Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8TD57

- DYH3_HUMAN

UniProt

Q8TD57 - DYH3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Dynein heavy chain 3, axonemal

Gene

DNAH3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Involved in sperm motility; implicated in sperm flagellar assembly (By similarity).By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi1429 – 14368ATPSequence Analysis
Nucleotide bindingi1710 – 17178ATPSequence Analysis
Nucleotide bindingi2074 – 20818ATPSequence Analysis
Nucleotide bindingi2434 – 24418ATPSequence Analysis

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. microtubule motor activity Source: UniProtKB

GO - Biological processi

  1. cilium or flagellum-dependent cell motility Source: UniProtKB
  2. metabolic process Source: GOC
  3. microtubule-based movement Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Motor protein

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Dynein heavy chain 3, axonemal
Alternative name(s):
Axonemal beta dynein heavy chain 3
Short name:
HsADHC3
Ciliary dynein heavy chain 3
Dnahc3-b
Gene namesi
Name:DNAH3
Synonyms:DNAHC3B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:2949. DNAH3.

Subcellular locationi

GO - Cellular componenti

  1. axonemal dynein complex Source: UniProtKB
  2. microtubule Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Dynein, Microtubule

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27402.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 41164116Dynein heavy chain 3, axonemalPRO_0000322544Add
BLAST

Proteomic databases

MaxQBiQ8TD57.
PaxDbiQ8TD57.
PRIDEiQ8TD57.

PTM databases

PhosphoSiteiQ8TD57.

Expressioni

Tissue specificityi

Expressed primarily in trachea and testis, 2 tissues containing axonemal structures. Also expressed in lung.1 Publication

Gene expression databases

BgeeiQ8TD57.
GenevestigatoriQ8TD57.

Organism-specific databases

HPAiHPA062493.

Interactioni

Subunit structurei

Consists of at least two heavy chains and a number of intermediate and light chains.

Protein-protein interaction databases

BioGridi120722. 1 interaction.
IntActiQ8TD57. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ8TD57.
SMRiQ8TD57. Positions 1001-1852, 2692-2924, 3562-3769.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 13901390StemBy similarityAdd
BLAST
Regioni1391 – 1612222AAA 1By similarityAdd
BLAST
Regioni1672 – 1903232AAA 2By similarityAdd
BLAST
Regioni2036 – 2284249AAA 3By similarityAdd
BLAST
Regioni2395 – 2646252AAA 4By similarityAdd
BLAST
Regioni2661 – 2960300StalkBy similarityAdd
BLAST
Regioni3045 – 3275231AAA 5By similarityAdd
BLAST
Regioni3488 – 3712225AAA 6By similarityAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili785 – 85268Sequence AnalysisAdd
BLAST

Domaini

Dynein heavy chains probably consist of an N-terminal stem (which binds cargo and interacts with other dynein components), and the head or motor domain. The motor contains six tandemly-linked AAA domains in the head, which form a ring. A stalk-like structure (formed by two of the coiled coil domains) protrudes between AAA 4 and AAA 5 and terminates in a microtubule-binding site. A seventh domain may also contribute to this ring; it is not clear whether the N-terminus or the C-terminus forms this extra domain. There are four well-conserved and two non-conserved ATPase sites, one per AAA domain. Probably only one of these (within AAA 1) actually hydrolyzes ATP, the others may serve a regulatory function (By similarity).By similarity

Sequence similaritiesi

Belongs to the dynein heavy chain family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiCOG5245.
GeneTreeiENSGT00760000118964.
HOVERGENiHBG107830.
InParanoidiQ8TD57.
KOiK10408.
OMAiLQCKFVV.
OrthoDBiEOG7BW0HH.
PhylomeDBiQ8TD57.
TreeFamiTF316836.

Family and domain databases

Gene3Di3.40.50.300. 5 hits.
InterProiIPR003593. AAA+_ATPase.
IPR026983. DHC_fam.
IPR024743. Dynein_HC_stalk.
IPR024317. Dynein_heavy_chain_D4_dom.
IPR004273. Dynein_heavy_dom.
IPR013602. Dynein_heavy_dom-2.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR10676. PTHR10676. 1 hit.
PfamiPF12780. AAA_8. 1 hit.
PF08393. DHC_N2. 1 hit.
PF03028. Dynein_heavy. 1 hit.
PF12777. MT. 1 hit.
[Graphical view]
SMARTiSM00382. AAA. 2 hits.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 5 hits.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8TD57-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGATGRLELT LAAPPHPGPA FQRSKARETQ GEEEGSEMQI AKSDSIHHMS
60 70 80 90 100
HSQGQPELPP LPASANEEPS GLYQTVMSHS FYPPLMQRTS WTLAAPFKEQ
110 120 130 140 150
HHHRGPSDSI ANNYSLMAQD LKLKDLLKVY QPATISVPRD RTGQGLPSSG
160 170 180 190 200
NRSSSEPMRK KTKFSSRNKE DSTRIKLAFK TSIFSPMKKE VKTSLTFPGS
210 220 230 240 250
RPMSPEQQLD VMLQQEMEME SKEKKPSESD LERYYYYLTN GIRKDMIAPE
260 270 280 290 300
EGEVMVRISK LISNTLLTSP FLEPLMVVLV QEKENDYYCS LMKSIVDYIL
310 320 330 340 350
MDPMERKRLF IESIPRLFPQ RVIRAPVPWH SVYRSAKKWN EEHLHTVNPM
360 370 380 390 400
MLRLKELWFA EFRDLRFVRT AEILAGKLPL QPQEFWDVIQ KHCLEAHQTL
410 420 430 440 450
LNKWIPTCAQ LFTSRKEHWI HFAPKSNYDS SRNIEEYFAS VASFMSLQLR
460 470 480 490 500
ELVIKSLEDL VSLFMIHKDG NDFKEPYQEM KFFIPQLIMI KLEVSEPIIV
510 520 530 540 550
FNPSFDGCWE LIRDSFLEII KNSNGIPKLK YIPLKFSFTA AAADRQCVKA
560 570 580 590 600
AEPGEPSMHA AATAMAELKG YNLLLGTVNA EEKLVSDFLI QTFKVFQKNQ
610 620 630 640 650
VGPCKYLNVY KKYVDLLDNT AEQNIAAFLK ENHDIDDFVT KINAIKKRRN
660 670 680 690 700
EIASMNITVP LAMFCLDATA LNHDLCERAQ NLKDHLIQFQ VDVNRDTNTS
710 720 730 740 750
ICNQYSHIAD KVSEVPANTK ELVSLIEFLK KSSAVTVFKL RRQLRDASER
760 770 780 790 800
LEFLMDYADL PYQIEDIFDN SRNLLLHKRD QAEMDLIKRC SEFELRLEGY
810 820 830 840 850
HRELESFRKR EVMTTEEMKH NVEKLNELSK NLNRAFAEFE LINKEEELLE
860 870 880 890 900
KEKSTYPLLQ AMLKNKVPYE QLWSTAYEFS IKSEEWMNGP LFLLNAEQIA
910 920 930 940 950
EEIGNMWRTT YKLIKTLSDV PAPRRLAENV KIKIDKFKQY IPILSISCNP
960 970 980 990 1000
GMKDRHWQQI SEIVGYEIKP TETTCLSNML EFGFGKFVEK LEPIGAAASK
1010 1020 1030 1040 1050
EYSLEKNLDR MKLDWVNVTF SFVKYRDTDT NILCAIDDIQ MLLDDHVIKT
1060 1070 1080 1090 1100
QTMCGSPFIK PIEAECRKWE EKLIRIQDNL DAWLKCQATW LYLEPIFSSE
1110 1120 1130 1140 1150
DIIAQMPEEG RKFGIVDSYW KSLMSQAVKD NRILVAADQP RMAEKLQEAN
1160 1170 1180 1190 1200
FLLEDIQKGL NDYLEKKRLF FPRFFFLSND ELLEILSETK DPLRVQPHLK
1210 1220 1230 1240 1250
KCFEGIAKLE FTDNLEIVGM ISSEKETVPF IQKIYPANAK GMVEKWLQQV
1260 1270 1280 1290 1300
EQMMLASMRE VIGLGIEAYV KVPRNHWVLQ WPGQVVICVS SIFWTQEVSQ
1310 1320 1330 1340 1350
ALAENTLLDF LKKSNDQIAQ IVQLVRGKLS SGARLTLGAL TVIDVHARDV
1360 1370 1380 1390 1400
VAKLSEDRVS DLNDFQWISQ LRYYWVAKDV QVQIITTEAL YGYEYLGNSP
1410 1420 1430 1440 1450
RLVITPLTDR CYRTLMGALK LNLGGAPEGP AGTGKTETTK DLAKALAKQC
1460 1470 1480 1490 1500
VVFNCSDGLD YKAMGKFFKG LAQAGAWACF DEFNRIEVEV LSVVAQQILS
1510 1520 1530 1540 1550
IQQAIIRKLK TFIFEGTELS LNPTCAVFIT MNPGYAGRAE LPDNLKALFR
1560 1570 1580 1590 1600
TVAMMVPDYA LIGEISLYSM GFLDSRSLAQ KIVATYRLCS EQLSSQHHYD
1610 1620 1630 1640 1650
YGMRAVKSVL TAAGNLKLKY PEENESVLLL RALLDVNLAK FLAQDVPLFQ
1660 1670 1680 1690 1700
GIISDLFPGV VLPKPDYEVF LKVLNDNIKK MKLQPVPWFI GKIIQIYEMM
1710 1720 1730 1740 1750
LVRHGYMIVG DPMGGKTSAY KVLAAALGDL HAANQMEEFA VEYKIINPKA
1760 1770 1780 1790 1800
ITMGQLYGCF DQVSHEWMDG VLANAFREQA SSLSDDRKWI IFDGPVDAIW
1810 1820 1830 1840 1850
IENMNTVLDD NKKLCLMSGE IIQMNSKMSL IFEPADLEQA SPATVSRCGM
1860 1870 1880 1890 1900
IYMEPHQLGW KPLKDSYMDT LPSSLTKEHK ELVNDMFMWL VQPCLEFGRL
1910 1920 1930 1940 1950
HCKFVVQTSP IHLAFSMMRL YSSLLDEIRA VEEEEMELGE GLSSQQIFLW
1960 1970 1980 1990 2000
LQGLFLFSLV WTVAGTINAD SRKKFDVFFR NLIMGMDDNH PRPKSVKLTK
2010 2020 2030 2040 2050
NNIFPERGSI YDFYFIKQAS GHWETWTQYI TKEEEKVPAG AKVSELIIPT
2060 2070 2080 2090 2100
METARQSFFL KTYLDHEIPM LFVGPTGTGK SAITNNFLLH LPKNTYLPNC
2110 2120 2130 2140 2150
INFSARTSAN QTQDIIMSKL DRRRKGLFGP PIGKKAVVFV DDLNMPAKEV
2160 2170 2180 2190 2200
YGAQPPIELL RQWIDHGYWF DKKDTTRLDI VDMLLVTAMG PPGGGRNDIT
2210 2220 2230 2240 2250
GRFTRHLNII SINAFEDDIL TKIFSSIVDW HFGKGFDVMF LRYGKMLVQA
2260 2270 2280 2290 2300
TKTIYRDAVE NFLPTPSKSH YVFNLRDFSR VIQGVLLCPH THLQDVEKCI
2310 2320 2330 2340 2350
RLWIHEVYRV FYDRLIDKED RQVFFNMVKE TTSNCFKQTI EKVLIHLSPT
2360 2370 2380 2390 2400
GKIVDDNIRS LFFGDYFKPE SDQKIYDEIT DLKQLTVVME HYLEEFNNIS
2410 2420 2430 2440 2450
KAPMSLVMFR FAIEHISRIC RVLKQDKGHL LLVGIGGSGR QSAAKLSTFM
2460 2470 2480 2490 2500
NAYELYQIEI TKNYAGNDWR EDLKKIILQV GVATKSTVFL FADNQIKDES
2510 2520 2530 2540 2550
FVEDINMLLN TGDVPNIFPA DEKADIVEKM QTAARTQGEK VEVTPLSMYN
2560 2570 2580 2590 2600
FFIERVINKI SFSLAMSPIG DAFRNRLRMF PSLINCCTID WFQSWPTDAL
2610 2620 2630 2640 2650
ELVANKFLED VELDDNIRVE VVSMCKYFQE SVKKLSLDYY NKLRRHNYVT
2660 2670 2680 2690 2700
PTSYLELILT FKTLLNSKRQ EVAMMRNRYL TGLQKLDFAA SQVAVMQREL
2710 2720 2730 2740 2750
TALQPQLILT SEETAKMMVK IEAETREADG KKLLVQADEK EANVAAAIAQ
2760 2770 2780 2790 2800
GIKNECEGDL AEAMPALEAA LAALDTLNPA DISLVKSMQN PPGPVKLVME
2810 2820 2830 2840 2850
SICIMKGMKP ERKPDPSGSG KMIEDYWGVS KKILGDLKFL ESLKTYDKDN
2860 2870 2880 2890 2900
IPPLTMKRIR ERFINHPEFQ PAVIKNVSSA CEGLCKWVRA MEVYDRVAKV
2910 2920 2930 2940 2950
VAPKRERLRE AEGKLAAQMQ KLNQKRAELK LVVDRLQALN DDFEEMNTKK
2960 2970 2980 2990 3000
KDLEENIEIC SQKLVRAEKL ISGLGGEKDR WTEAARQLGI RYTNLTGDVL
3010 3020 3030 3040 3050
LSSGTVAYLG AFTVDYRVQC QNQWLAECKD KVIPGFSDFS LSHTLGDPIK
3060 3070 3080 3090 3100
IRAWQIAGLP VDSFSIDNGI IVSNSRRWAL MIDPHGQANK WIKNMEKANK
3110 3120 3130 3140 3150
LAVIKFSDSN YMRMLENALQ LGTPVLIENI GEELDASIEP ILLKATFKQQ
3160 3170 3180 3190 3200
GVEYMRLGEN IIEYSRDFKL YITTRLRNPH YLPEVAVKVC LLNFMITPLG
3210 3220 3230 3240 3250
LQDQLLGIVA AKEKPELEEK KNQLIVESAK NKKHLKEIED KILEVLSMSK
3260 3270 3280 3290 3300
GNILEDETAI KVLSSSKVLS EEISEKQKVA SMTETQIDET RMGYKPVAVH
3310 3320 3330 3340 3350
SATIFFCISD LANIEPMYQY SLTWFINLYM HSLTHSTKSE ELNLRIKYII
3360 3370 3380 3390 3400
DHFTLSIYNN VCRSLFEKDK LLFSLLLTIG IMKQKKEITE EVWYFLLTGG
3410 3420 3430 3440 3450
IALDNPYPNP APQWLSEKAW AEIVRASALP KLHGLMEHLE QNLGEWKLIY
3460 3470 3480 3490 3500
DSAWPHEEQL PGSWKFSQGL EKMVILRCLR PDKMVPAVRE FIAEHMGKLY
3510 3520 3530 3540 3550
IEAPTFDLQG SYNDSSCCAP LIFVLSPSAD PMAGLLKFAD DLGMGGTRTQ
3560 3570 3580 3590 3600
TISLGQGQGP IAAKMINNAI KDGTWVVLQN CHLAASWMPT LEKICEEVIV
3610 3620 3630 3640 3650
PESTNARFRL WLTSYPSEKF PVSILQNGIK MTNEPPKGLR ANLLRSYLND
3660 3670 3680 3690 3700
PISDPVFFQS CAKAVMWQKM LFGLCFFHAV VQERRNFGPL GWNIPYEFNE
3710 3720 3730 3740 3750
SDLRISMWQI QMFLNDYKEV PFDALTYLTG ECNYGGRVTD DKDRRLLLSL
3760 3770 3780 3790 3800
LSMFYCKEIE EDYYSLAPGD TYYIPPHGSY QSYIDYLRNL PITAHPEVFG
3810 3820 3830 3840 3850
LHENADITKD NQETNQLFEG VLLTLPRQSG GSGKSPQEVV EELAQDILSK
3860 3870 3880 3890 3900
LPRDFDLEEV MKLYPVVYEE SMNTVLRQEL IRFNRLTKVV RRSLINLGRA
3910 3920 3930 3940 3950
IKGQVLMSSE LEEVFNSMLV GKVPAMWAAK SYPSLKPLGG YVADLLARLT
3960 3970 3980 3990 4000
FFQEWIDKGP PVVFWISGFY FTQSFLTGVS QNYARKYTIP IDHIGFEFEV
4010 4020 4030 4040 4050
TPQETVMENN PEDGAYIKGL FLEGARWDRK TMQIGESLPK ILYDPLPIIW
4060 4070 4080 4090 4100
LKPGESAMFL HQDIYVCPVY KTSARRGTLS TTGHSTNYVL SIELPTDMPQ
4110
KHWINRGVAS LCQLDN
Length:4,116
Mass (Da):470,771
Last modified:June 1, 2002 - v1
Checksum:iAF387246540D9DF2
GO
Isoform 2 (identifier: Q8TD57-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MGATGRLELTLAAPPHPGPAFQRSKARETQGEEEGSEMQ → MGDMDCSSQK
     528-566: KLKYIPLKFSFTAAAADRQCVKAAEPGEPSMHAAATAMA → KVESVLFP
     762-762: Y → YEDIKLNSTLFLWPD
     790-799: CSEFELRLEG → YRESLGLSWK
     800-4116: Missing.

Note: No experimental confirmation available.

Show »
Length:753
Mass (Da):87,501
Checksum:i0BDED2AED898AD0C
GO
Isoform 3 (identifier: Q8TD57-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1883-1887: VNDMF → MKSGQ
     1888-4116: Missing.

Note: No experimental confirmation available.

Show »
Length:1,887
Mass (Da):216,078
Checksum:iDC3B4B00F469AD22
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1393 – 13931Y → F in CAA10558. 1 PublicationCurated
Sequence conflicti1441 – 14411D → V in CAB06059. (PubMed:9373155)Curated
Sequence conflicti1601 – 16044YGMR → FGLH in CAB06059. (PubMed:9373155)Curated
Sequence conflicti3828 – 38281Q → M in CAB46377. (PubMed:17974005)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti484 – 4841I → L in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_039412
Natural varianti545 – 5451R → W.
Corresponds to variant rs16970910 [ dbSNP | Ensembl ].
VAR_039413
Natural varianti1565 – 15651I → M.
Corresponds to variant rs330150 [ dbSNP | Ensembl ].
VAR_039414
Natural varianti1583 – 15831V → I.
Corresponds to variant rs16970832 [ dbSNP | Ensembl ].
VAR_039415
Natural varianti1608 – 16081S → F in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_039416
Natural varianti1752 – 17521T → M.
Corresponds to variant rs13332291 [ dbSNP | Ensembl ].
VAR_039417
Natural varianti2399 – 23991I → N.
Corresponds to variant rs34179606 [ dbSNP | Ensembl ].
VAR_039418
Natural varianti2804 – 28041I → V.
Corresponds to variant rs12929546 [ dbSNP | Ensembl ].
VAR_039419
Natural varianti2949 – 29491K → T.
Corresponds to variant rs33928718 [ dbSNP | Ensembl ].
VAR_039420
Natural varianti3457 – 34571E → K.
Corresponds to variant rs3743695 [ dbSNP | Ensembl ].
VAR_039421
Natural varianti3639 – 36391L → I.
Corresponds to variant rs34771199 [ dbSNP | Ensembl ].
VAR_039422
Natural varianti3645 – 36451R → C.
Corresponds to variant rs12924551 [ dbSNP | Ensembl ].
VAR_039423
Natural varianti3744 – 37441R → W.
Corresponds to variant rs2301620 [ dbSNP | Ensembl ].
VAR_039424

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3939MGATG…GSEMQ → MGDMDCSSQK in isoform 2. 1 PublicationVSP_031919Add
BLAST
Alternative sequencei528 – 56639KLKYI…ATAMA → KVESVLFP in isoform 2. 1 PublicationVSP_031920Add
BLAST
Alternative sequencei762 – 7621Y → YEDIKLNSTLFLWPD in isoform 2. 1 PublicationVSP_031921
Alternative sequencei790 – 79910CSEFELRLEG → YRESLGLSWK in isoform 2. 1 PublicationVSP_031922
Alternative sequencei800 – 41163317Missing in isoform 2. 1 PublicationVSP_031923Add
BLAST
Alternative sequencei1883 – 18875VNDMF → MKSGQ in isoform 3. 1 PublicationVSP_031924
Alternative sequencei1888 – 41162229Missing in isoform 3. 1 PublicationVSP_031925Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF494040 mRNA. Translation: AAM12861.1.
AK056509 mRNA. Translation: BAE46616.1.
CH471228 Genomic DNA. Translation: EAW66851.1.
AJ132085 mRNA. Translation: CAA10558.1.
AJ132092 Genomic DNA. Translation: CAA10565.1.
Z83805 mRNA. Translation: CAB06059.1.
U83574 Genomic DNA. Translation: AAB82763.1.
BC019878 mRNA. Translation: AAH19878.1.
AL096732 mRNA. Translation: CAB46377.1.
AC002394 Genomic DNA. Translation: AAC05809.1.
CCDSiCCDS10594.1. [Q8TD57-1]
PIRiT12545.
RefSeqiNP_060009.1. NM_017539.1. [Q8TD57-1]
UniGeneiHs.526500.

Genome annotation databases

EnsembliENST00000261383; ENSP00000261383; ENSG00000158486. [Q8TD57-1]
GeneIDi55567.
KEGGihsa:55567.
UCSCiuc002die.2. human. [Q8TD57-2]
uc010vbe.2. human. [Q8TD57-1]

Polymorphism databases

DMDMi74762616.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF494040 mRNA. Translation: AAM12861.1 .
AK056509 mRNA. Translation: BAE46616.1 .
CH471228 Genomic DNA. Translation: EAW66851.1 .
AJ132085 mRNA. Translation: CAA10558.1 .
AJ132092 Genomic DNA. Translation: CAA10565.1 .
Z83805 mRNA. Translation: CAB06059.1 .
U83574 Genomic DNA. Translation: AAB82763.1 .
BC019878 mRNA. Translation: AAH19878.1 .
AL096732 mRNA. Translation: CAB46377.1 .
AC002394 Genomic DNA. Translation: AAC05809.1 .
CCDSi CCDS10594.1. [Q8TD57-1 ]
PIRi T12545.
RefSeqi NP_060009.1. NM_017539.1. [Q8TD57-1 ]
UniGenei Hs.526500.

3D structure databases

ProteinModelPortali Q8TD57.
SMRi Q8TD57. Positions 1001-1852, 2692-2924, 3562-3769.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120722. 1 interaction.
IntActi Q8TD57. 1 interaction.

PTM databases

PhosphoSitei Q8TD57.

Polymorphism databases

DMDMi 74762616.

Proteomic databases

MaxQBi Q8TD57.
PaxDbi Q8TD57.
PRIDEi Q8TD57.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000261383 ; ENSP00000261383 ; ENSG00000158486 . [Q8TD57-1 ]
GeneIDi 55567.
KEGGi hsa:55567.
UCSCi uc002die.2. human. [Q8TD57-2 ]
uc010vbe.2. human. [Q8TD57-1 ]

Organism-specific databases

CTDi 55567.
GeneCardsi GC16M020944.
HGNCi HGNC:2949. DNAH3.
HPAi HPA062493.
MIMi 603334. gene.
neXtProti NX_Q8TD57.
PharmGKBi PA27402.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5245.
GeneTreei ENSGT00760000118964.
HOVERGENi HBG107830.
InParanoidi Q8TD57.
KOi K10408.
OMAi LQCKFVV.
OrthoDBi EOG7BW0HH.
PhylomeDBi Q8TD57.
TreeFami TF316836.

Miscellaneous databases

ChiTaRSi DNAH3. human.
GenomeRNAii 55567.
NextBioi 60052.
PROi Q8TD57.
SOURCEi Search...

Gene expression databases

Bgeei Q8TD57.
Genevestigatori Q8TD57.

Family and domain databases

Gene3Di 3.40.50.300. 5 hits.
InterProi IPR003593. AAA+_ATPase.
IPR026983. DHC_fam.
IPR024743. Dynein_HC_stalk.
IPR024317. Dynein_heavy_chain_D4_dom.
IPR004273. Dynein_heavy_dom.
IPR013602. Dynein_heavy_dom-2.
IPR027417. P-loop_NTPase.
[Graphical view ]
PANTHERi PTHR10676. PTHR10676. 1 hit.
Pfami PF12780. AAA_8. 1 hit.
PF08393. DHC_N2. 1 hit.
PF03028. Dynein_heavy. 1 hit.
PF12777. MT. 1 hit.
[Graphical view ]
SMARTi SM00382. AAA. 2 hits.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 5 hits.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "DNAH3: characterization of the full length gene and mutation search in patients with primary ciliary dyskinesia."
    Blouin J.-L., Gehrig C., Jeganathan D., Bartoloni L., Rossier C., Duriaux Sail G., Scamuffa N., Mitchison H.M., DeLozier Blanchet C.D., Antonarakis S.E.
    Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "Chromosomal localization of human dynein heavy chain genes."
    Maiti A.K., Mattei M.-G., Jorissen M., Volz A., Ziegler A., Bouvagnet P.
    Submitted (JAN-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1391-1533 (ISOFORM 1), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1435-1449.
    Tissue: Nasal polyp.
  5. "Identification of dynein heavy chain genes expressed in human and mouse testis: chromosomal localization of an axonemal dynein gene."
    Neesen J., Koehler M.R., Kirschner R., Steinlein C., Kreutzberger J., Engel W., Schmid M.
    Gene 200:193-202(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1429-1605 (ISOFORM 1).
    Tissue: Testis.
  6. "Isolation of several human axonemal dynein heavy chain genes: genomic structure of the catalytic site, phylogenetic analysis and chromosomal assignment."
    Chapelin C., Duriez B., Magnino F., Goossens M., Escudier E., Amselem S.
    FEBS Lett. 412:325-330(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1429-1478, TISSUE SPECIFICITY.
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1574-4116 (ISOFORM 3).
    Tissue: Ovary.
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3152-4116 (ISOFORM 1).
    Tissue: Testis.
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] OF 3544-4116.
  10. Cited for: VARIANTS [LARGE SCALE ANALYSIS] LEU-484 AND PHE-1608.

Entry informationi

Entry nameiDYH3_HUMAN
AccessioniPrimary (citable) accession number: Q8TD57
Secondary accession number(s): O00437
, O15437, O43326, Q3C0H2, Q8WUP9, Q9UEM3, Q9UEM5, Q9UG35
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: June 1, 2002
Last modified: November 26, 2014
This is version 99 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3