB06059.1.
U83574 Genomic DNA. Translation: AAB82763.1.
BC019878 mRNA. Translation: AAH19878.1.
AL096732 mRNA. Translation: CAB46377.1.
AC002394 Genomic DNA. Translation: AAC05809.1.
CCDSiCCDS10594.1. [Q8TD57-1]
PIRiT12545.
RefSeqiNP_060009.1. NM_017539.1. [Q8TD57-1]
UniGeneiHs.526500.

Genome annotation databases

EnsembliENST00000261383; ENSP00000261383; ENSG00000158486. [Q8TD57-1]
ENST00000415178; ENSP00000394245; ENSG00000158486. [Q8TD57-3]
GeneIDi55567.
KEGGihsa:55567.
UCSCiuc002die.2. human. [Q8TD57-2]
uc010vbe.2. human. [Q8TD57-1]

Polymorphism databases

DMDMi74762616.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF494040 mRNA. Translation: AAM12861.1 .
AK056509 mRNA. Translation: BAE46616.1 .
CH471228 Genomic DNA. Translation: EAW66851.1 .
AJ132085 mRNA. Translation: CAA10558.1 .
AJ132092 Genomic DNA. Translation: CAA10565.1 .
Z83805 mRNA. Translation: CAB06059.1 .
U83574 Genomic DNA. Translation: AAB82763.1 .
BC019878 mRNA. Translation: AAH19878.1 .
AL096732 mRNA. Translation: CAB46377.1 .
AC002394 Genomic DNA. Translation: AAC05809.1 .
CCDSi CCDS10594.1. [Q8TD57-1 ]
PIRi T12545.
RefSeqi NP_060009.1. NM_017539.1. [Q8TD57-1 ]
UniGenei Hs.526500.

3D structure databases

ProteinModelPortali Q8TD57.
SMRi Q8TD57. Positions 1001-1852, 2430-2457, 2757-2911, 3562-3769.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120722. 1 interaction.
IntActi Q8TD57. 1 interaction.

PTM databases

PhosphoSitei Q8TD57.

Polymorphism databases

DMDMi 74762616.

Proteomic databases

MaxQBi Q8TD57.
PaxDbi Q8TD57.
PRIDEi Q8TD57.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000261383 ; ENSP00000261383 ; ENSG00000158486 . [Q8TD57-1 ]
ENST00000415178 ; ENSP00000394245 ; ENSG00000158486 . [Q8TD57-3 ]
GeneIDi 55567.
KEGGi hsa:55567.
UCSCi uc002die.2. human. [Q8TD57-2 ]
uc010vbe.2. human. [Q8TD57-1 ]

Organism-specific databases

CTDi 55567.
GeneCardsi GC16M020944.
HGNCi HGNC:2949. DNAH3.
HPAi HPA062493.
MIMi 603334. gene.
neXtProti NX_Q8TD57.
PharmGKBi PA27402.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5245.
HOVERGENi HBG107830.
InParanoidi Q8TD57.
KOi K10408.
OMAi LQCKFVV.
OrthoDBi EOG7BW0HH.
PhylomeDBi Q8TD57.
TreeFami TF316836.

Miscellaneous databases

GenomeRNAii 55567.
NextBioi 60052.
PROi Q8TD57.
SOURCEi Search...

Gene expression databases

Bgeei Q8TD57.
Genevestigatori Q8TD57.

Family and domain databases

Gene3Di 3.40.50.300. 5 hits.
InterProi IPR003593. AAA+_ATPase.
IPR026983. DHC_fam.
IPR024743. Dynein_HC_stalk.
IPR024317. Dynein_heavy_chain_D4_dom.
IPR004273. Dynein_heavy_dom.
IPR013602. Dynein_heavy_dom-2.
IPR027417. P-loop_NTPase.
[Graphical view ]
PANTHERi PTHR10676. PTHR10676. 1 hit.
Pfami PF12780. AAA_8. 1 hit.
PF08393. DHC_N2. 1 hit.
PF03028. Dynein_heavy. 1 hit.
PF12777. MT. 1 hit.
[Graphical view ]
SMARTi SM00382. AAA. 2 hits.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 5 hits.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "DNAH3: characterization of the full length gene and mutation search in patients with primary ciliary dyskinesia."
    Blouin J.-L., Gehrig C., Jeganathan D., Bartoloni L., Rossier C., Duriaux Sail G., Scamuffa N., Mitchison H.M., DeLozier Blanchet C.D., Antonarakis S.E.
    Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "Chromosomal localization of human dynein heavy chain genes."
    Maiti A.K., Mattei M.-G., Jorissen M., Volz A., Ziegler A., Bouvagnet P.
    Submitted (JAN-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1391-1533 (ISOFORM 1), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1435-1449.
    Tissue: Nasal polyp.
  5. "Identification of dynein heavy chain genes expressed in human and mouse testis: chromosomal localization of an axonemal dynein gene."
    Neesen J., Koehler M.R., Kirschner R., Steinlein C., Kreutzberger J., Engel W., Schmid M.
    Gene 200:193-202(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1429-1605 (ISOFORM 1).
    Tissue: Testis.
  6. "Isolation of several human axonemal dynein heavy chain genes: genomic structure of the catalytic site, phylogenetic analysis and chromosomal assignment."
    Chapelin C., Duriez B., Magnino F., Goossens M., Escudier E., Amselem S.
    FEBS Lett. 412:325-330(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1429-1478, TISSUE SPECIFICITY.
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1574-4116 (ISOFORM 3).
    Tissue: Ovary.
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3152-4116 (ISOFORM 1).
    Tissue: Testis.
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] OF 3544-4116.
  10. Cited for: VARIANTS [LARGE SCALE ANALYSIS] LEU-484 AND PHE-1608.

Entry informationi

Entry nameiDYH3_HUMAN
AccessioniPrimary (citable) accession number: Q8TD57
Secondary accession number(s): O00437
, O15437, O43326, Q3C0H2, Q8WUP9, Q9UEM3, Q9UEM5, Q9UG35
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: June 1, 2002
Last modified: July 9, 2014
This is version 96 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi