Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Chromodomain-helicase-DNA-binding protein 6

Gene

CHD6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Probable chromatin-remodeling protein with a DNA-dependent ATPase activity. May play a role in transcription regulation, activating for instance, the transcription of specific genes in response to oxidative stress through interaction with NFE2L2.1 Publication

Catalytic activityi

ATP + H2O = ADP + phosphate.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi486 – 4938ATPPROSITE-ProRule annotation

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • ATP-dependent helicase activity Source: InterPro
  • DNA binding Source: UniProtKB-KW
  • DNA-dependent ATPase activity Source: UniProtKB
  • transcription cofactor binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Chromatin regulator, Helicase, Hydrolase

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

ATP-binding, DNA-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Chromodomain-helicase-DNA-binding protein 6 (EC:3.6.4.12)
Short name:
CHD-6
Alternative name(s):
ATP-dependent helicase CHD6
Radiation-induced gene B protein
Gene namesi
Name:CHD6
Synonyms:CHD5, KIAA1335, RIGB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:19057. CHD6.

Subcellular locationi

  • Nucleusnucleoplasm 1 Publication

  • Note: Enriched at sites of mRNA synthesis.

GO - Cellular componenti

  • nucleoplasm Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration disrupting CHD6 has been found in a patient with mild to moderate mental retardation and minor facial anomalies. Translocation t(18;20)(q21.1;q11.2) with TCF4 producing a CHD6-TCF4 fusion transcript (PubMed:18627065).

Organism-specific databases

PharmGKBiPA134974700.

Polymorphism and mutation databases

BioMutaiCHD6.
DMDMi296439466.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 27152715Chromodomain-helicase-DNA-binding protein 6PRO_0000080231Add
BLAST

Proteomic databases

EPDiQ8TD26.
MaxQBiQ8TD26.
PaxDbiQ8TD26.
PRIDEiQ8TD26.

PTM databases

iPTMnetiQ8TD26.
PhosphoSiteiQ8TD26.

Expressioni

Tissue specificityi

Widely expressed.

Gene expression databases

BgeeiQ8TD26.
CleanExiHS_CHD5.
HS_CHD6.
ExpressionAtlasiQ8TD26. baseline and differential.
GenevisibleiQ8TD26. HS.

Organism-specific databases

HPAiHPA015543.

Interactioni

Subunit structurei

Interacts with NFE2L2; involved in activation of the transcription. May interact with PPARA.1 Publication

GO - Molecular functioni

  • transcription cofactor binding Source: UniProtKB

Protein-protein interaction databases

BioGridi123931. 14 interactions.
IntActiQ8TD26. 13 interactions.
MINTiMINT-1197235.
STRINGi9606.ENSP00000362330.

Structurei

Secondary structure

1
2715
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi379 – 3879Combined sources
Beta strandi389 – 3913Combined sources
Beta strandi394 – 4018Combined sources
Helixi407 – 4093Combined sources
Beta strandi412 – 4143Combined sources
Turni415 – 4173Combined sources
Helixi420 – 42910Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2EPBNMR-A371-431[»]
ProteinModelPortaliQ8TD26.
SMRiQ8TD26. Positions 371-431.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8TD26.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini292 – 34352Chromo 1PROSITE-ProRule annotationAdd
BLAST
Domaini375 – 43965Chromo 2PROSITE-ProRule annotationAdd
BLAST
Domaini473 – 647175Helicase ATP-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini787 – 956170Helicase C-terminalPROSITE-ProRule annotationAdd
BLAST
Domaini1449 – 150355Myb-likeAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 747747Required for DNA-dependent ATPase activityAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi598 – 6014DEAH box

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi93 – 202110Lys-richAdd
BLAST

Sequence similaritiesi

Belongs to the SNF2/RAD54 helicase family.Curated
Contains 2 chromo domains.PROSITE-ProRule annotation
Contains 1 helicase ATP-binding domain.PROSITE-ProRule annotation
Contains 1 helicase C-terminal domain.PROSITE-ProRule annotation
Contains 1 Myb-like domain.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0383. Eukaryota.
COG0553. LUCA.
GeneTreeiENSGT00760000119067.
HOVERGENiHBG081150.
InParanoidiQ8TD26.
KOiK14436.
OMAiTHGRFKW.
OrthoDBiEOG7NSB1C.
PhylomeDBiQ8TD26.
TreeFamiTF313572.

Family and domain databases

Gene3Di3.40.50.300. 2 hits.
InterProiIPR006576. BRK_domain.
IPR000953. Chromo/shadow_dom.
IPR023780. Chromo_domain.
IPR016197. Chromodomain-like.
IPR002464. DNA/RNA_helicase_DEAH_CS.
IPR014001. Helicase_ATP-bd.
IPR001650. Helicase_C.
IPR027417. P-loop_NTPase.
IPR000330. SNF2_N.
[Graphical view]
PfamiPF00385. Chromo. 2 hits.
PF00271. Helicase_C. 1 hit.
PF00176. SNF2_N. 1 hit.
[Graphical view]
SMARTiSM00592. BRK. 1 hit.
SM00298. CHROMO. 2 hits.
SM00487. DEXDc. 1 hit.
SM00490. HELICc. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 2 hits.
SSF54160. SSF54160. 2 hits.
PROSITEiPS50013. CHROMO_2. 1 hit.
PS00690. DEAH_ATP_HELICASE. 1 hit.
PS51192. HELICASE_ATP_BIND_1. 1 hit.
PS51194. HELICASE_CTER. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TD26-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKMKIQKKEK QLSNLKVLNH SPMSDASVNF DYKSPSPFDC STDQEEKIED
60 70 80 90 100
VASHCLPQKD LYTAEEEAAT LFPRKMTSHN GMEDSGGGGT GVKKKRKKKE
110 120 130 140 150
PGDQEGAAKG SKDREPKPKR KREPKEPKEP RKAKEPKKAK EHKEPKQKDG
160 170 180 190 200
AKKARKPREA SGTKEAKEKR SCTDSAARTK SRKASKEQGP TPVEKKKKGK
210 220 230 240 250
RKSETTVESL ELDQGLTNPS LRSPEESTES TDSQKRRSGR QVKRRKYNED
260 270 280 290 300
LDFKVVDDDG ETIAVLGAGR TSALSASTLA WQAEEPPEDD ANIIEKILAS
310 320 330 340 350
KTVQEVHPGE PPFDLELFYV KYRNFSYLHC KWATMEELEK DPRIAQKIKR
360 370 380 390 400
FRNKQAQMKH IFTEPDEDLF NPDYVEVDRI LEVAHTKDAE TGEEVTHYLV
410 420 430 440 450
KWCSLPYEES TWELEEDVDP AKVKEFESLQ VLPEIKHVER PASDSWQKLE
460 470 480 490 500
KSREYKNSNQ LREYQLEGMN WLLFNWYNRK NCILADEMGL GKTIQSITFL
510 520 530 540 550
SEIFLRGIHG PFLIIAPLST ITNWEREFRT WTEMNAIVYH GSQISRQMIQ
560 570 580 590 600
QYEMVYRDAQ GNPLSGVFKF HVVITTFEMI LADCPELKKI HWSCVIIDEA
610 620 630 640 650
HRLKNRNCKL LEGLKLMALE HKVLLTGTPL QNSVEELFSL LNFLEPSQFP
660 670 680 690 700
SETAFLEEFG DLKTEEQVKK LQSILKPMML RRLKDDVEKN LAPKQETIIE
710 720 730 740 750
VELTNIQKKY YRAILEKNFS FLTKGANQHN MPNLINTMME LRKCCNHPYL
760 770 780 790 800
INGAEEKILE DFRKTHSPDA PDFQLQAMIQ AAGKLVLIDK LLPKLIAGGH
810 820 830 840 850
KVLIFSQMVR CLDILEDYLI QRRYTYERID GRVRGNLRQA AIDRFCKPDS
860 870 880 890 900
DRFVFLLCTR AGGLGINLTA ADTCIIFDSD WNPQNDLQAQ ARCHRIGQSK
910 920 930 940 950
AVKVYRLITR NSYEREMFDK ASLKLGLDKA VLQDINRKGG TNGVQQLSKM
960 970 980 990 1000
EVEDLLRKGA YGALMDEEDE GSKFCEEDID QILQRRTHTI TIQSEGKGST
1010 1020 1030 1040 1050
FAKASFVASG NRTDISLDDP NFWQKWAKIA ELDTEAKNEK ESLVIDRPRV
1060 1070 1080 1090 1100
RKQTKHYNSF EEDELMEFSE LDSDSDERPT RSRRLNDKAR RYLRAECFRV
1110 1120 1130 1140 1150
EKNLLIFGWG RWKDILTHGR FKWHLNEKDM EMICRALLVY CVKHYKGDEK
1160 1170 1180 1190 1200
IKSFIWELIT PTKDGQAQTL QNHSGLSAPV PRGRKGKKTK NQLLIPELKD
1210 1220 1230 1240 1250
ADWLATCNPE VVLHDDGYKK HLKQHCNKVL LRVRMLYYLK AEILGEAAEK
1260 1270 1280 1290 1300
AFEGSPAREL DVPLPDIDYM EIPVDWWDAE ADKSLLIGVF KHGYERYNAM
1310 1320 1330 1340 1350
RADPALCFLE KVGMPDEKSL SAEQGVTDGT SDIPERGNTD KEDNAEDKVD
1360 1370 1380 1390 1400
GLQKQTESSS DGGDGVFSEK KDDSRAAQDG SDPDKSPWPV SSALTARLRR
1410 1420 1430 1440 1450
LVTVYQRCNR KELCRPEILG PGNQGYWVQE EMFRRTSEMD LINKEAQKRW
1460 1470 1480 1490 1500
TRREQADFYR TVSSFGVVYD QEKKTFDWTQ FRIISRLDKK SDESLEQYFY
1510 1520 1530 1540 1550
SFVAMCRNVC RLPTWKDGGP PDTTIYVEPI TEERAARTLY RIELLRKVRE
1560 1570 1580 1590 1600
QVLKCPQLHE RLQLCRPSLY LPVWWECGKH DRDLLIGTAK HGLNRTDCYI
1610 1620 1630 1640 1650
MNDPQLSFLD AYRNYAQHKR SGTQAPGNLC CLYQTNSKLY ESLTYSQMSR
1660 1670 1680 1690 1700
TSESLENEPE NLVRVESRDD HLSLPDVTCE NFISKVQDVI SINHDESLLP
1710 1720 1730 1740 1750
ESLESMMYGK KVLSQEPSSF QESPSTNTES RKDVITISIS KDGNCQSGGP
1760 1770 1780 1790 1800
EAEIASGPTF MGSLEAGGVA QANIKNGKHL LMSISKEGEL CCSEAGQRPE
1810 1820 1830 1840 1850
NIGQLEAKCL ASPSLNPGNE SGFVDMCSLS VCDSKRNLSS DQQLIDLLEN
1860 1870 1880 1890 1900
KSLESKLILS QNHSDEEEEE EENEEENLAM AVGMGERPEV LHLTEPTTNI
1910 1920 1930 1940 1950
SREKNQGFQD ETKKGSLEVA NQTPGLQRAF PAPAACQCHC KHMERWMHGL
1960 1970 1980 1990 2000
ENDEFEIEKP KAYIPDLFKS KTNTIAMEGE PTAIPSQPFK VKHELLKEPW
2010 2020 2030 2040 2050
KESAEGQNVF PTYPLEGSEL KSEDMDFENK DDYDRDGNCH SQDYPGKYSE
2060 2070 2080 2090 2100
EESKSSTSGI TGDIGDELQE ARAPTIAQLL QEKTLYSFSE WPKDRVIINR
2110 2120 2130 2140 2150
LDNICHVVLK GKWPSSQQYE PSGTLPTPVL TSSAGSRTSL SEPEAAEHSF
2160 2170 2180 2190 2200
SNGAALAAQI HKESFLAPVF TKDEQKHRRP YEFEVERDAK ARGLEQFSAT
2210 2220 2230 2240 2250
HGHTPIILNG WHGESAMDLS CSSEGSPGAT SPFPVSASTP KIGAISSLQG
2260 2270 2280 2290 2300
ALGMDLSGIL QAGLIHPVTG QIVNGSLRRD DAATRRRRGR RKHVEGGMDL
2310 2320 2330 2340 2350
IFLKEQTLQA GILEVHEDPG QATLSTTHPE GPGPATSAPE PATAASSQAE
2360 2370 2380 2390 2400
KSIPSKSLLD WLRQQADYSL EVPGFGANFS DKPKQRRPRC KEPGKLDVSS
2410 2420 2430 2440 2450
LSGEERVPAI PKEPGLRGFL PENKFNHTLA EPILRDTGPR RRGRRPRSEL
2460 2470 2480 2490 2500
LKAPSIVADS PSGMGPLFMN GLIAGMDLVG LQNMRNMPGI PLTGLVGFPA
2510 2520 2530 2540 2550
GFATMPTGEE VKSTLSMLPM MLPGMAAVPQ MFGVGGLLSP PMATTCTSTA
2560 2570 2580 2590 2600
PASLSSTTKS GTAVTEKTAE DKPSSHDVKT DTLAEDKPGP GPFSDQSEPA
2610 2620 2630 2640 2650
ITTSSPVAFN PFLIPGVSPG LIYPSMFLSP GMGMALPAMQ QARHSEIVGL
2660 2670 2680 2690 2700
ESQKRKKKKT KGDNPNSHPE PAPSCEREPS GDENCAEPSA PLPAEREHGA
2710
QAGEGALKDS NNDTN
Length:2,715
Mass (Da):305,412
Last modified:May 18, 2010 - v4
Checksum:i5B3FEC537340A8B7
GO
Isoform 2 (identifier: Q8TD26-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MKMKIQKKEK → MCQSHMIGFCTSSVNEETETQGDQISCPNPTTLVFRTQISSLPSL
     325-338: FSYLHCKWATMEEL → LYVYLKYSLYLGFI
     339-2715: Missing.

Note: Gene prediction based on EST data.
Show »
Length:373
Mass (Da):41,654
Checksum:i0264B708481CB446
GO
Isoform 3 (identifier: Q8TD26-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     592-1108: Missing.
     1337-1339: GNT → QHR
     1340-2715: Missing.

Note: No experimental confirmation available.
Show »
Length:822
Mass (Da):94,609
Checksum:iBC0D0A3987286332
GO

Sequence cautioni

The sequence AAK56405.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAN59903.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB15325.1 differs from that shown.The sequence differs from position 1528 onward for unknown reasons.Curated
The sequence CAI21743.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAI22254.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti134 – 1341K → E in AAK56405 (PubMed:11889561).Curated
Sequence conflicti575 – 5751T → A in AAN59903 (Ref. 4) Curated
Sequence conflicti1031 – 10311E → K in AAK56405 (PubMed:11889561).Curated
Sequence conflicti2442 – 24476RGRRPR → EIVGLE in AAH21907 (PubMed:15489334).Curated
Sequence conflicti2663 – 26631D → G in AAK56405 (PubMed:11889561).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti780 – 7801Q → H.
Corresponds to variant rs4474937 [ dbSNP | Ensembl ].
VAR_059213
Natural varianti2161 – 21611H → Q.
Corresponds to variant rs3817893 [ dbSNP | Ensembl ].
VAR_023363

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1010MKMKIQKKEK → MCQSHMIGFCTSSVNEETET QGDQISCPNPTTLVFRTQIS SLPSL in isoform 2. 1 PublicationVSP_015296
Alternative sequencei325 – 33814FSYLH…TMEEL → LYVYLKYSLYLGFI in isoform 2. 1 PublicationVSP_015297Add
BLAST
Alternative sequencei339 – 27152377Missing in isoform 2. 1 PublicationVSP_015298Add
BLAST
Alternative sequencei592 – 1108517Missing in isoform 3. 1 PublicationVSP_015299Add
BLAST
Alternative sequencei1337 – 13393GNT → QHR in isoform 3. 1 PublicationVSP_015300
Alternative sequencei1340 – 27151376Missing in isoform 3. 1 PublicationVSP_015301Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY034072 mRNA. Translation: AAK56405.1. Different initiation.
AL121674, AL031669 Genomic DNA. Translation: CAI21743.1. Sequence problems.
AL121674, AL031667, AL031669 Genomic DNA. Translation: CAI21744.1.
AL121674, AL031667, AL031669 Genomic DNA. Translation: CAI21745.1.
AL031669, AL121674 Genomic DNA. Translation: CAI22254.1. Sequence problems.
AL031669, AL031667, AL121674 Genomic DNA. Translation: CAI22255.1.
AL031669, AL031667, AL121674 Genomic DNA. Translation: CAI22256.1.
AL031667, AL031669, AL121674 Genomic DNA. Translation: CAI42977.1.
AL031667, AL031669, AL121674 Genomic DNA. Translation: CAI42981.1.
AL031667 Genomic DNA. Translation: CAI42983.1.
BC021907 mRNA. Translation: AAH21907.1.
BC039860 mRNA. No translation available.
BC040016 mRNA. No translation available.
AF525085 mRNA. Translation: AAN59903.1. Different initiation.
AB037756 mRNA. Translation: BAA92573.2.
AK026022 mRNA. Translation: BAB15325.1. Sequence problems.
CCDSiCCDS13317.1. [Q8TD26-1]
RefSeqiNP_115597.3. NM_032221.4. [Q8TD26-1]
UniGeneiHs.740645.

Genome annotation databases

EnsembliENST00000373222; ENSP00000362319; ENSG00000124177. [Q8TD26-2]
ENST00000373233; ENSP00000362330; ENSG00000124177. [Q8TD26-1]
GeneIDi84181.
KEGGihsa:84181.
UCSCiuc002xka.3. human. [Q8TD26-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY034072 mRNA. Translation: AAK56405.1. Different initiation.
AL121674, AL031669 Genomic DNA. Translation: CAI21743.1. Sequence problems.
AL121674, AL031667, AL031669 Genomic DNA. Translation: CAI21744.1.
AL121674, AL031667, AL031669 Genomic DNA. Translation: CAI21745.1.
AL031669, AL121674 Genomic DNA. Translation: CAI22254.1. Sequence problems.
AL031669, AL031667, AL121674 Genomic DNA. Translation: CAI22255.1.
AL031669, AL031667, AL121674 Genomic DNA. Translation: CAI22256.1.
AL031667, AL031669, AL121674 Genomic DNA. Translation: CAI42977.1.
AL031667, AL031669, AL121674 Genomic DNA. Translation: CAI42981.1.
AL031667 Genomic DNA. Translation: CAI42983.1.
BC021907 mRNA. Translation: AAH21907.1.
BC039860 mRNA. No translation available.
BC040016 mRNA. No translation available.
AF525085 mRNA. Translation: AAN59903.1. Different initiation.
AB037756 mRNA. Translation: BAA92573.2.
AK026022 mRNA. Translation: BAB15325.1. Sequence problems.
CCDSiCCDS13317.1. [Q8TD26-1]
RefSeqiNP_115597.3. NM_032221.4. [Q8TD26-1]
UniGeneiHs.740645.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2EPBNMR-A371-431[»]
ProteinModelPortaliQ8TD26.
SMRiQ8TD26. Positions 371-431.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123931. 14 interactions.
IntActiQ8TD26. 13 interactions.
MINTiMINT-1197235.
STRINGi9606.ENSP00000362330.

PTM databases

iPTMnetiQ8TD26.
PhosphoSiteiQ8TD26.

Polymorphism and mutation databases

BioMutaiCHD6.
DMDMi296439466.

Proteomic databases

EPDiQ8TD26.
MaxQBiQ8TD26.
PaxDbiQ8TD26.
PRIDEiQ8TD26.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000373222; ENSP00000362319; ENSG00000124177. [Q8TD26-2]
ENST00000373233; ENSP00000362330; ENSG00000124177. [Q8TD26-1]
GeneIDi84181.
KEGGihsa:84181.
UCSCiuc002xka.3. human. [Q8TD26-1]

Organism-specific databases

CTDi84181.
GeneCardsiCHD6.
H-InvDBHIX0015824.
HIX0027712.
HGNCiHGNC:19057. CHD6.
HPAiHPA015543.
MIMi616114. gene.
neXtProtiNX_Q8TD26.
PharmGKBiPA134974700.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0383. Eukaryota.
COG0553. LUCA.
GeneTreeiENSGT00760000119067.
HOVERGENiHBG081150.
InParanoidiQ8TD26.
KOiK14436.
OMAiTHGRFKW.
OrthoDBiEOG7NSB1C.
PhylomeDBiQ8TD26.
TreeFamiTF313572.

Miscellaneous databases

ChiTaRSiCHD6. human.
EvolutionaryTraceiQ8TD26.
GenomeRNAii84181.
PROiQ8TD26.
SOURCEiSearch...

Gene expression databases

BgeeiQ8TD26.
CleanExiHS_CHD5.
HS_CHD6.
ExpressionAtlasiQ8TD26. baseline and differential.
GenevisibleiQ8TD26. HS.

Family and domain databases

Gene3Di3.40.50.300. 2 hits.
InterProiIPR006576. BRK_domain.
IPR000953. Chromo/shadow_dom.
IPR023780. Chromo_domain.
IPR016197. Chromodomain-like.
IPR002464. DNA/RNA_helicase_DEAH_CS.
IPR014001. Helicase_ATP-bd.
IPR001650. Helicase_C.
IPR027417. P-loop_NTPase.
IPR000330. SNF2_N.
[Graphical view]
PfamiPF00385. Chromo. 2 hits.
PF00271. Helicase_C. 1 hit.
PF00176. SNF2_N. 1 hit.
[Graphical view]
SMARTiSM00592. BRK. 1 hit.
SM00298. CHROMO. 2 hits.
SM00487. DEXDc. 1 hit.
SM00490. HELICc. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 2 hits.
SSF54160. SSF54160. 2 hits.
PROSITEiPS50013. CHROMO_2. 1 hit.
PS00690. DEAH_ATP_HELICASE. 1 hit.
PS51192. HELICASE_ATP_BIND_1. 1 hit.
PS51194. HELICASE_CTER. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "CHD5 defines a new subfamily of chromodomain-SWI2/SNF2-like helicases."
    Schuster E.F., Stoeger R.J.
    Mamm. Genome 13:117-119(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "The DNA sequence and comparative analysis of human chromosome 20."
    Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
    , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
    Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2442-2715 (ISOFORM 1).
    Tissue: Hippocampus, Lymph and Retinoblastoma.
  4. "cDNA cloning and transcriptional controlling of a novel radiation-induced gene and its function analysis."
    Zhou P.-K., Sui J.-L.
    Zhonghua Fang She Yi Xue Yu Fang Hu Za Zhi 22:73-77(2002)
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 299-2715 (ISOFORM 3).
  5. "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
    DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 675-2715 (ISOFORM 1).
    Tissue: Brain.
  6. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 759-1527 (ISOFORM 1).
  8. "The carboxy-terminal Neh3 domain of Nrf2 is required for transcriptional activation."
    Nioi P., Nguyen T., Sherratt P.J., Pickett C.B.
    Mol. Cell. Biol. 25:10895-10906(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN TRANSCRIPTION, INTERACTION WITH NFE2L2.
  9. "CHD6 is a DNA-dependent ATPase and localizes at nuclear sites of mRNA synthesis."
    Lutz T., Stoger R., Nieto A.
    FEBS Lett. 580:5851-5857(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: CATALYTIC ACTIVITY, SUBCELLULAR LOCATION, REGION.
  10. "Disruption of the TCF4 gene in a girl with mental retardation but without the classical Pitt-Hopkins syndrome."
    Kalscheuer V.M., Feenstra I., Van Ravenswaaij-Arts C.M., Smeets D.F., Menzel C., Ullmann R., Musante L., Ropers H.H.
    Am. J. Med. Genet. A 146A:2053-2059(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISEASE.
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. "Solution structure of chromo domain 2 in chromodomain-helicase-DNA-binding protein 6."
    RIKEN structural genomics initiative (RSGI)
    Submitted (OCT-2007) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 371-431.

Entry informationi

Entry nameiCHD6_HUMAN
AccessioniPrimary (citable) accession number: Q8TD26
Secondary accession number(s): Q5JYQ0
, Q5TGZ9, Q5TH00, Q5TH01, Q8IZR2, Q8WTY0, Q9H4H6, Q9H6D4, Q9NTT7, Q9P2L1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 19, 2002
Last sequence update: May 18, 2010
Last modified: June 8, 2016
This is version 148 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.