SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8TCX1

- DC2L1_HUMAN

UniProt

Q8TCX1 - DC2L1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Cytoplasmic dynein 2 light intermediate chain 1
Gene
DYNC2LI1, D2LIC, LIC3, CGI-60
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May function as a motor for intraflagellar retrograde transport. Functions in cilia biogenesis By similarity.

GO - Molecular functioni

  1. motor activity Source: UniProtKB-KW
  2. protein binding Source: IntAct

GO - Biological processi

  1. antigen processing and presentation of exogenous peptide antigen via MHC class II Source: Reactome
  2. cilium assembly Source: Ensembl
  3. determination of left/right symmetry Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Motor protein

Keywords - Biological processi

Cilium biogenesis/degradation

Enzyme and pathway databases

ReactomeiREACT_121399. MHC class II antigen presentation.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytoplasmic dynein 2 light intermediate chain 1
Short name:
Dynein 2 light intermediate chain
Gene namesi
Synonyms:D2LIC, LIC3
ORF Names:CGI-60
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:24595. DYNC2LI1.

Subcellular locationi

Cytoplasmcytoskeletoncilium axoneme By similarity. Cytoplasm By similarity
Note: Localizes to the apical cytoplasm By similarity.

GO - Cellular componenti

  1. apical part of cell Source: BHF-UCL
  2. axonemal dynein complex Source: BHF-UCL
  3. axoneme Source: BHF-UCL
  4. cytosol Source: Reactome
  5. intraciliary transport particle Source: Ensembl
  6. microtubule Source: UniProtKB-KW
  7. motile primary cilium Source: BHF-UCL
  8. primary cilium Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Dynein, Microtubule

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671919.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 351351Cytoplasmic dynein 2 light intermediate chain 1
PRO_0000318750Add
BLAST

Proteomic databases

MaxQBiQ8TCX1.
PaxDbiQ8TCX1.
PRIDEiQ8TCX1.

PTM databases

PhosphoSiteiQ8TCX1.

Expressioni

Gene expression databases

ArrayExpressiQ8TCX1.
BgeeiQ8TCX1.
CleanExiHS_DYNC2LI1.
GenevestigatoriQ8TCX1.

Interactioni

Subunit structurei

The cytoplasmic dynein complex 2 is probably composed by a DYNC2H1 homodimer and a number of DYNC2LI1 light intermediate chains By similarity.

Binary interactionsi

WithEntry#Exp.IntActNotes
SOD1P004413EBI-8568003,EBI-990792

Protein-protein interaction databases

BioGridi119644. 2 interactions.
IntActiQ8TCX1. 3 interactions.
MINTiMINT-6784031.

Structurei

3D structure databases

ProteinModelPortaliQ8TCX1.

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG256387.
HOVERGENiHBG066237.
InParanoidiQ8TCX1.
KOiK10417.
OMAiKLEPREN.
OrthoDBiEOG70CR6X.
PhylomeDBiQ8TCX1.
TreeFamiTF314138.

Family and domain databases

Gene3Di3.40.50.300. 2 hits.
InterProiIPR022780. Dynein_light_int_chain.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF05783. DLIC. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 2 hits.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8TCX1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MPSETLWEIA KAEVEKRGIN GSEGDGAEIA EKFVFFIGSK NGGKTTIILR    50
CLDRDEPPKP TLALEYTYGR RAKGHNTPKD IAHFWELGGG TSLLDLISIP 100
ITGDTLRTFS LVLVLDLSKP NDLWPTMENL LQATKSHVDK VIMKLGKTNA 150
KAVSEMRQKI WNNMPKDHPD HELIDPFPVP LVIIGSKYDV FQDFESEKRK 200
VICKTLRFVA HYYGASLMFT SKSEALLLKI RGVINQLAFG IDKSKSICVD 250
QNKPLFITAG LDSFGQIGSP PVPENDIGKL HAHSPMELWK KVYEKLFPPK 300
SINTLKDIKD PARDPQYAEN EVDEMRIQKD LELEQYKRSS SKSWKQIELD 350
S 351
Length:351
Mass (Da):39,625
Last modified:June 1, 2002 - v1
Checksum:iBB4BB8B528D4A99A
GO
Isoform 2 (identifier: Q8TCX1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     169-169: P → PQ

Show »
Length:352
Mass (Da):39,753
Checksum:i156B9FAB4FDABAC1
GO
Isoform 3 (identifier: Q8TCX1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     332-351: ELEQYKRSSSKSWKQIELDS → VLS

Show »
Length:334
Mass (Da):37,500
Checksum:iC4D1D8FF4A49656F
GO
Isoform 4 (identifier: Q8TCX1-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     170-201: DHELIDPFPVPLVIIGSKYDVFQDFESEKRKV → VSCCLGLLLESLVPFIVNDNITNNFFRFLCMT
     202-351: Missing.

Show »
Length:201
Mass (Da):22,433
Checksum:i88D40AFF3FB35E50
GO
Isoform 5 (identifier: Q8TCX1-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     108-144: TFSLVLVLDLSKPNDLWPTMENLLQATKSHVDKVIMK → SWQLSSLLPVSMNLTTPVPHINEIIHYLSFCYLFHLA
     145-351: Missing.

Note: No experimental confirmation available.

Show »
Length:144
Mass (Da):15,997
Checksum:i4A235A2C5B2D1F15
GO

Sequence cautioni

The sequence AAD34055.1 differs from that shown. Reason: Frameshift at positions 163 and 167.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti33 – 331F → S.2 Publications
Corresponds to variant rs2288709 [ dbSNP | Ensembl ].
VAR_038874
Natural varianti58 – 581P → S.1 Publication
Corresponds to variant rs17854966 [ dbSNP | Ensembl ].
VAR_038875
Natural varianti230 – 2301I → L.2 Publications
Corresponds to variant rs11556157 [ dbSNP | Ensembl ].
VAR_038876

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei108 – 14437TFSLV…KVIMK → SWQLSSLLPVSMNLTTPVPH INEIIHYLSFCYLFHLA in isoform 5.
VSP_031287Add
BLAST
Alternative sequencei145 – 351207Missing in isoform 5.
VSP_031288Add
BLAST
Alternative sequencei169 – 1691P → PQ in isoform 2.
VSP_031289
Alternative sequencei170 – 20132DHELI…EKRKV → VSCCLGLLLESLVPFIVNDN ITNNFFRFLCMT in isoform 4.
VSP_031290Add
BLAST
Alternative sequencei202 – 351150Missing in isoform 4.
VSP_031291Add
BLAST
Alternative sequencei332 – 35120ELEQY…IELDS → VLS in isoform 3.
VSP_031292Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti29 – 291I → F in CAB43233. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY083346 mRNA. Translation: AAL99216.1.
AF151818 mRNA. Translation: AAD34055.1. Frameshift.
AK223432 mRNA. Translation: BAD97152.1.
AC011242 Genomic DNA. Translation: AAY14702.1.
CH471053 Genomic DNA. Translation: EAX00289.1.
CH471053 Genomic DNA. Translation: EAX00290.1.
CH471053 Genomic DNA. Translation: EAX00291.1.
BC006969 mRNA. Translation: AAH06969.1.
BC016324 mRNA. Translation: AAH16324.1.
BC040558 mRNA. Translation: AAH40558.1.
BC058823 mRNA. Translation: AAH58823.1.
AL050006 mRNA. Translation: CAB43233.1.
CCDSiCCDS1813.1. [Q8TCX1-1]
CCDS46270.1. [Q8TCX1-4]
CCDS62903.1. [Q8TCX1-2]
PIRiT08695.
RefSeqiNP_001180393.1. NM_001193464.1. [Q8TCX1-2]
NP_056337.1. NM_015522.3. [Q8TCX1-4]
NP_057092.2. NM_016008.3. [Q8TCX1-1]
UniGeneiHs.371597.

Genome annotation databases

EnsembliENST00000260605; ENSP00000260605; ENSG00000138036. [Q8TCX1-1]
ENST00000398823; ENSP00000381804; ENSG00000138036. [Q8TCX1-5]
ENST00000406852; ENSP00000385738; ENSG00000138036. [Q8TCX1-4]
ENST00000605786; ENSP00000474032; ENSG00000138036. [Q8TCX1-2]
GeneIDi51626.
KEGGihsa:51626.
UCSCiuc002rth.3. human. [Q8TCX1-4]
uc002rti.3. human. [Q8TCX1-5]
uc002rtk.3. human. [Q8TCX1-1]
uc002rtl.3. human. [Q8TCX1-2]

Polymorphism databases

DMDMi74715850.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY083346 mRNA. Translation: AAL99216.1 .
AF151818 mRNA. Translation: AAD34055.1 . Frameshift.
AK223432 mRNA. Translation: BAD97152.1 .
AC011242 Genomic DNA. Translation: AAY14702.1 .
CH471053 Genomic DNA. Translation: EAX00289.1 .
CH471053 Genomic DNA. Translation: EAX00290.1 .
CH471053 Genomic DNA. Translation: EAX00291.1 .
BC006969 mRNA. Translation: AAH06969.1 .
BC016324 mRNA. Translation: AAH16324.1 .
BC040558 mRNA. Translation: AAH40558.1 .
BC058823 mRNA. Translation: AAH58823.1 .
AL050006 mRNA. Translation: CAB43233.1 .
CCDSi CCDS1813.1. [Q8TCX1-1 ]
CCDS46270.1. [Q8TCX1-4 ]
CCDS62903.1. [Q8TCX1-2 ]
PIRi T08695.
RefSeqi NP_001180393.1. NM_001193464.1. [Q8TCX1-2 ]
NP_056337.1. NM_015522.3. [Q8TCX1-4 ]
NP_057092.2. NM_016008.3. [Q8TCX1-1 ]
UniGenei Hs.371597.

3D structure databases

ProteinModelPortali Q8TCX1.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119644. 2 interactions.
IntActi Q8TCX1. 3 interactions.
MINTi MINT-6784031.

PTM databases

PhosphoSitei Q8TCX1.

Polymorphism databases

DMDMi 74715850.

Proteomic databases

MaxQBi Q8TCX1.
PaxDbi Q8TCX1.
PRIDEi Q8TCX1.

Protocols and materials databases

DNASUi 51626.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000260605 ; ENSP00000260605 ; ENSG00000138036 . [Q8TCX1-1 ]
ENST00000398823 ; ENSP00000381804 ; ENSG00000138036 . [Q8TCX1-5 ]
ENST00000406852 ; ENSP00000385738 ; ENSG00000138036 . [Q8TCX1-4 ]
ENST00000605786 ; ENSP00000474032 ; ENSG00000138036 . [Q8TCX1-2 ]
GeneIDi 51626.
KEGGi hsa:51626.
UCSCi uc002rth.3. human. [Q8TCX1-4 ]
uc002rti.3. human. [Q8TCX1-5 ]
uc002rtk.3. human. [Q8TCX1-1 ]
uc002rtl.3. human. [Q8TCX1-2 ]

Organism-specific databases

CTDi 51626.
GeneCardsi GC02P043913.
HGNCi HGNC:24595. DYNC2LI1.
neXtProti NX_Q8TCX1.
PharmGKBi PA142671919.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG256387.
HOVERGENi HBG066237.
InParanoidi Q8TCX1.
KOi K10417.
OMAi KLEPREN.
OrthoDBi EOG70CR6X.
PhylomeDBi Q8TCX1.
TreeFami TF314138.

Enzyme and pathway databases

Reactomei REACT_121399. MHC class II antigen presentation.

Miscellaneous databases

ChiTaRSi DYNC2LI1. human.
GenomeRNAii 51626.
NextBioi 55545.
PROi Q8TCX1.

Gene expression databases

ArrayExpressi Q8TCX1.
Bgeei Q8TCX1.
CleanExi HS_DYNC2LI1.
Genevestigatori Q8TCX1.

Family and domain databases

Gene3Di 3.40.50.300. 2 hits.
InterProi IPR022780. Dynein_light_int_chain.
IPR027417. P-loop_NTPase.
[Graphical view ]
Pfami PF05783. DLIC. 1 hit.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 2 hits.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a novel light intermediate chain (D2LIC) for mammalian cytoplasmic dynein 2."
    Grissom P.M., Vaisberg E.A., McIntosh J.R.
    Mol. Biol. Cell 13:817-829(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics."
    Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.
    Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS SER-33 AND LEU-230.
    Tissue: Testis.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 4 AND 5), VARIANT SER-58.
    Tissue: Brain, Kidney, Testis and Urinary bladder.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 18-351 (ISOFORM 3), VARIANTS SER-33 AND LEU-230.
    Tissue: Brain.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiDC2L1_HUMAN
AccessioniPrimary (citable) accession number: Q8TCX1
Secondary accession number(s): A8MVJ5
, Q53F57, Q6PDB2, Q8IWA3, Q96B03, Q96J00, Q9Y370, Q9Y3S9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: June 1, 2002
Last modified: September 3, 2014
This is version 78 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi