Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8TD16

- BICD2_HUMAN

UniProt

Q8TD16 - BICD2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein bicaudal D homolog 2

Gene

BICD2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May play a role in the dynein-dynactin interactions on the surface of membranous organelles, by associating with these complexes. Regulates coat complex coatomer protein I (COPI)-independent Golgi-endoplasmic reticulum transport by recruiting the dynein-dynactin motor complex (By similarity).By similarity

GO - Molecular functioni

  1. Rab GTPase binding Source: BHF-UCL

GO - Biological processi

  1. cell death Source: UniProtKB-KW
  2. microtubule anchoring at microtubule organizing center Source: BHF-UCL
  3. minus-end-directed organelle transport along microtubule Source: BHF-UCL
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Protein bicaudal D homolog 2
Short name:
Bic-D 2
Gene namesi
Name:BICD2
Synonyms:KIAA0699
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:17208. BICD2.

Subcellular locationi

Golgi apparatus. Cytoplasmcytoskeleton
Note: In interphase cells mainly localizes to the Golgi complex and colocalizes with dynactin at microtubule plus ends (By similarity). Its localization is dependent on microtubule morphology.By similarity

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. cytoplasmic vesicle Source: BHF-UCL
  3. cytoskeleton Source: UniProtKB-KW
  4. Golgi apparatus Source: HPA
  5. plasma membrane Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Golgi apparatus

Pathology & Biotechi

Involvement in diseasei

Spinal muscular atrophy, lower extremity-predominant 2, autosomal dominant (SMALED2) [MIM:615290]: An autosomal dominant form of spinal muscular atrophy characterized by early-childhood onset of muscle weakness and atrophy predominantly affecting the proximal and distal muscles of the lower extremity, although some patients may show upper extremity involvement. The disorder results in delayed walking, waddling gait, difficulty walking, and loss of distal reflexes. Some patients may have foot deformities or hyperlordosis, and some show mild upper motor signs, such as spasticity. Sensation, bulbar function, and cognitive function are preserved. The disorder shows very slow progression throughout life.3 Publications
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti107 – 1071S → L in SMALED2; causes Golgi fragmentation; affects interaction with RAB6A and DNAI1 and the subcellular location of the protein. 3 Publications
VAR_070112
Natural varianti188 – 1881N → T in SMALED2; causes Golgi fragmentation. 1 Publication
VAR_070113
Natural varianti189 – 1891I → F in SMALED2. 1 Publication
VAR_070114
Natural varianti501 – 5011R → P in SMALED2; the mutation causes increased interaction with dynein; the mutant protein accumulates abnormally in the perinuclear region where it forms ring-like structures that colocalize with RAB6A. 1 Publication
VAR_070115
Natural varianti508 – 5081K → T in SMALED2. 1 Publication
VAR_070116
Natural varianti703 – 7031T → M in SMALED2; causes Golgi fragmentation. 1 Publication
VAR_070117
Natural varianti774 – 7741E → G in SMALED2; affects interaction with RAB6A and DNAI1 and the subcellular location of the protein. 1 Publication
VAR_070118

Keywords - Diseasei

Disease mutation, Neurodegeneration

Organism-specific databases

MIMi615290. phenotype.
Orphaneti363454. Autosomal dominant childhood-onset proximal spinal muscular atrophy with contractures.
PharmGKBiPA134969018.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed2 Publications
Chaini2 – 824823Protein bicaudal D homolog 2PRO_0000205359Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylserine2 Publications
Modified residuei190 – 1901Phosphoserine2 Publications
Modified residuei224 – 2241Phosphoserine1 Publication
Modified residuei343 – 3431Phosphoserine1 Publication
Modified residuei395 – 3951Phosphoserine1 Publication
Modified residuei582 – 5821Phosphoserine5 Publications
Modified residuei821 – 8211Phosphothreonine1 Publication
Modified residuei823 – 8231Phosphoserine1 Publication

Post-translational modificationi

Phosphorylated by NEK9 in vitro.7 Publications

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ8TD16.
PaxDbiQ8TD16.
PRIDEiQ8TD16.

PTM databases

PhosphoSiteiQ8TD16.

Expressioni

Tissue specificityi

Ubiquitous.

Gene expression databases

BgeeiQ8TD16.
CleanExiHS_BICD2.
GenevestigatoriQ8TD16.

Organism-specific databases

HPAiHPA023013.
HPA024452.

Interactioni

Subunit structurei

Interacts with DCTN2 and RAB6A. Interacts with NEK9. Interacts with DNAI1.3 Publications

Protein-protein interaction databases

BioGridi116891. 19 interactions.
DIPiDIP-53426N.
IntActiQ8TD16. 8 interactions.
MINTiMINT-5006473.
STRINGi9606.ENSP00000349351.

Structurei

3D structure databases

ProteinModelPortaliQ8TD16.
SMRiQ8TD16. Positions 716-797.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni663 – 803141Interacts with RAB6ABy similarityAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili20 – 269250Sequence AnalysisAdd
BLAST
Coiled coili338 – 537200Sequence AnalysisAdd
BLAST
Coiled coili666 – 808143Sequence AnalysisAdd
BLAST

Domaini

The fourth coiled coil region is involved in Golgi targeting and in the interaction with DCTN2.By similarity

Sequence similaritiesi

Belongs to the BicD family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG291306.
GeneTreeiENSGT00390000004114.
HOVERGENiHBG050686.
InParanoidiQ8TD16.
OMAiRNVLTNT.
OrthoDBiEOG7BZVRK.
PhylomeDBiQ8TD16.
TreeFamiTF323833.

Family and domain databases

InterProiIPR018477. Bicaudal-D_microtubule-assoc.
[Graphical view]
PANTHERiPTHR31233. PTHR31233. 1 hit.
PfamiPF09730. BicD. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8TD16-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAPSEEEEY ARLVMEAQPE WLRAEVKRLS HELAETTREK IQAAEYGLAV
60 70 80 90 100
LEEKHQLKLQ FEELEVDYEA IRSEMEQLKE AFGQAHTNHK KVAADGESRE
110 120 130 140 150
ESLIQESASK EQYYVRKVLE LQTELKQLRN VLTNTQSENE RLASVAQELK
160 170 180 190 200
EINQNVEIQR GRLRDDIKEY KFREARLLQD YSELEEENIS LQKQVSVLRQ
210 220 230 240 250
NQVEFEGLKH EIKRLEEETE YLNSQLEDAI RLKEISERQL EEALETLKTE
260 270 280 290 300
REQKNSLRKE LSHYMSINDS FYTSHLHVSL DGLKFSDDAA EPNNDAEALV
310 320 330 340 350
NGFEHGGLAK LPLDNKTSTP KKEGLAPPSP SLVSDLLSEL NISEIQKLKQ
360 370 380 390 400
QLMQMEREKA GLLATLQDTQ KQLEHTRGSL SEQQEKVTRL TENLSALRRL
410 420 430 440 450
QASKERQTAL DNEKDRDSHE DGDYYEVDIN GPEILACKYH VAVAEAGELR
460 470 480 490 500
EQLKALRSTH EAREAQHAEE KGRYEAEGQA LTEKVSLLEK ASRQDRELLA
510 520 530 540 550
RLEKELKKVS DVAGETQGSL SVAQDELVTF SEELANLYHH VCMCNNETPN
560 570 580 590 600
RVMLDYYREG QGGAGRTSPG GRTSPEARGR RSPILLPKGL LAPEAGRADG
610 620 630 640 650
GTGDSSPSPG SSLPSPLSDP RREPMNIYNL IAIIRDQIKH LQAAVDRTTE
660 670 680 690 700
LSRQRIASQE LGPAVDKDKE ALMEEILKLK SLLSTKREQI TTLRTVLKAN
710 720 730 740 750
KQTAEVALAN LKSKYENEKA MVTETMMKLR NELKALKEDA ATFSSLRAMF
760 770 780 790 800
ATRCDEYITQ LDEMQRQLAA AEDEKKTLNS LLRMAIQQKL ALTQRLELLE
810 820
LDHEQTRRGR AKAAPKTKPA TPSL
Length:824
Mass (Da):93,533
Last modified:June 1, 2002 - v1
Checksum:i9C49138FF416378D
GO
Isoform 2 (identifier: Q8TD16-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     824-824: L → VSHTCACASDRAEGTGLANQVFCSEKHSIYCD

Note: Due to intron retention. No experimental confirmation available.

Show »
Length:855
Mass (Da):96,806
Checksum:iDE52F8A0D1FCDFD8
GO

Sequence cautioni

The sequence BAA31674.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti90 – 901K → R.1 Publication
Corresponds to variant rs61754130 [ dbSNP | Ensembl ].
VAR_070111
Natural varianti107 – 1071S → L in SMALED2; causes Golgi fragmentation; affects interaction with RAB6A and DNAI1 and the subcellular location of the protein. 3 Publications
VAR_070112
Natural varianti188 – 1881N → T in SMALED2; causes Golgi fragmentation. 1 Publication
VAR_070113
Natural varianti189 – 1891I → F in SMALED2. 1 Publication
VAR_070114
Natural varianti501 – 5011R → P in SMALED2; the mutation causes increased interaction with dynein; the mutant protein accumulates abnormally in the perinuclear region where it forms ring-like structures that colocalize with RAB6A. 1 Publication
VAR_070115
Natural varianti508 – 5081K → T in SMALED2. 1 Publication
VAR_070116
Natural varianti703 – 7031T → M in SMALED2; causes Golgi fragmentation. 1 Publication
VAR_070117
Natural varianti774 – 7741E → G in SMALED2; affects interaction with RAB6A and DNAI1 and the subcellular location of the protein. 1 Publication
VAR_070118

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei824 – 8241L → VSHTCACASDRAEGTGLANQ VFCSEKHSIYCD in isoform 2. 1 PublicationVSP_007969

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY052562 mRNA. Translation: AAL12246.1.
AB014599 mRNA. Translation: BAA31674.1. Different initiation.
AL137074, AL136981 Genomic DNA. Translation: CAI14369.1.
AL137074, AL136981 Genomic DNA. Translation: CAI14370.1.
AL136981, AL137074 Genomic DNA. Translation: CAI41013.1.
AL136981, AL137074 Genomic DNA. Translation: CAI41014.1.
BC004296 mRNA. Translation: AAH04296.1.
BC073970 mRNA. Translation: AAH73970.1.
CCDSiCCDS35064.1. [Q8TD16-2]
CCDS6700.1. [Q8TD16-1]
RefSeqiNP_001003800.1. NM_001003800.1. [Q8TD16-2]
NP_056065.1. NM_015250.3. [Q8TD16-1]
UniGeneiHs.436939.

Genome annotation databases

EnsembliENST00000356884; ENSP00000349351; ENSG00000185963. [Q8TD16-2]
ENST00000375512; ENSP00000364662; ENSG00000185963. [Q8TD16-1]
GeneIDi23299.
KEGGihsa:23299.
UCSCiuc004aso.1. human. [Q8TD16-1]
uc004asp.1. human. [Q8TD16-2]

Polymorphism databases

DMDMi34098604.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY052562 mRNA. Translation: AAL12246.1 .
AB014599 mRNA. Translation: BAA31674.1 . Different initiation.
AL137074 , AL136981 Genomic DNA. Translation: CAI14369.1 .
AL137074 , AL136981 Genomic DNA. Translation: CAI14370.1 .
AL136981 , AL137074 Genomic DNA. Translation: CAI41013.1 .
AL136981 , AL137074 Genomic DNA. Translation: CAI41014.1 .
BC004296 mRNA. Translation: AAH04296.1 .
BC073970 mRNA. Translation: AAH73970.1 .
CCDSi CCDS35064.1. [Q8TD16-2 ]
CCDS6700.1. [Q8TD16-1 ]
RefSeqi NP_001003800.1. NM_001003800.1. [Q8TD16-2 ]
NP_056065.1. NM_015250.3. [Q8TD16-1 ]
UniGenei Hs.436939.

3D structure databases

ProteinModelPortali Q8TD16.
SMRi Q8TD16. Positions 716-797.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116891. 19 interactions.
DIPi DIP-53426N.
IntActi Q8TD16. 8 interactions.
MINTi MINT-5006473.
STRINGi 9606.ENSP00000349351.

PTM databases

PhosphoSitei Q8TD16.

Polymorphism databases

DMDMi 34098604.

Proteomic databases

MaxQBi Q8TD16.
PaxDbi Q8TD16.
PRIDEi Q8TD16.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000356884 ; ENSP00000349351 ; ENSG00000185963 . [Q8TD16-2 ]
ENST00000375512 ; ENSP00000364662 ; ENSG00000185963 . [Q8TD16-1 ]
GeneIDi 23299.
KEGGi hsa:23299.
UCSCi uc004aso.1. human. [Q8TD16-1 ]
uc004asp.1. human. [Q8TD16-2 ]

Organism-specific databases

CTDi 23299.
GeneCardsi GC09M095473.
HGNCi HGNC:17208. BICD2.
HPAi HPA023013.
HPA024452.
MIMi 609797. gene.
615290. phenotype.
neXtProti NX_Q8TD16.
Orphaneti 363454. Autosomal dominant childhood-onset proximal spinal muscular atrophy with contractures.
PharmGKBi PA134969018.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG291306.
GeneTreei ENSGT00390000004114.
HOVERGENi HBG050686.
InParanoidi Q8TD16.
OMAi RNVLTNT.
OrthoDBi EOG7BZVRK.
PhylomeDBi Q8TD16.
TreeFami TF323833.

Miscellaneous databases

ChiTaRSi BICD2. human.
GeneWikii BICD2.
GenomeRNAii 23299.
NextBioi 45128.
PROi Q8TD16.
SOURCEi Search...

Gene expression databases

Bgeei Q8TD16.
CleanExi HS_BICD2.
Genevestigatori Q8TD16.

Family and domain databases

InterProi IPR018477. Bicaudal-D_microtubule-assoc.
[Graphical view ]
PANTHERi PTHR31233. PTHR31233. 1 hit.
Pfami PF09730. BicD. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Purification, cloning, and characterization of Nek8, a novel NIMA-related kinase, and its candidate substrate Bicd2."
    Holland P.M., Milne A., Garka K., Johnson R.S., Willis C., Sims J.E., Rauch C.T., Bird T.A., Virca G.D.
    J. Biol. Chem. 277:16229-16240(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH NEK9, PHOSPHORYLATION BY NEK9.
  2. "Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Ishikawa K., Nagase T., Suyama M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:169-176(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  3. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 239-824 (ISOFORM 1).
    Tissue: Pancreas and Skin.
  5. "Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry."
    Brill L.M., Salomon A.R., Ficarro S.B., Mukherji M., Stettler-Gill M., Peters E.C.
    Anal. Chem. 76:2763-2772(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-582, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  6. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-582, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-190; SER-224; SER-343; SER-395 AND SER-582, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-190; THR-821 AND SER-823, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  11. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-582, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-582, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. "Molecular defects in the motor adaptor BICD2 cause proximal spinal muscular atrophy with autosomal-dominant inheritance."
    Peeters K., Litvinenko I., Asselbergh B., Almeida-Souza L., Chamova T., Geuens T., Ydens E., Zimon M., Irobi J., De Vriendt E., De Winter V., Ooms T., Timmerman V., Tournev I., Jordanova A.
    Am. J. Hum. Genet. 92:955-964(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS SMALED2 LEU-107 AND GLY-774, CHARACTERIZATION OF VARIANTS SMALED2 LEU-107 AND GLY-774, INTERACTION WITH DNAI1 AND RAB6A.
  16. Cited for: VARIANTS SMALED2 LEU-107; PHE-189; PRO-501 AND THR-508, CHARACTERIZATION OF VARIANTS SMALED2 LEU-107 AND PRO-501, INTERACTION WITH DNAI1.
  17. Cited for: VARIANTS SMALED2 LEU-107; THR-188 AND MET-703, CHARACTERIZATION OF VARIANTS SMALED2 LEU-107; THR-188 AND MET-703, VARIANT ARG-90.

Entry informationi

Entry nameiBICD2_HUMAN
AccessioniPrimary (citable) accession number: Q8TD16
Secondary accession number(s): O75181
, Q5TBQ2, Q5TBQ3, Q96LH2, Q9BT84, Q9H561
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: June 1, 2002
Last modified: November 26, 2014
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3