Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Chromodomain-helicase-DNA-binding protein 6

Gene

CHD6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Probable chromatin-remodeling protein with a DNA-dependent ATPase activity. May play a role in transcription regulation, activating for instance, the transcription of specific genes in response to oxidative stress through interaction with NFE2L2.1 Publication

Catalytic activityi

ATP + H2O = ADP + phosphate.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi486 – 493ATPPROSITE-ProRule annotation8

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • ATP-dependent helicase activity Source: InterPro
  • DNA binding Source: UniProtKB-KW
  • DNA-dependent ATPase activity Source: UniProtKB
  • transcription cofactor binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Chromatin regulator, Helicase, Hydrolase

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

ATP-binding, DNA-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Chromodomain-helicase-DNA-binding protein 6 (EC:3.6.4.12)
Short name:
CHD-6
Alternative name(s):
ATP-dependent helicase CHD6
Radiation-induced gene B protein
Gene namesi
Name:CHD6
Synonyms:CHD5, KIAA1335, RIGB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:19057. CHD6.

Subcellular locationi

  • Nucleusnucleoplasm 1 Publication

  • Note: Enriched at sites of mRNA synthesis.

GO - Cellular componenti

  • nucleoplasm Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration disrupting CHD6 has been found in a patient with mild to moderate mental retardation and minor facial anomalies. Translocation t(18;20)(q21.1;q11.2) with TCF4 producing a CHD6-TCF4 fusion transcript (PubMed:18627065).

Organism-specific databases

DisGeNETi84181.
OpenTargetsiENSG00000124177.
PharmGKBiPA134974700.

Polymorphism and mutation databases

BioMutaiCHD6.
DMDMi296439466.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000802311 – 2715Chromodomain-helicase-DNA-binding protein 6Add BLAST2715

Proteomic databases

EPDiQ8TD26.
MaxQBiQ8TD26.
PaxDbiQ8TD26.
PeptideAtlasiQ8TD26.
PRIDEiQ8TD26.

PTM databases

iPTMnetiQ8TD26.
PhosphoSitePlusiQ8TD26.

Expressioni

Tissue specificityi

Widely expressed.

Gene expression databases

BgeeiENSG00000124177.
CleanExiHS_CHD5.
HS_CHD6.
ExpressionAtlasiQ8TD26. baseline and differential.
GenevisibleiQ8TD26. HS.

Organism-specific databases

HPAiHPA015543.

Interactioni

Subunit structurei

Interacts with NFE2L2; involved in activation of the transcription. May interact with PPARA.1 Publication

GO - Molecular functioni

  • transcription cofactor binding Source: UniProtKB

Protein-protein interaction databases

BioGridi123931. 14 interactors.
IntActiQ8TD26. 13 interactors.
MINTiMINT-1197235.
STRINGi9606.ENSP00000362330.

Structurei

Secondary structure

12715
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi379 – 387Combined sources9
Beta strandi389 – 391Combined sources3
Beta strandi394 – 401Combined sources8
Helixi407 – 409Combined sources3
Beta strandi412 – 414Combined sources3
Turni415 – 417Combined sources3
Helixi420 – 429Combined sources10

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EPBNMR-A371-431[»]
ProteinModelPortaliQ8TD26.
SMRiQ8TD26.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8TD26.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini292 – 343Chromo 1PROSITE-ProRule annotationAdd BLAST52
Domaini375 – 439Chromo 2PROSITE-ProRule annotationAdd BLAST65
Domaini473 – 647Helicase ATP-bindingPROSITE-ProRule annotationAdd BLAST175
Domaini787 – 956Helicase C-terminalPROSITE-ProRule annotationAdd BLAST170
Domaini1449 – 1503Myb-likeAdd BLAST55

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 747Required for DNA-dependent ATPase activityAdd BLAST747

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi598 – 601DEAH box4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi93 – 202Lys-richAdd BLAST110

Sequence similaritiesi

Belongs to the SNF2/RAD54 helicase family.Curated
Contains 2 chromo domains.PROSITE-ProRule annotation
Contains 1 helicase ATP-binding domain.PROSITE-ProRule annotation
Contains 1 helicase C-terminal domain.PROSITE-ProRule annotation
Contains 1 Myb-like domain.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0383. Eukaryota.
COG0553. LUCA.
GeneTreeiENSGT00760000119067.
HOVERGENiHBG081150.
InParanoidiQ8TD26.
KOiK14436.
OMAiTHGRFKW.
OrthoDBiEOG091G0022.
PhylomeDBiQ8TD26.
TreeFamiTF313572.

Family and domain databases

Gene3Di3.40.50.300. 2 hits.
InterProiIPR006576. BRK_domain.
IPR000953. Chromo/shadow_dom.
IPR023780. Chromo_domain.
IPR016197. Chromodomain-like.
IPR002464. DNA/RNA_helicase_DEAH_CS.
IPR014001. Helicase_ATP-bd.
IPR001650. Helicase_C.
IPR027417. P-loop_NTPase.
IPR000330. SNF2_N.
[Graphical view]
PfamiPF00385. Chromo. 2 hits.
PF00271. Helicase_C. 1 hit.
PF00176. SNF2_N. 1 hit.
[Graphical view]
SMARTiSM00592. BRK. 1 hit.
SM00298. CHROMO. 2 hits.
SM00487. DEXDc. 1 hit.
SM00490. HELICc. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 2 hits.
SSF54160. SSF54160. 2 hits.
PROSITEiPS50013. CHROMO_2. 1 hit.
PS00690. DEAH_ATP_HELICASE. 1 hit.
PS51192. HELICASE_ATP_BIND_1. 1 hit.
PS51194. HELICASE_CTER. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TD26-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKMKIQKKEK QLSNLKVLNH SPMSDASVNF DYKSPSPFDC STDQEEKIED
60 70 80 90 100
VASHCLPQKD LYTAEEEAAT LFPRKMTSHN GMEDSGGGGT GVKKKRKKKE
110 120 130 140 150
PGDQEGAAKG SKDREPKPKR KREPKEPKEP RKAKEPKKAK EHKEPKQKDG
160 170 180 190 200
AKKARKPREA SGTKEAKEKR SCTDSAARTK SRKASKEQGP TPVEKKKKGK
210 220 230 240 250
RKSETTVESL ELDQGLTNPS LRSPEESTES TDSQKRRSGR QVKRRKYNED
260 270 280 290 300
LDFKVVDDDG ETIAVLGAGR TSALSASTLA WQAEEPPEDD ANIIEKILAS
310 320 330 340 350
KTVQEVHPGE PPFDLELFYV KYRNFSYLHC KWATMEELEK DPRIAQKIKR
360 370 380 390 400
FRNKQAQMKH IFTEPDEDLF NPDYVEVDRI LEVAHTKDAE TGEEVTHYLV
410 420 430 440 450
KWCSLPYEES TWELEEDVDP AKVKEFESLQ VLPEIKHVER PASDSWQKLE
460 470 480 490 500
KSREYKNSNQ LREYQLEGMN WLLFNWYNRK NCILADEMGL GKTIQSITFL
510 520 530 540 550
SEIFLRGIHG PFLIIAPLST ITNWEREFRT WTEMNAIVYH GSQISRQMIQ
560 570 580 590 600
QYEMVYRDAQ GNPLSGVFKF HVVITTFEMI LADCPELKKI HWSCVIIDEA
610 620 630 640 650
HRLKNRNCKL LEGLKLMALE HKVLLTGTPL QNSVEELFSL LNFLEPSQFP
660 670 680 690 700
SETAFLEEFG DLKTEEQVKK LQSILKPMML RRLKDDVEKN LAPKQETIIE
710 720 730 740 750
VELTNIQKKY YRAILEKNFS FLTKGANQHN MPNLINTMME LRKCCNHPYL
760 770 780 790 800
INGAEEKILE DFRKTHSPDA PDFQLQAMIQ AAGKLVLIDK LLPKLIAGGH
810 820 830 840 850
KVLIFSQMVR CLDILEDYLI QRRYTYERID GRVRGNLRQA AIDRFCKPDS
860 870 880 890 900
DRFVFLLCTR AGGLGINLTA ADTCIIFDSD WNPQNDLQAQ ARCHRIGQSK
910 920 930 940 950
AVKVYRLITR NSYEREMFDK ASLKLGLDKA VLQDINRKGG TNGVQQLSKM
960 970 980 990 1000
EVEDLLRKGA YGALMDEEDE GSKFCEEDID QILQRRTHTI TIQSEGKGST
1010 1020 1030 1040 1050
FAKASFVASG NRTDISLDDP NFWQKWAKIA ELDTEAKNEK ESLVIDRPRV
1060 1070 1080 1090 1100
RKQTKHYNSF EEDELMEFSE LDSDSDERPT RSRRLNDKAR RYLRAECFRV
1110 1120 1130 1140 1150
EKNLLIFGWG RWKDILTHGR FKWHLNEKDM EMICRALLVY CVKHYKGDEK
1160 1170 1180 1190 1200
IKSFIWELIT PTKDGQAQTL QNHSGLSAPV PRGRKGKKTK NQLLIPELKD
1210 1220 1230 1240 1250
ADWLATCNPE VVLHDDGYKK HLKQHCNKVL LRVRMLYYLK AEILGEAAEK
1260 1270 1280 1290 1300
AFEGSPAREL DVPLPDIDYM EIPVDWWDAE ADKSLLIGVF KHGYERYNAM
1310 1320 1330 1340 1350
RADPALCFLE KVGMPDEKSL SAEQGVTDGT SDIPERGNTD KEDNAEDKVD
1360 1370 1380 1390 1400
GLQKQTESSS DGGDGVFSEK KDDSRAAQDG SDPDKSPWPV SSALTARLRR
1410 1420 1430 1440 1450
LVTVYQRCNR KELCRPEILG PGNQGYWVQE EMFRRTSEMD LINKEAQKRW
1460 1470 1480 1490 1500
TRREQADFYR TVSSFGVVYD QEKKTFDWTQ FRIISRLDKK SDESLEQYFY
1510 1520 1530 1540 1550
SFVAMCRNVC RLPTWKDGGP PDTTIYVEPI TEERAARTLY RIELLRKVRE
1560 1570 1580 1590 1600
QVLKCPQLHE RLQLCRPSLY LPVWWECGKH DRDLLIGTAK HGLNRTDCYI
1610 1620 1630 1640 1650
MNDPQLSFLD AYRNYAQHKR SGTQAPGNLC CLYQTNSKLY ESLTYSQMSR
1660 1670 1680 1690 1700
TSESLENEPE NLVRVESRDD HLSLPDVTCE NFISKVQDVI SINHDESLLP
1710 1720 1730 1740 1750
ESLESMMYGK KVLSQEPSSF QESPSTNTES RKDVITISIS KDGNCQSGGP
1760 1770 1780 1790 1800
EAEIASGPTF MGSLEAGGVA QANIKNGKHL LMSISKEGEL CCSEAGQRPE
1810 1820 1830 1840 1850
NIGQLEAKCL ASPSLNPGNE SGFVDMCSLS VCDSKRNLSS DQQLIDLLEN
1860 1870 1880 1890 1900
KSLESKLILS QNHSDEEEEE EENEEENLAM AVGMGERPEV LHLTEPTTNI
1910 1920 1930 1940 1950
SREKNQGFQD ETKKGSLEVA NQTPGLQRAF PAPAACQCHC KHMERWMHGL
1960 1970 1980 1990 2000
ENDEFEIEKP KAYIPDLFKS KTNTIAMEGE PTAIPSQPFK VKHELLKEPW
2010 2020 2030 2040 2050
KESAEGQNVF PTYPLEGSEL KSEDMDFENK DDYDRDGNCH SQDYPGKYSE
2060 2070 2080 2090 2100
EESKSSTSGI TGDIGDELQE ARAPTIAQLL QEKTLYSFSE WPKDRVIINR
2110 2120 2130 2140 2150
LDNICHVVLK GKWPSSQQYE PSGTLPTPVL TSSAGSRTSL SEPEAAEHSF
2160 2170 2180 2190 2200
SNGAALAAQI HKESFLAPVF TKDEQKHRRP YEFEVERDAK ARGLEQFSAT
2210 2220 2230 2240 2250
HGHTPIILNG WHGESAMDLS CSSEGSPGAT SPFPVSASTP KIGAISSLQG
2260 2270 2280 2290 2300
ALGMDLSGIL QAGLIHPVTG QIVNGSLRRD DAATRRRRGR RKHVEGGMDL
2310 2320 2330 2340 2350
IFLKEQTLQA GILEVHEDPG QATLSTTHPE GPGPATSAPE PATAASSQAE
2360 2370 2380 2390 2400
KSIPSKSLLD WLRQQADYSL EVPGFGANFS DKPKQRRPRC KEPGKLDVSS
2410 2420 2430 2440 2450
LSGEERVPAI PKEPGLRGFL PENKFNHTLA EPILRDTGPR RRGRRPRSEL
2460 2470 2480 2490 2500
LKAPSIVADS PSGMGPLFMN GLIAGMDLVG LQNMRNMPGI PLTGLVGFPA
2510 2520 2530 2540 2550
GFATMPTGEE VKSTLSMLPM MLPGMAAVPQ MFGVGGLLSP PMATTCTSTA
2560 2570 2580 2590 2600
PASLSSTTKS GTAVTEKTAE DKPSSHDVKT DTLAEDKPGP GPFSDQSEPA
2610 2620 2630 2640 2650
ITTSSPVAFN PFLIPGVSPG LIYPSMFLSP GMGMALPAMQ QARHSEIVGL
2660 2670 2680 2690 2700
ESQKRKKKKT KGDNPNSHPE PAPSCEREPS GDENCAEPSA PLPAEREHGA
2710
QAGEGALKDS NNDTN
Length:2,715
Mass (Da):305,412
Last modified:May 18, 2010 - v4
Checksum:i5B3FEC537340A8B7
GO
Isoform 2 (identifier: Q8TD26-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MKMKIQKKEK → MCQSHMIGFCTSSVNEETETQGDQISCPNPTTLVFRTQISSLPSL
     325-338: FSYLHCKWATMEEL → LYVYLKYSLYLGFI
     339-2715: Missing.

Note: Gene prediction based on EST data.
Show »
Length:373
Mass (Da):41,654
Checksum:i0264B708481CB446
GO
Isoform 3 (identifier: Q8TD26-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     592-1108: Missing.
     1337-1339: GNT → QHR
     1340-2715: Missing.

Note: No experimental confirmation available.
Show »
Length:822
Mass (Da):94,609
Checksum:iBC0D0A3987286332
GO

Sequence cautioni

The sequence AAK56405 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAN59903 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB15325 differs from that shown. The sequence differs from position 1528 onward for unknown reasons.Curated
The sequence CAI21743 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAI22254 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti134K → E in AAK56405 (PubMed:11889561).Curated1
Sequence conflicti575T → A in AAN59903 (Ref. 4) Curated1
Sequence conflicti1031E → K in AAK56405 (PubMed:11889561).Curated1
Sequence conflicti2442 – 2447RGRRPR → EIVGLE in AAH21907 (PubMed:15489334).Curated6
Sequence conflicti2663D → G in AAK56405 (PubMed:11889561).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_059213780Q → H.Corresponds to variant rs4474937dbSNPEnsembl.1
Natural variantiVAR_0233632161H → Q.Corresponds to variant rs3817893dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0152961 – 10MKMKIQKKEK → MCQSHMIGFCTSSVNEETET QGDQISCPNPTTLVFRTQIS SLPSL in isoform 2. 1 Publication10
Alternative sequenceiVSP_015297325 – 338FSYLH…TMEEL → LYVYLKYSLYLGFI in isoform 2. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_015298339 – 2715Missing in isoform 2. 1 PublicationAdd BLAST2377
Alternative sequenceiVSP_015299592 – 1108Missing in isoform 3. 1 PublicationAdd BLAST517
Alternative sequenceiVSP_0153001337 – 1339GNT → QHR in isoform 3. 1 Publication3
Alternative sequenceiVSP_0153011340 – 2715Missing in isoform 3. 1 PublicationAdd BLAST1376

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY034072 mRNA. Translation: AAK56405.1. Different initiation.
AL121674, AL031669 Genomic DNA. Translation: CAI21743.1. Sequence problems.
AL121674, AL031667, AL031669 Genomic DNA. Translation: CAI21744.1.
AL121674, AL031667, AL031669 Genomic DNA. Translation: CAI21745.1.
AL031669, AL121674 Genomic DNA. Translation: CAI22254.1. Sequence problems.
AL031669, AL031667, AL121674 Genomic DNA. Translation: CAI22255.1.
AL031669, AL031667, AL121674 Genomic DNA. Translation: CAI22256.1.
AL031667, AL031669, AL121674 Genomic DNA. Translation: CAI42977.1.
AL031667, AL031669, AL121674 Genomic DNA. Translation: CAI42981.1.
AL031667 Genomic DNA. Translation: CAI42983.1.
BC021907 mRNA. Translation: AAH21907.1.
BC039860 mRNA. No translation available.
BC040016 mRNA. No translation available.
AF525085 mRNA. Translation: AAN59903.1. Different initiation.
AB037756 mRNA. Translation: BAA92573.2.
AK026022 mRNA. Translation: BAB15325.1. Sequence problems.
CCDSiCCDS13317.1. [Q8TD26-1]
RefSeqiNP_115597.3. NM_032221.4. [Q8TD26-1]
UniGeneiHs.740645.

Genome annotation databases

EnsembliENST00000373222; ENSP00000362319; ENSG00000124177. [Q8TD26-2]
ENST00000373233; ENSP00000362330; ENSG00000124177. [Q8TD26-1]
GeneIDi84181.
KEGGihsa:84181.
UCSCiuc002xka.3. human. [Q8TD26-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY034072 mRNA. Translation: AAK56405.1. Different initiation.
AL121674, AL031669 Genomic DNA. Translation: CAI21743.1. Sequence problems.
AL121674, AL031667, AL031669 Genomic DNA. Translation: CAI21744.1.
AL121674, AL031667, AL031669 Genomic DNA. Translation: CAI21745.1.
AL031669, AL121674 Genomic DNA. Translation: CAI22254.1. Sequence problems.
AL031669, AL031667, AL121674 Genomic DNA. Translation: CAI22255.1.
AL031669, AL031667, AL121674 Genomic DNA. Translation: CAI22256.1.
AL031667, AL031669, AL121674 Genomic DNA. Translation: CAI42977.1.
AL031667, AL031669, AL121674 Genomic DNA. Translation: CAI42981.1.
AL031667 Genomic DNA. Translation: CAI42983.1.
BC021907 mRNA. Translation: AAH21907.1.
BC039860 mRNA. No translation available.
BC040016 mRNA. No translation available.
AF525085 mRNA. Translation: AAN59903.1. Different initiation.
AB037756 mRNA. Translation: BAA92573.2.
AK026022 mRNA. Translation: BAB15325.1. Sequence problems.
CCDSiCCDS13317.1. [Q8TD26-1]
RefSeqiNP_115597.3. NM_032221.4. [Q8TD26-1]
UniGeneiHs.740645.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EPBNMR-A371-431[»]
ProteinModelPortaliQ8TD26.
SMRiQ8TD26.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123931. 14 interactors.
IntActiQ8TD26. 13 interactors.
MINTiMINT-1197235.
STRINGi9606.ENSP00000362330.

PTM databases

iPTMnetiQ8TD26.
PhosphoSitePlusiQ8TD26.

Polymorphism and mutation databases

BioMutaiCHD6.
DMDMi296439466.

Proteomic databases

EPDiQ8TD26.
MaxQBiQ8TD26.
PaxDbiQ8TD26.
PeptideAtlasiQ8TD26.
PRIDEiQ8TD26.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000373222; ENSP00000362319; ENSG00000124177. [Q8TD26-2]
ENST00000373233; ENSP00000362330; ENSG00000124177. [Q8TD26-1]
GeneIDi84181.
KEGGihsa:84181.
UCSCiuc002xka.3. human. [Q8TD26-1]

Organism-specific databases

CTDi84181.
DisGeNETi84181.
GeneCardsiCHD6.
H-InvDBHIX0015824.
HIX0027712.
HGNCiHGNC:19057. CHD6.
HPAiHPA015543.
MIMi616114. gene.
neXtProtiNX_Q8TD26.
OpenTargetsiENSG00000124177.
PharmGKBiPA134974700.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0383. Eukaryota.
COG0553. LUCA.
GeneTreeiENSGT00760000119067.
HOVERGENiHBG081150.
InParanoidiQ8TD26.
KOiK14436.
OMAiTHGRFKW.
OrthoDBiEOG091G0022.
PhylomeDBiQ8TD26.
TreeFamiTF313572.

Miscellaneous databases

ChiTaRSiCHD6. human.
EvolutionaryTraceiQ8TD26.
GenomeRNAii84181.
PROiQ8TD26.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000124177.
CleanExiHS_CHD5.
HS_CHD6.
ExpressionAtlasiQ8TD26. baseline and differential.
GenevisibleiQ8TD26. HS.

Family and domain databases

Gene3Di3.40.50.300. 2 hits.
InterProiIPR006576. BRK_domain.
IPR000953. Chromo/shadow_dom.
IPR023780. Chromo_domain.
IPR016197. Chromodomain-like.
IPR002464. DNA/RNA_helicase_DEAH_CS.
IPR014001. Helicase_ATP-bd.
IPR001650. Helicase_C.
IPR027417. P-loop_NTPase.
IPR000330. SNF2_N.
[Graphical view]
PfamiPF00385. Chromo. 2 hits.
PF00271. Helicase_C. 1 hit.
PF00176. SNF2_N. 1 hit.
[Graphical view]
SMARTiSM00592. BRK. 1 hit.
SM00298. CHROMO. 2 hits.
SM00487. DEXDc. 1 hit.
SM00490. HELICc. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 2 hits.
SSF54160. SSF54160. 2 hits.
PROSITEiPS50013. CHROMO_2. 1 hit.
PS00690. DEAH_ATP_HELICASE. 1 hit.
PS51192. HELICASE_ATP_BIND_1. 1 hit.
PS51194. HELICASE_CTER. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCHD6_HUMAN
AccessioniPrimary (citable) accession number: Q8TD26
Secondary accession number(s): Q5JYQ0
, Q5TGZ9, Q5TH00, Q5TH01, Q8IZR2, Q8WTY0, Q9H4H6, Q9H6D4, Q9NTT7, Q9P2L1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 19, 2002
Last sequence update: May 18, 2010
Last modified: November 2, 2016
This is version 152 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.