Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8TD57

- DYH3_HUMAN

UniProt

Q8TD57 - DYH3_HUMAN

Protein

Dynein heavy chain 3, axonemal

Gene

DNAH3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 97 (01 Oct 2014)
      Sequence version 1 (01 Jun 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Involved in sperm motility; implicated in sperm flagellar assembly By similarity.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi1429 – 14368ATPSequence Analysis
    Nucleotide bindingi1710 – 17178ATPSequence Analysis
    Nucleotide bindingi2074 – 20818ATPSequence Analysis
    Nucleotide bindingi2434 – 24418ATPSequence Analysis

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. microtubule motor activity Source: UniProtKB

    GO - Biological processi

    1. cilium or flagellum-dependent cell motility Source: UniProtKB
    2. metabolic process Source: GOC
    3. microtubule-based movement Source: InterPro

    Keywords - Molecular functioni

    Motor protein

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Dynein heavy chain 3, axonemal
    Alternative name(s):
    Axonemal beta dynein heavy chain 3
    Short name:
    HsADHC3
    Ciliary dynein heavy chain 3
    Dnahc3-b
    Gene namesi
    Name:DNAH3
    Synonyms:DNAHC3B
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:2949. DNAH3.

    Subcellular locationi

    GO - Cellular componenti

    1. axonemal dynein complex Source: UniProtKB
    2. microtubule Source: UniProtKB-KW

    Keywords - Cellular componenti

    Cell projection, Cilium, Cytoplasm, Cytoskeleton, Dynein, Microtubule

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA27402.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 41164116Dynein heavy chain 3, axonemalPRO_0000322544Add
    BLAST

    Proteomic databases

    MaxQBiQ8TD57.
    PaxDbiQ8TD57.
    PRIDEiQ8TD57.

    PTM databases

    PhosphoSiteiQ8TD57.

    Expressioni

    Tissue specificityi

    Expressed primarily in trachea and testis, 2 tissues containing axonemal structures. Also expressed in lung.1 Publication

    Gene expression databases

    BgeeiQ8TD57.
    GenevestigatoriQ8TD57.

    Organism-specific databases

    HPAiHPA062493.

    Interactioni

    Subunit structurei

    Consists of at least two heavy chains and a number of intermediate and light chains.

    Protein-protein interaction databases

    BioGridi120722. 1 interaction.
    IntActiQ8TD57. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8TD57.
    SMRiQ8TD57. Positions 1001-1852, 2430-2457, 2757-2911, 3562-3769.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 13901390StemBy similarityAdd
    BLAST
    Regioni1391 – 1612222AAA 1By similarityAdd
    BLAST
    Regioni1672 – 1903232AAA 2By similarityAdd
    BLAST
    Regioni2036 – 2284249AAA 3By similarityAdd
    BLAST
    Regioni2395 – 2646252AAA 4By similarityAdd
    BLAST
    Regioni2661 – 2960300StalkBy similarityAdd
    BLAST
    Regioni3045 – 3275231AAA 5By similarityAdd
    BLAST
    Regioni3488 – 3712225AAA 6By similarityAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili785 – 85268Sequence AnalysisAdd
    BLAST

    Domaini

    Dynein heavy chains probably consist of an N-terminal stem (which binds cargo and interacts with other dynein components), and the head or motor domain. The motor contains six tandemly-linked AAA domains in the head, which form a ring. A stalk-like structure (formed by two of the coiled coil domains) protrudes between AAA 4 and AAA 5 and terminates in a microtubule-binding site. A seventh domain may also contribute to this ring; it is not clear whether the N-terminus or the C-terminus forms this extra domain. There are four well-conserved and two non-conserved ATPase sites, one per AAA domain. Probably only one of these (within AAA 1) actually hydrolyzes ATP, the others may serve a regulatory function By similarity.By similarity

    Sequence similaritiesi

    Belongs to the dynein heavy chain family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiCOG5245.
    HOVERGENiHBG107830.
    InParanoidiQ8TD57.
    KOiK10408.
    OMAiLQCKFVV.
    OrthoDBiEOG7BW0HH.
    PhylomeDBiQ8TD57.
    TreeFamiTF316836.

    Family and domain databases

    Gene3Di3.40.50.300. 5 hits.
    InterProiIPR003593. AAA+_ATPase.
    IPR026983. DHC_fam.
    IPR024743. Dynein_HC_stalk.
    IPR024317. Dynein_heavy_chain_D4_dom.
    IPR004273. Dynein_heavy_dom.
    IPR013602. Dynein_heavy_dom-2.
    IPR027417. P-loop_NTPase.
    [Graphical view]
    PANTHERiPTHR10676. PTHR10676. 1 hit.
    PfamiPF12780. AAA_8. 1 hit.
    PF08393. DHC_N2. 1 hit.
    PF03028. Dynein_heavy. 1 hit.
    PF12777. MT. 1 hit.
    [Graphical view]
    SMARTiSM00382. AAA. 2 hits.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 5 hits.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8TD57-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGATGRLELT LAAPPHPGPA FQRSKARETQ GEEEGSEMQI AKSDSIHHMS     50
    HSQGQPELPP LPASANEEPS GLYQTVMSHS FYPPLMQRTS WTLAAPFKEQ 100
    HHHRGPSDSI ANNYSLMAQD LKLKDLLKVY QPATISVPRD RTGQGLPSSG 150
    NRSSSEPMRK KTKFSSRNKE DSTRIKLAFK TSIFSPMKKE VKTSLTFPGS 200
    RPMSPEQQLD VMLQQEMEME SKEKKPSESD LERYYYYLTN GIRKDMIAPE 250
    EGEVMVRISK LISNTLLTSP FLEPLMVVLV QEKENDYYCS LMKSIVDYIL 300
    MDPMERKRLF IESIPRLFPQ RVIRAPVPWH SVYRSAKKWN EEHLHTVNPM 350
    MLRLKELWFA EFRDLRFVRT AEILAGKLPL QPQEFWDVIQ KHCLEAHQTL 400
    LNKWIPTCAQ LFTSRKEHWI HFAPKSNYDS SRNIEEYFAS VASFMSLQLR 450
    ELVIKSLEDL VSLFMIHKDG NDFKEPYQEM KFFIPQLIMI KLEVSEPIIV 500
    FNPSFDGCWE LIRDSFLEII KNSNGIPKLK YIPLKFSFTA AAADRQCVKA 550
    AEPGEPSMHA AATAMAELKG YNLLLGTVNA EEKLVSDFLI QTFKVFQKNQ 600
    VGPCKYLNVY KKYVDLLDNT AEQNIAAFLK ENHDIDDFVT KINAIKKRRN 650
    EIASMNITVP LAMFCLDATA LNHDLCERAQ NLKDHLIQFQ VDVNRDTNTS 700
    ICNQYSHIAD KVSEVPANTK ELVSLIEFLK KSSAVTVFKL RRQLRDASER 750
    LEFLMDYADL PYQIEDIFDN SRNLLLHKRD QAEMDLIKRC SEFELRLEGY 800
    HRELESFRKR EVMTTEEMKH NVEKLNELSK NLNRAFAEFE LINKEEELLE 850
    KEKSTYPLLQ AMLKNKVPYE QLWSTAYEFS IKSEEWMNGP LFLLNAEQIA 900
    EEIGNMWRTT YKLIKTLSDV PAPRRLAENV KIKIDKFKQY IPILSISCNP 950
    GMKDRHWQQI SEIVGYEIKP TETTCLSNML EFGFGKFVEK LEPIGAAASK 1000
    EYSLEKNLDR MKLDWVNVTF SFVKYRDTDT NILCAIDDIQ MLLDDHVIKT 1050
    QTMCGSPFIK PIEAECRKWE EKLIRIQDNL DAWLKCQATW LYLEPIFSSE 1100
    DIIAQMPEEG RKFGIVDSYW KSLMSQAVKD NRILVAADQP RMAEKLQEAN 1150
    FLLEDIQKGL NDYLEKKRLF FPRFFFLSND ELLEILSETK DPLRVQPHLK 1200
    KCFEGIAKLE FTDNLEIVGM ISSEKETVPF IQKIYPANAK GMVEKWLQQV 1250
    EQMMLASMRE VIGLGIEAYV KVPRNHWVLQ WPGQVVICVS SIFWTQEVSQ 1300
    ALAENTLLDF LKKSNDQIAQ IVQLVRGKLS SGARLTLGAL TVIDVHARDV 1350
    VAKLSEDRVS DLNDFQWISQ LRYYWVAKDV QVQIITTEAL YGYEYLGNSP 1400
    RLVITPLTDR CYRTLMGALK LNLGGAPEGP AGTGKTETTK DLAKALAKQC 1450
    VVFNCSDGLD YKAMGKFFKG LAQAGAWACF DEFNRIEVEV LSVVAQQILS 1500
    IQQAIIRKLK TFIFEGTELS LNPTCAVFIT MNPGYAGRAE LPDNLKALFR 1550
    TVAMMVPDYA LIGEISLYSM GFLDSRSLAQ KIVATYRLCS EQLSSQHHYD 1600
    YGMRAVKSVL TAAGNLKLKY PEENESVLLL RALLDVNLAK FLAQDVPLFQ 1650
    GIISDLFPGV VLPKPDYEVF LKVLNDNIKK MKLQPVPWFI GKIIQIYEMM 1700
    LVRHGYMIVG DPMGGKTSAY KVLAAALGDL HAANQMEEFA VEYKIINPKA 1750
    ITMGQLYGCF DQVSHEWMDG VLANAFREQA SSLSDDRKWI IFDGPVDAIW 1800
    IENMNTVLDD NKKLCLMSGE IIQMNSKMSL IFEPADLEQA SPATVSRCGM 1850
    IYMEPHQLGW KPLKDSYMDT LPSSLTKEHK ELVNDMFMWL VQPCLEFGRL 1900
    HCKFVVQTSP IHLAFSMMRL YSSLLDEIRA VEEEEMELGE GLSSQQIFLW 1950
    LQGLFLFSLV WTVAGTINAD SRKKFDVFFR NLIMGMDDNH PRPKSVKLTK 2000
    NNIFPERGSI YDFYFIKQAS GHWETWTQYI TKEEEKVPAG AKVSELIIPT 2050
    METARQSFFL KTYLDHEIPM LFVGPTGTGK SAITNNFLLH LPKNTYLPNC 2100
    INFSARTSAN QTQDIIMSKL DRRRKGLFGP PIGKKAVVFV DDLNMPAKEV 2150
    YGAQPPIELL RQWIDHGYWF DKKDTTRLDI VDMLLVTAMG PPGGGRNDIT 2200
    GRFTRHLNII SINAFEDDIL TKIFSSIVDW HFGKGFDVMF LRYGKMLVQA 2250
    TKTIYRDAVE NFLPTPSKSH YVFNLRDFSR VIQGVLLCPH THLQDVEKCI 2300
    RLWIHEVYRV FYDRLIDKED RQVFFNMVKE TTSNCFKQTI EKVLIHLSPT 2350
    GKIVDDNIRS LFFGDYFKPE SDQKIYDEIT DLKQLTVVME HYLEEFNNIS 2400
    KAPMSLVMFR FAIEHISRIC RVLKQDKGHL LLVGIGGSGR QSAAKLSTFM 2450
    NAYELYQIEI TKNYAGNDWR EDLKKIILQV GVATKSTVFL FADNQIKDES 2500
    FVEDINMLLN TGDVPNIFPA DEKADIVEKM QTAARTQGEK VEVTPLSMYN 2550
    FFIERVINKI SFSLAMSPIG DAFRNRLRMF PSLINCCTID WFQSWPTDAL 2600
    ELVANKFLED VELDDNIRVE VVSMCKYFQE SVKKLSLDYY NKLRRHNYVT 2650
    PTSYLELILT FKTLLNSKRQ EVAMMRNRYL TGLQKLDFAA SQVAVMQREL 2700
    TALQPQLILT SEETAKMMVK IEAETREADG KKLLVQADEK EANVAAAIAQ 2750
    GIKNECEGDL AEAMPALEAA LAALDTLNPA DISLVKSMQN PPGPVKLVME 2800
    SICIMKGMKP ERKPDPSGSG KMIEDYWGVS KKILGDLKFL ESLKTYDKDN 2850
    IPPLTMKRIR ERFINHPEFQ PAVIKNVSSA CEGLCKWVRA MEVYDRVAKV 2900
    VAPKRERLRE AEGKLAAQMQ KLNQKRAELK LVVDRLQALN DDFEEMNTKK 2950
    KDLEENIEIC SQKLVRAEKL ISGLGGEKDR WTEAARQLGI RYTNLTGDVL 3000
    LSSGTVAYLG AFTVDYRVQC QNQWLAECKD KVIPGFSDFS LSHTLGDPIK 3050
    IRAWQIAGLP VDSFSIDNGI IVSNSRRWAL MIDPHGQANK WIKNMEKANK 3100
    LAVIKFSDSN YMRMLENALQ LGTPVLIENI GEELDASIEP ILLKATFKQQ 3150
    GVEYMRLGEN IIEYSRDFKL YITTRLRNPH YLPEVAVKVC LLNFMITPLG 3200
    LQDQLLGIVA AKEKPELEEK KNQLIVESAK NKKHLKEIED KILEVLSMSK 3250
    GNILEDETAI KVLSSSKVLS EEISEKQKVA SMTETQIDET RMGYKPVAVH 3300
    SATIFFCISD LANIEPMYQY SLTWFINLYM HSLTHSTKSE ELNLRIKYII 3350
    DHFTLSIYNN VCRSLFEKDK LLFSLLLTIG IMKQKKEITE EVWYFLLTGG 3400
    IALDNPYPNP APQWLSEKAW AEIVRASALP KLHGLMEHLE QNLGEWKLIY 3450
    DSAWPHEEQL PGSWKFSQGL EKMVILRCLR PDKMVPAVRE FIAEHMGKLY 3500
    IEAPTFDLQG SYNDSSCCAP LIFVLSPSAD PMAGLLKFAD DLGMGGTRTQ 3550
    TISLGQGQGP IAAKMINNAI KDGTWVVLQN CHLAASWMPT LEKICEEVIV 3600
    PESTNARFRL WLTSYPSEKF PVSILQNGIK MTNEPPKGLR ANLLRSYLND 3650
    PISDPVFFQS CAKAVMWQKM LFGLCFFHAV VQERRNFGPL GWNIPYEFNE 3700
    SDLRISMWQI QMFLNDYKEV PFDALTYLTG ECNYGGRVTD DKDRRLLLSL 3750
    LSMFYCKEIE EDYYSLAPGD TYYIPPHGSY QSYIDYLRNL PITAHPEVFG 3800
    LHENADITKD NQETNQLFEG VLLTLPRQSG GSGKSPQEVV EELAQDILSK 3850
    LPRDFDLEEV MKLYPVVYEE SMNTVLRQEL IRFNRLTKVV RRSLINLGRA 3900
    IKGQVLMSSE LEEVFNSMLV GKVPAMWAAK SYPSLKPLGG YVADLLARLT 3950
    FFQEWIDKGP PVVFWISGFY FTQSFLTGVS QNYARKYTIP IDHIGFEFEV 4000
    TPQETVMENN PEDGAYIKGL FLEGARWDRK TMQIGESLPK ILYDPLPIIW 4050
    LKPGESAMFL HQDIYVCPVY KTSARRGTLS TTGHSTNYVL SIELPTDMPQ 4100
    KHWINRGVAS LCQLDN 4116
    Length:4,116
    Mass (Da):470,771
    Last modified:June 1, 2002 - v1
    Checksum:iAF387246540D9DF2
    GO
    Isoform 2 (identifier: Q8TD57-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-39: MGATGRLELTLAAPPHPGPAFQRSKARETQGEEEGSEMQ → MGDMDCSSQK
         528-566: KLKYIPLKFSFTAAAADRQCVKAAEPGEPSMHAAATAMA → KVESVLFP
         762-762: Y → YEDIKLNSTLFLWPD
         790-799: CSEFELRLEG → YRESLGLSWK
         800-4116: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:753
    Mass (Da):87,501
    Checksum:i0BDED2AED898AD0C
    GO
    Isoform 3 (identifier: Q8TD57-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1883-1887: VNDMF → MKSGQ
         1888-4116: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,887
    Mass (Da):216,078
    Checksum:iDC3B4B00F469AD22
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti1393 – 13931Y → F in CAA10558. 1 PublicationCurated
    Sequence conflicti1441 – 14411D → V in CAB06059. (PubMed:9373155)Curated
    Sequence conflicti1601 – 16044YGMR → FGLH in CAB06059. (PubMed:9373155)Curated
    Sequence conflicti3828 – 38281Q → M in CAB46377. (PubMed:17974005)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti484 – 4841I → L in a colorectal cancer sample; somatic mutation. 1 Publication
    VAR_039412
    Natural varianti545 – 5451R → W.
    Corresponds to variant rs16970910 [ dbSNP | Ensembl ].
    VAR_039413
    Natural varianti1565 – 15651I → M.
    Corresponds to variant rs330150 [ dbSNP | Ensembl ].
    VAR_039414
    Natural varianti1583 – 15831V → I.
    Corresponds to variant rs16970832 [ dbSNP | Ensembl ].
    VAR_039415
    Natural varianti1608 – 16081S → F in a colorectal cancer sample; somatic mutation. 1 Publication
    VAR_039416
    Natural varianti1752 – 17521T → M.
    Corresponds to variant rs13332291 [ dbSNP | Ensembl ].
    VAR_039417
    Natural varianti2399 – 23991I → N.
    Corresponds to variant rs34179606 [ dbSNP | Ensembl ].
    VAR_039418
    Natural varianti2804 – 28041I → V.
    Corresponds to variant rs12929546 [ dbSNP | Ensembl ].
    VAR_039419
    Natural varianti2949 – 29491K → T.
    Corresponds to variant rs33928718 [ dbSNP | Ensembl ].
    VAR_039420
    Natural varianti3457 – 34571E → K.
    Corresponds to variant rs3743695 [ dbSNP | Ensembl ].
    VAR_039421
    Natural varianti3639 – 36391L → I.
    Corresponds to variant rs34771199 [ dbSNP | Ensembl ].
    VAR_039422
    Natural varianti3645 – 36451R → C.
    Corresponds to variant rs12924551 [ dbSNP | Ensembl ].
    VAR_039423
    Natural varianti3744 – 37441R → W.
    Corresponds to variant rs2301620 [ dbSNP | Ensembl ].
    VAR_039424

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3939MGATG…GSEMQ → MGDMDCSSQK in isoform 2. 1 PublicationVSP_031919Add
    BLAST
    Alternative sequencei528 – 56639KLKYI…ATAMA → KVESVLFP in isoform 2. 1 PublicationVSP_031920Add
    BLAST
    Alternative sequencei762 – 7621Y → YEDIKLNSTLFLWPD in isoform 2. 1 PublicationVSP_031921
    Alternative sequencei790 – 79910CSEFELRLEG → YRESLGLSWK in isoform 2. 1 PublicationVSP_031922
    Alternative sequencei800 – 41163317Missing in isoform 2. 1 PublicationVSP_031923Add
    BLAST
    Alternative sequencei1883 – 18875VNDMF → MKSGQ in isoform 3. 1 PublicationVSP_031924
    Alternative sequencei1888 – 41162229Missing in isoform 3. 1 PublicationVSP_031925Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF494040 mRNA. Translation: AAM12861.1.
    AK056509 mRNA. Translation: BAE46616.1.
    CH471228 Genomic DNA. Translation: EAW66851.1.
    AJ132085 mRNA. Translation: CAA10558.1.
    AJ132092 Genomic DNA. Translation: CAA10565.1.
    Z83805 mRNA. Translation: CAB06059.1.
    U83574 Genomic DNA. Translation: AAB82763.1.
    BC019878 mRNA. Translation: AAH19878.1.
    AL096732 mRNA. Translation: CAB46377.1.
    AC002394 Genomic DNA. Translation: AAC05809.1.
    CCDSiCCDS10594.1. [Q8TD57-1]
    PIRiT12545.
    RefSeqiNP_060009.1. NM_017539.1. [Q8TD57-1]
    UniGeneiHs.526500.

    Genome annotation databases

    EnsembliENST00000261383; ENSP00000261383; ENSG00000158486. [Q8TD57-1]
    GeneIDi55567.
    KEGGihsa:55567.
    UCSCiuc002die.2. human. [Q8TD57-2]
    uc010vbe.2. human. [Q8TD57-1]

    Polymorphism databases

    DMDMi74762616.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF494040 mRNA. Translation: AAM12861.1 .
    AK056509 mRNA. Translation: BAE46616.1 .
    CH471228 Genomic DNA. Translation: EAW66851.1 .
    AJ132085 mRNA. Translation: CAA10558.1 .
    AJ132092 Genomic DNA. Translation: CAA10565.1 .
    Z83805 mRNA. Translation: CAB06059.1 .
    U83574 Genomic DNA. Translation: AAB82763.1 .
    BC019878 mRNA. Translation: AAH19878.1 .
    AL096732 mRNA. Translation: CAB46377.1 .
    AC002394 Genomic DNA. Translation: AAC05809.1 .
    CCDSi CCDS10594.1. [Q8TD57-1 ]
    PIRi T12545.
    RefSeqi NP_060009.1. NM_017539.1. [Q8TD57-1 ]
    UniGenei Hs.526500.

    3D structure databases

    ProteinModelPortali Q8TD57.
    SMRi Q8TD57. Positions 1001-1852, 2430-2457, 2757-2911, 3562-3769.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120722. 1 interaction.
    IntActi Q8TD57. 1 interaction.

    PTM databases

    PhosphoSitei Q8TD57.

    Polymorphism databases

    DMDMi 74762616.

    Proteomic databases

    MaxQBi Q8TD57.
    PaxDbi Q8TD57.
    PRIDEi Q8TD57.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000261383 ; ENSP00000261383 ; ENSG00000158486 . [Q8TD57-1 ]
    GeneIDi 55567.
    KEGGi hsa:55567.
    UCSCi uc002die.2. human. [Q8TD57-2 ]
    uc010vbe.2. human. [Q8TD57-1 ]

    Organism-specific databases

    CTDi 55567.
    GeneCardsi GC16M020944.
    HGNCi HGNC:2949. DNAH3.
    HPAi HPA062493.
    MIMi 603334. gene.
    neXtProti NX_Q8TD57.
    PharmGKBi PA27402.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5245.
    HOVERGENi HBG107830.
    InParanoidi Q8TD57.
    KOi K10408.
    OMAi LQCKFVV.
    OrthoDBi EOG7BW0HH.
    PhylomeDBi Q8TD57.
    TreeFami TF316836.

    Miscellaneous databases

    GenomeRNAii 55567.
    NextBioi 60052.
    PROi Q8TD57.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8TD57.
    Genevestigatori Q8TD57.

    Family and domain databases

    Gene3Di 3.40.50.300. 5 hits.
    InterProi IPR003593. AAA+_ATPase.
    IPR026983. DHC_fam.
    IPR024743. Dynein_HC_stalk.
    IPR024317. Dynein_heavy_chain_D4_dom.
    IPR004273. Dynein_heavy_dom.
    IPR013602. Dynein_heavy_dom-2.
    IPR027417. P-loop_NTPase.
    [Graphical view ]
    PANTHERi PTHR10676. PTHR10676. 1 hit.
    Pfami PF12780. AAA_8. 1 hit.
    PF08393. DHC_N2. 1 hit.
    PF03028. Dynein_heavy. 1 hit.
    PF12777. MT. 1 hit.
    [Graphical view ]
    SMARTi SM00382. AAA. 2 hits.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 5 hits.
    ProtoNeti Search...

    Publicationsi

    1. "DNAH3: characterization of the full length gene and mutation search in patients with primary ciliary dyskinesia."
      Blouin J.-L., Gehrig C., Jeganathan D., Bartoloni L., Rossier C., Duriaux Sail G., Scamuffa N., Mitchison H.M., DeLozier Blanchet C.D., Antonarakis S.E.
      Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "Chromosomal localization of human dynein heavy chain genes."
      Maiti A.K., Mattei M.-G., Jorissen M., Volz A., Ziegler A., Bouvagnet P.
      Submitted (JAN-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1391-1533 (ISOFORM 1), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1435-1449.
      Tissue: Nasal polyp.
    5. "Identification of dynein heavy chain genes expressed in human and mouse testis: chromosomal localization of an axonemal dynein gene."
      Neesen J., Koehler M.R., Kirschner R., Steinlein C., Kreutzberger J., Engel W., Schmid M.
      Gene 200:193-202(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1429-1605 (ISOFORM 1).
      Tissue: Testis.
    6. "Isolation of several human axonemal dynein heavy chain genes: genomic structure of the catalytic site, phylogenetic analysis and chromosomal assignment."
      Chapelin C., Duriez B., Magnino F., Goossens M., Escudier E., Amselem S.
      FEBS Lett. 412:325-330(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1429-1478, TISSUE SPECIFICITY.
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1574-4116 (ISOFORM 3).
      Tissue: Ovary.
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3152-4116 (ISOFORM 1).
      Tissue: Testis.
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] OF 3544-4116.
    10. Cited for: VARIANTS [LARGE SCALE ANALYSIS] LEU-484 AND PHE-1608.

    Entry informationi

    Entry nameiDYH3_HUMAN
    AccessioniPrimary (citable) accession number: Q8TD57
    Secondary accession number(s): O00437
    , O15437, O43326, Q3C0H2, Q8WUP9, Q9UEM3, Q9UEM5, Q9UG35
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 26, 2008
    Last sequence update: June 1, 2002
    Last modified: October 1, 2014
    This is version 97 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3