Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8TD57 (DYH3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 93. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Dynein heavy chain 3, axonemal
Alternative name(s):
Axonemal beta dynein heavy chain 3
Short name=HsADHC3
Ciliary dynein heavy chain 3
Dnahc3-b
Gene names
Name:DNAH3
Synonyms:DNAHC3B
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length4116 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Involved in sperm motility; implicated in sperm flagellar assembly By similarity.

Subunit structure

Consists of at least two heavy chains and a number of intermediate and light chains.

Subcellular location

Cytoplasmcytoskeletoncilium axoneme Potential.

Tissue specificity

Expressed primarily in trachea and testis, 2 tissues containing axonemal structures. Also expressed in lung. Ref.6

Domain

Dynein heavy chains probably consist of an N-terminal stem (which binds cargo and interacts with other dynein components), and the head or motor domain. The motor contains six tandemly-linked AAA domains in the head, which form a ring. A stalk-like structure (formed by two of the coiled coil domains) protrudes between AAA 4 and AAA 5 and terminates in a microtubule-binding site. A seventh domain may also contribute to this ring; it is not clear whether the N-terminus or the C-terminus forms this extra domain. There are four well-conserved and two non-conserved ATPase sites, one per AAA domain. Probably only one of these (within AAA 1) actually hydrolyzes ATP, the others may serve a regulatory function By similarity.

Sequence similarities

Belongs to the dynein heavy chain family.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8TD57-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8TD57-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MGATGRLELTLAAPPHPGPAFQRSKARETQGEEEGSEMQ → MGDMDCSSQK
     528-566: KLKYIPLKFSFTAAAADRQCVKAAEPGEPSMHAAATAMA → KVESVLFP
     762-762: Y → YEDIKLNSTLFLWPD
     790-799: CSEFELRLEG → YRESLGLSWK
     800-4116: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q8TD57-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1883-1887: VNDMF → MKSGQ
     1888-4116: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 41164116Dynein heavy chain 3, axonemal
PRO_0000322544

Regions

Nucleotide binding1429 – 14368ATP Potential
Nucleotide binding1710 – 17178ATP Potential
Nucleotide binding2074 – 20818ATP Potential
Nucleotide binding2434 – 24418ATP Potential
Region1 – 13901390Stem By similarity
Region1391 – 1612222AAA 1 By similarity
Region1672 – 1903232AAA 2 By similarity
Region2036 – 2284249AAA 3 By similarity
Region2395 – 2646252AAA 4 By similarity
Region2661 – 2960300Stalk By similarity
Region3045 – 3275231AAA 5 By similarity
Region3488 – 3712225AAA 6 By similarity
Coiled coil785 – 85268 Potential

Natural variations

Alternative sequence1 – 3939MGATG…GSEMQ → MGDMDCSSQK in isoform 2.
VSP_031919
Alternative sequence528 – 56639KLKYI…ATAMA → KVESVLFP in isoform 2.
VSP_031920
Alternative sequence7621Y → YEDIKLNSTLFLWPD in isoform 2.
VSP_031921
Alternative sequence790 – 79910CSEFELRLEG → YRESLGLSWK in isoform 2.
VSP_031922
Alternative sequence800 – 41163317Missing in isoform 2.
VSP_031923
Alternative sequence1883 – 18875VNDMF → MKSGQ in isoform 3.
VSP_031924
Alternative sequence1888 – 41162229Missing in isoform 3.
VSP_031925
Natural variant4841I → L in a colorectal cancer sample; somatic mutation. Ref.10
VAR_039412
Natural variant5451R → W.
Corresponds to variant rs16970910 [ dbSNP | Ensembl ].
VAR_039413
Natural variant15651I → M.
Corresponds to variant rs330150 [ dbSNP | Ensembl ].
VAR_039414
Natural variant15831V → I.
Corresponds to variant rs16970832 [ dbSNP | Ensembl ].
VAR_039415
Natural variant16081S → F in a colorectal cancer sample; somatic mutation. Ref.10
VAR_039416
Natural variant17521T → M.
Corresponds to variant rs13332291 [ dbSNP | Ensembl ].
VAR_039417
Natural variant23991I → N.
Corresponds to variant rs34179606 [ dbSNP | Ensembl ].
VAR_039418
Natural variant28041I → V.
Corresponds to variant rs12929546 [ dbSNP | Ensembl ].
VAR_039419
Natural variant29491K → T.
Corresponds to variant rs33928718 [ dbSNP | Ensembl ].
VAR_039420
Natural variant34571E → K.
Corresponds to variant rs3743695 [ dbSNP | Ensembl ].
VAR_039421
Natural variant36391L → I.
Corresponds to variant rs34771199 [ dbSNP | Ensembl ].
VAR_039422
Natural variant36451R → C.
Corresponds to variant rs12924551 [ dbSNP | Ensembl ].
VAR_039423
Natural variant37441R → W.
Corresponds to variant rs2301620 [ dbSNP | Ensembl ].
VAR_039424

Experimental info

Sequence conflict13931Y → F in CAA10558. Ref.4
Sequence conflict14411D → V in CAB06059. Ref.5
Sequence conflict1601 – 16044YGMR → FGLH in CAB06059. Ref.5
Sequence conflict38281Q → M in CAB46377. Ref.8

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2002. Version 1.
Checksum: AF387246540D9DF2

FASTA4,116470,771
        10         20         30         40         50         60 
MGATGRLELT LAAPPHPGPA FQRSKARETQ GEEEGSEMQI AKSDSIHHMS HSQGQPELPP 

        70         80         90        100        110        120 
LPASANEEPS GLYQTVMSHS FYPPLMQRTS WTLAAPFKEQ HHHRGPSDSI ANNYSLMAQD 

       130        140        150        160        170        180 
LKLKDLLKVY QPATISVPRD RTGQGLPSSG NRSSSEPMRK KTKFSSRNKE DSTRIKLAFK 

       190        200        210        220        230        240 
TSIFSPMKKE VKTSLTFPGS RPMSPEQQLD VMLQQEMEME SKEKKPSESD LERYYYYLTN 

       250        260        270        280        290        300 
GIRKDMIAPE EGEVMVRISK LISNTLLTSP FLEPLMVVLV QEKENDYYCS LMKSIVDYIL 

       310        320        330        340        350        360 
MDPMERKRLF IESIPRLFPQ RVIRAPVPWH SVYRSAKKWN EEHLHTVNPM MLRLKELWFA 

       370        380        390        400        410        420 
EFRDLRFVRT AEILAGKLPL QPQEFWDVIQ KHCLEAHQTL LNKWIPTCAQ LFTSRKEHWI 

       430        440        450        460        470        480 
HFAPKSNYDS SRNIEEYFAS VASFMSLQLR ELVIKSLEDL VSLFMIHKDG NDFKEPYQEM 

       490        500        510        520        530        540 
KFFIPQLIMI KLEVSEPIIV FNPSFDGCWE LIRDSFLEII KNSNGIPKLK YIPLKFSFTA 

       550        560        570        580        590        600 
AAADRQCVKA AEPGEPSMHA AATAMAELKG YNLLLGTVNA EEKLVSDFLI QTFKVFQKNQ 

       610        620        630        640        650        660 
VGPCKYLNVY KKYVDLLDNT AEQNIAAFLK ENHDIDDFVT KINAIKKRRN EIASMNITVP 

       670        680        690        700        710        720 
LAMFCLDATA LNHDLCERAQ NLKDHLIQFQ VDVNRDTNTS ICNQYSHIAD KVSEVPANTK 

       730        740        750        760        770        780 
ELVSLIEFLK KSSAVTVFKL RRQLRDASER LEFLMDYADL PYQIEDIFDN SRNLLLHKRD 

       790        800        810        820        830        840 
QAEMDLIKRC SEFELRLEGY HRELESFRKR EVMTTEEMKH NVEKLNELSK NLNRAFAEFE 

       850        860        870        880        890        900 
LINKEEELLE KEKSTYPLLQ AMLKNKVPYE QLWSTAYEFS IKSEEWMNGP LFLLNAEQIA 

       910        920        930        940        950        960 
EEIGNMWRTT YKLIKTLSDV PAPRRLAENV KIKIDKFKQY IPILSISCNP GMKDRHWQQI 

       970        980        990       1000       1010       1020 
SEIVGYEIKP TETTCLSNML EFGFGKFVEK LEPIGAAASK EYSLEKNLDR MKLDWVNVTF 

      1030       1040       1050       1060       1070       1080 
SFVKYRDTDT NILCAIDDIQ MLLDDHVIKT QTMCGSPFIK PIEAECRKWE EKLIRIQDNL 

      1090       1100       1110       1120       1130       1140 
DAWLKCQATW LYLEPIFSSE DIIAQMPEEG RKFGIVDSYW KSLMSQAVKD NRILVAADQP 

      1150       1160       1170       1180       1190       1200 
RMAEKLQEAN FLLEDIQKGL NDYLEKKRLF FPRFFFLSND ELLEILSETK DPLRVQPHLK 

      1210       1220       1230       1240       1250       1260 
KCFEGIAKLE FTDNLEIVGM ISSEKETVPF IQKIYPANAK GMVEKWLQQV EQMMLASMRE 

      1270       1280       1290       1300       1310       1320 
VIGLGIEAYV KVPRNHWVLQ WPGQVVICVS SIFWTQEVSQ ALAENTLLDF LKKSNDQIAQ 

      1330       1340       1350       1360       1370       1380 
IVQLVRGKLS SGARLTLGAL TVIDVHARDV VAKLSEDRVS DLNDFQWISQ LRYYWVAKDV 

      1390       1400       1410       1420       1430       1440 
QVQIITTEAL YGYEYLGNSP RLVITPLTDR CYRTLMGALK LNLGGAPEGP AGTGKTETTK 

      1450       1460       1470       1480       1490       1500 
DLAKALAKQC VVFNCSDGLD YKAMGKFFKG LAQAGAWACF DEFNRIEVEV LSVVAQQILS 

      1510       1520       1530       1540       1550       1560 
IQQAIIRKLK TFIFEGTELS LNPTCAVFIT MNPGYAGRAE LPDNLKALFR TVAMMVPDYA 

      1570       1580       1590       1600       1610       1620 
LIGEISLYSM GFLDSRSLAQ KIVATYRLCS EQLSSQHHYD YGMRAVKSVL TAAGNLKLKY 

      1630       1640       1650       1660       1670       1680 
PEENESVLLL RALLDVNLAK FLAQDVPLFQ GIISDLFPGV VLPKPDYEVF LKVLNDNIKK 

      1690       1700       1710       1720       1730       1740 
MKLQPVPWFI GKIIQIYEMM LVRHGYMIVG DPMGGKTSAY KVLAAALGDL HAANQMEEFA 

      1750       1760       1770       1780       1790       1800 
VEYKIINPKA ITMGQLYGCF DQVSHEWMDG VLANAFREQA SSLSDDRKWI IFDGPVDAIW 

      1810       1820       1830       1840       1850       1860 
IENMNTVLDD NKKLCLMSGE IIQMNSKMSL IFEPADLEQA SPATVSRCGM IYMEPHQLGW 

      1870       1880       1890       1900       1910       1920 
KPLKDSYMDT LPSSLTKEHK ELVNDMFMWL VQPCLEFGRL HCKFVVQTSP IHLAFSMMRL 

      1930       1940       1950       1960       1970       1980 
YSSLLDEIRA VEEEEMELGE GLSSQQIFLW LQGLFLFSLV WTVAGTINAD SRKKFDVFFR 

      1990       2000       2010       2020       2030       2040 
NLIMGMDDNH PRPKSVKLTK NNIFPERGSI YDFYFIKQAS GHWETWTQYI TKEEEKVPAG 

      2050       2060       2070       2080       2090       2100 
AKVSELIIPT METARQSFFL KTYLDHEIPM LFVGPTGTGK SAITNNFLLH LPKNTYLPNC 

      2110       2120       2130       2140       2150       2160 
INFSARTSAN QTQDIIMSKL DRRRKGLFGP PIGKKAVVFV DDLNMPAKEV YGAQPPIELL 

      2170       2180       2190       2200       2210       2220 
RQWIDHGYWF DKKDTTRLDI VDMLLVTAMG PPGGGRNDIT GRFTRHLNII SINAFEDDIL 

      2230       2240       2250       2260       2270       2280 
TKIFSSIVDW HFGKGFDVMF LRYGKMLVQA TKTIYRDAVE NFLPTPSKSH YVFNLRDFSR 

      2290       2300       2310       2320       2330       2340 
VIQGVLLCPH THLQDVEKCI RLWIHEVYRV FYDRLIDKED RQVFFNMVKE TTSNCFKQTI 

      2350       2360       2370       2380       2390       2400 
EKVLIHLSPT GKIVDDNIRS LFFGDYFKPE SDQKIYDEIT DLKQLTVVME HYLEEFNNIS 

      2410       2420       2430       2440       2450       2460 
KAPMSLVMFR FAIEHISRIC RVLKQDKGHL LLVGIGGSGR QSAAKLSTFM NAYELYQIEI 

      2470       2480       2490       2500       2510       2520 
TKNYAGNDWR EDLKKIILQV GVATKSTVFL FADNQIKDES FVEDINMLLN TGDVPNIFPA 

      2530       2540       2550       2560       2570       2580 
DEKADIVEKM QTAARTQGEK VEVTPLSMYN FFIERVINKI SFSLAMSPIG DAFRNRLRMF 

      2590       2600       2610       2620       2630       2640 
PSLINCCTID WFQSWPTDAL ELVANKFLED VELDDNIRVE VVSMCKYFQE SVKKLSLDYY 

      2650       2660       2670       2680       2690       2700 
NKLRRHNYVT PTSYLELILT FKTLLNSKRQ EVAMMRNRYL TGLQKLDFAA SQVAVMQREL 

      2710       2720       2730       2740       2750       2760 
TALQPQLILT SEETAKMMVK IEAETREADG KKLLVQADEK EANVAAAIAQ GIKNECEGDL 

      2770       2780       2790       2800       2810       2820 
AEAMPALEAA LAALDTLNPA DISLVKSMQN PPGPVKLVME SICIMKGMKP ERKPDPSGSG 

      2830       2840       2850       2860       2870       2880 
KMIEDYWGVS KKILGDLKFL ESLKTYDKDN IPPLTMKRIR ERFINHPEFQ PAVIKNVSSA 

      2890       2900       2910       2920       2930       2940 
CEGLCKWVRA MEVYDRVAKV VAPKRERLRE AEGKLAAQMQ KLNQKRAELK LVVDRLQALN 

      2950       2960       2970       2980       2990       3000 
DDFEEMNTKK KDLEENIEIC SQKLVRAEKL ISGLGGEKDR WTEAARQLGI RYTNLTGDVL 

      3010       3020       3030       3040       3050       3060 
LSSGTVAYLG AFTVDYRVQC QNQWLAECKD KVIPGFSDFS LSHTLGDPIK IRAWQIAGLP 

      3070       3080       3090       3100       3110       3120 
VDSFSIDNGI IVSNSRRWAL MIDPHGQANK WIKNMEKANK LAVIKFSDSN YMRMLENALQ 

      3130       3140       3150       3160       3170       3180 
LGTPVLIENI GEELDASIEP ILLKATFKQQ GVEYMRLGEN IIEYSRDFKL YITTRLRNPH 

      3190       3200       3210       3220       3230       3240 
YLPEVAVKVC LLNFMITPLG LQDQLLGIVA AKEKPELEEK KNQLIVESAK NKKHLKEIED 

      3250       3260       3270       3280       3290       3300 
KILEVLSMSK GNILEDETAI KVLSSSKVLS EEISEKQKVA SMTETQIDET RMGYKPVAVH 

      3310       3320       3330       3340       3350       3360 
SATIFFCISD LANIEPMYQY SLTWFINLYM HSLTHSTKSE ELNLRIKYII DHFTLSIYNN 

      3370       3380       3390       3400       3410       3420 
VCRSLFEKDK LLFSLLLTIG IMKQKKEITE EVWYFLLTGG IALDNPYPNP APQWLSEKAW 

      3430       3440       3450       3460       3470       3480 
AEIVRASALP KLHGLMEHLE QNLGEWKLIY DSAWPHEEQL PGSWKFSQGL EKMVILRCLR 

      3490       3500       3510       3520       3530       3540 
PDKMVPAVRE FIAEHMGKLY IEAPTFDLQG SYNDSSCCAP LIFVLSPSAD PMAGLLKFAD 

      3550       3560       3570       3580       3590       3600 
DLGMGGTRTQ TISLGQGQGP IAAKMINNAI KDGTWVVLQN CHLAASWMPT LEKICEEVIV 

      3610       3620       3630       3640       3650       3660 
PESTNARFRL WLTSYPSEKF PVSILQNGIK MTNEPPKGLR ANLLRSYLND PISDPVFFQS 

      3670       3680       3690       3700       3710       3720 
CAKAVMWQKM LFGLCFFHAV VQERRNFGPL GWNIPYEFNE SDLRISMWQI QMFLNDYKEV 

      3730       3740       3750       3760       3770       3780 
PFDALTYLTG ECNYGGRVTD DKDRRLLLSL LSMFYCKEIE EDYYSLAPGD TYYIPPHGSY 

      3790       3800       3810       3820       3830       3840 
QSYIDYLRNL PITAHPEVFG LHENADITKD NQETNQLFEG VLLTLPRQSG GSGKSPQEVV 

      3850       3860       3870       3880       3890       3900 
EELAQDILSK LPRDFDLEEV MKLYPVVYEE SMNTVLRQEL IRFNRLTKVV RRSLINLGRA 

      3910       3920       3930       3940       3950       3960 
IKGQVLMSSE LEEVFNSMLV GKVPAMWAAK SYPSLKPLGG YVADLLARLT FFQEWIDKGP 

      3970       3980       3990       4000       4010       4020 
PVVFWISGFY FTQSFLTGVS QNYARKYTIP IDHIGFEFEV TPQETVMENN PEDGAYIKGL 

      4030       4040       4050       4060       4070       4080 
FLEGARWDRK TMQIGESLPK ILYDPLPIIW LKPGESAMFL HQDIYVCPVY KTSARRGTLS 

      4090       4100       4110 
TTGHSTNYVL SIELPTDMPQ KHWINRGVAS LCQLDN 

« Hide

Isoform 2 [UniParc].

Checksum: 0BDED2AED898AD0C
Show »

FASTA75387,501
Isoform 3 [UniParc].

Checksum: DC3B4B00F469AD22
Show »

FASTA1,887216,078

References

« Hide 'large scale' references
[1]"DNAH3: characterization of the full length gene and mutation search in patients with primary ciliary dyskinesia."
Blouin J.-L., Gehrig C., Jeganathan D., Bartoloni L., Rossier C., Duriaux Sail G., Scamuffa N., Mitchison H.M., DeLozier Blanchet C.D., Antonarakis S.E.
Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"Chromosomal localization of human dynein heavy chain genes."
Maiti A.K., Mattei M.-G., Jorissen M., Volz A., Ziegler A., Bouvagnet P.
Submitted (JAN-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1391-1533 (ISOFORM 1), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1435-1449.
Tissue: Nasal polyp.
[5]"Identification of dynein heavy chain genes expressed in human and mouse testis: chromosomal localization of an axonemal dynein gene."
Neesen J., Koehler M.R., Kirschner R., Steinlein C., Kreutzberger J., Engel W., Schmid M.
Gene 200:193-202(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1429-1605 (ISOFORM 1).
Tissue: Testis.
[6]"Isolation of several human axonemal dynein heavy chain genes: genomic structure of the catalytic site, phylogenetic analysis and chromosomal assignment."
Chapelin C., Duriez B., Magnino F., Goossens M., Escudier E., Amselem S.
FEBS Lett. 412:325-330(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1429-1478, TISSUE SPECIFICITY.
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1574-4116 (ISOFORM 3).
Tissue: Ovary.
[8]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3152-4116 (ISOFORM 1).
Tissue: Testis.
[9]"Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q."
Loftus B.J., Kim U.-J., Sneddon V.P., Kalush F., Brandon R., Fuhrmann J., Mason T., Crosby M.L., Barnstead M., Cronin L., Mays A.D., Cao Y., Xu R.X., Kang H.-L., Mitchell S., Eichler E.E., Harris P.C., Venter J.C., Adams M.D.
Genomics 60:295-308(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] OF 3544-4116.
[10]"The consensus coding sequences of human breast and colorectal cancers."
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. expand/collapse author list , Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.
Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS [LARGE SCALE ANALYSIS] LEU-484 AND PHE-1608.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF494040 mRNA. Translation: AAM12861.1.
AK056509 mRNA. Translation: BAE46616.1.
CH471228 Genomic DNA. Translation: EAW66851.1.
AJ132085 mRNA. Translation: CAA10558.1.
AJ132092 Genomic DNA. Translation: CAA10565.1.
Z83805 mRNA. Translation: CAB06059.1.
U83574 Genomic DNA. Translation: AAB82763.1.
BC019878 mRNA. Translation: AAH19878.1.
AL096732 mRNA. Translation: CAB46377.1.
AC002394 Genomic DNA. Translation: AAC05809.1.
PIRT12545.
RefSeqNP_060009.1. NM_017539.1.
UniGeneHs.526500.

3D structure databases

ProteinModelPortalQ8TD57.
SMRQ8TD57. Positions 1001-1852, 2068-2108, 2425-2459, 2757-2911, 3562-3769.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120722. 1 interaction.
IntActQ8TD57. 1 interaction.

PTM databases

PhosphoSiteQ8TD57.

Polymorphism databases

DMDM74762616.

Proteomic databases

PaxDbQ8TD57.
PRIDEQ8TD57.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000261383; ENSP00000261383; ENSG00000158486. [Q8TD57-1]
ENST00000415178; ENSP00000394245; ENSG00000158486. [Q8TD57-3]
GeneID55567.
KEGGhsa:55567.
UCSCuc002die.2. human. [Q8TD57-2]
uc010vbe.2. human. [Q8TD57-1]

Organism-specific databases

CTD55567.
GeneCardsGC16M020944.
HGNCHGNC:2949. DNAH3.
HPAHPA062493.
MIM603334. gene.
neXtProtNX_Q8TD57.
PharmGKBPA27402.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5245.
HOVERGENHBG107830.
InParanoidQ8TD57.
KOK10408.
OMACLSNMLE.
OrthoDBEOG7BW0HH.
PhylomeDBQ8TD57.
TreeFamTF316836.

Gene expression databases

BgeeQ8TD57.
GenevestigatorQ8TD57.

Family and domain databases

Gene3D3.40.50.300. 5 hits.
InterProIPR003593. AAA+_ATPase.
IPR026983. DHC_fam.
IPR024743. Dynein_HC_stalk.
IPR024317. Dynein_heavy_chain_D4_dom.
IPR004273. Dynein_heavy_dom.
IPR013602. Dynein_heavy_dom-2.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERPTHR10676. PTHR10676. 1 hit.
PfamPF12780. AAA_8. 1 hit.
PF08393. DHC_N2. 1 hit.
PF03028. Dynein_heavy. 1 hit.
PF12777. MT. 1 hit.
[Graphical view]
SMARTSM00382. AAA. 2 hits.
[Graphical view]
SUPFAMSSF52540. SSF52540. 5 hits.
ProtoNetSearch...

Other

GenomeRNAi55567.
NextBio60052.
PROQ8TD57.
SOURCESearch...

Entry information

Entry nameDYH3_HUMAN
AccessionPrimary (citable) accession number: Q8TD57
Secondary accession number(s): O00437 expand/collapse secondary AC list , O15437, O43326, Q3C0H2, Q8WUP9, Q9UEM3, Q9UEM5, Q9UG35
Entry history
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: June 1, 2002
Last modified: April 16, 2014
This is version 93 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 16

Human chromosome 16: entries, gene names and cross-references to MIM