Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytoplasmic dynein 2 light intermediate chain 1

Gene

DYNC2LI1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May function as a motor for intraflagellar retrograde transport. Functions in cilia biogenesis (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Motor protein

Keywords - Biological processi

Cilium biogenesis/degradation

Enzyme and pathway databases

BioCyciZFISH:ENSG00000138036-MONOMER.
ReactomeiR-HSA-2132295. MHC class II antigen presentation.
R-HSA-5620924. Intraflagellar transport.
R-HSA-6807878. COPI-mediated anterograde transport.
R-HSA-6811436. COPI-independent Golgi-to-ER retrograde traffic.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytoplasmic dynein 2 light intermediate chain 1
Short name:
Dynein 2 light intermediate chain
Gene namesi
Name:DYNC2LI1
Synonyms:D2LIC, LIC3
ORF Names:CGI-60
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:24595. DYNC2LI1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Dynein, Microtubule

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000138036.
PharmGKBiPA142671919.

Polymorphism and mutation databases

BioMutaiDYNC2LI1.
DMDMi74715850.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003187501 – 351Cytoplasmic dynein 2 light intermediate chain 1Add BLAST351

Proteomic databases

EPDiQ8TCX1.
MaxQBiQ8TCX1.
PaxDbiQ8TCX1.
PeptideAtlasiQ8TCX1.
PRIDEiQ8TCX1.

PTM databases

iPTMnetiQ8TCX1.
PhosphoSitePlusiQ8TCX1.

Expressioni

Gene expression databases

BgeeiENSG00000138036.
CleanExiHS_DYNC2LI1.
ExpressionAtlasiQ8TCX1. baseline and differential.
GenevisibleiQ8TCX1. HS.

Organism-specific databases

HPAiHPA062905.

Interactioni

Subunit structurei

The cytoplasmic dynein complex 2 is probably composed by a DYNC2H1 homodimer and a number of DYNC2LI1 light intermediate chains.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
SOD1P004413EBI-8568003,EBI-990792

GO - Molecular functioni

Protein-protein interaction databases

BioGridi119644. 21 interactors.
IntActiQ8TCX1. 12 interactors.
MINTiMINT-6784031.
STRINGi9606.ENSP00000260605.

Structurei

3D structure databases

ProteinModelPortaliQ8TCX1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3929. Eukaryota.
ENOG410XTE5. LUCA.
GeneTreeiENSGT00390000010498.
HOVERGENiHBG066237.
InParanoidiQ8TCX1.
KOiK10417.
OMAiPAKDPQY.
OrthoDBiEOG091G0MQ3.
PhylomeDBiQ8TCX1.
TreeFamiTF314138.

Family and domain databases

Gene3Di3.40.50.300. 2 hits.
InterProiIPR022780. Dynein_light_int_chain.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF05783. DLIC. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 2 hits.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TCX1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPSETLWEIA KAEVEKRGIN GSEGDGAEIA EKFVFFIGSK NGGKTTIILR
60 70 80 90 100
CLDRDEPPKP TLALEYTYGR RAKGHNTPKD IAHFWELGGG TSLLDLISIP
110 120 130 140 150
ITGDTLRTFS LVLVLDLSKP NDLWPTMENL LQATKSHVDK VIMKLGKTNA
160 170 180 190 200
KAVSEMRQKI WNNMPKDHPD HELIDPFPVP LVIIGSKYDV FQDFESEKRK
210 220 230 240 250
VICKTLRFVA HYYGASLMFT SKSEALLLKI RGVINQLAFG IDKSKSICVD
260 270 280 290 300
QNKPLFITAG LDSFGQIGSP PVPENDIGKL HAHSPMELWK KVYEKLFPPK
310 320 330 340 350
SINTLKDIKD PARDPQYAEN EVDEMRIQKD LELEQYKRSS SKSWKQIELD

S
Length:351
Mass (Da):39,625
Last modified:June 1, 2002 - v1
Checksum:iBB4BB8B528D4A99A
GO
Isoform 2 (identifier: Q8TCX1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     169-169: P → PQ

Show »
Length:352
Mass (Da):39,753
Checksum:i156B9FAB4FDABAC1
GO
Isoform 3 (identifier: Q8TCX1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     332-351: ELEQYKRSSSKSWKQIELDS → VLS

Show »
Length:334
Mass (Da):37,500
Checksum:iC4D1D8FF4A49656F
GO
Isoform 4 (identifier: Q8TCX1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     170-201: DHELIDPFPVPLVIIGSKYDVFQDFESEKRKV → VSCCLGLLLESLVPFIVNDNITNNFFRFLCMT
     202-351: Missing.

Show »
Length:201
Mass (Da):22,433
Checksum:i88D40AFF3FB35E50
GO
Isoform 5 (identifier: Q8TCX1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     108-144: TFSLVLVLDLSKPNDLWPTMENLLQATKSHVDKVIMK → SWQLSSLLPVSMNLTTPVPHINEIIHYLSFCYLFHLA
     145-351: Missing.

Note: No experimental confirmation available.
Show »
Length:144
Mass (Da):15,997
Checksum:i4A235A2C5B2D1F15
GO

Sequence cautioni

The sequence AAD34055 differs from that shown. Reason: Frameshift at positions 163 and 167.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti29I → F in CAB43233 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03887433F → S.2 PublicationsCorresponds to variant rs2288709dbSNPEnsembl.1
Natural variantiVAR_03887558P → S.1 PublicationCorresponds to variant rs17854966dbSNPEnsembl.1
Natural variantiVAR_038876230I → L.2 PublicationsCorresponds to variant rs11556157dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_031287108 – 144TFSLV…KVIMK → SWQLSSLLPVSMNLTTPVPH INEIIHYLSFCYLFHLA in isoform 5. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_031288145 – 351Missing in isoform 5. 1 PublicationAdd BLAST207
Alternative sequenceiVSP_031289169P → PQ in isoform 2. 1 Publication1
Alternative sequenceiVSP_031290170 – 201DHELI…EKRKV → VSCCLGLLLESLVPFIVNDN ITNNFFRFLCMT in isoform 4. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_031291202 – 351Missing in isoform 4. 1 PublicationAdd BLAST150
Alternative sequenceiVSP_031292332 – 351ELEQY…IELDS → VLS in isoform 3. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY083346 mRNA. Translation: AAL99216.1.
AF151818 mRNA. Translation: AAD34055.1. Frameshift.
AK223432 mRNA. Translation: BAD97152.1.
AC011242 Genomic DNA. Translation: AAY14702.1.
CH471053 Genomic DNA. Translation: EAX00289.1.
CH471053 Genomic DNA. Translation: EAX00290.1.
CH471053 Genomic DNA. Translation: EAX00291.1.
BC006969 mRNA. Translation: AAH06969.1.
BC016324 mRNA. Translation: AAH16324.1.
BC040558 mRNA. Translation: AAH40558.1.
BC058823 mRNA. Translation: AAH58823.1.
AL050006 mRNA. Translation: CAB43233.1.
CCDSiCCDS1813.1. [Q8TCX1-1]
CCDS46270.1. [Q8TCX1-4]
CCDS62903.1. [Q8TCX1-2]
PIRiT08695.
RefSeqiNP_001180393.1. NM_001193464.1. [Q8TCX1-2]
NP_056337.1. NM_015522.3. [Q8TCX1-4]
NP_057092.2. NM_016008.3. [Q8TCX1-1]
UniGeneiHs.371597.

Genome annotation databases

EnsembliENST00000260605; ENSP00000260605; ENSG00000138036. [Q8TCX1-1]
ENST00000398823; ENSP00000381804; ENSG00000138036. [Q8TCX1-5]
ENST00000406852; ENSP00000385738; ENSG00000138036. [Q8TCX1-4]
ENST00000605786; ENSP00000474032; ENSG00000138036. [Q8TCX1-2]
GeneIDi51626.
KEGGihsa:51626.
UCSCiuc002rth.4. human. [Q8TCX1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY083346 mRNA. Translation: AAL99216.1.
AF151818 mRNA. Translation: AAD34055.1. Frameshift.
AK223432 mRNA. Translation: BAD97152.1.
AC011242 Genomic DNA. Translation: AAY14702.1.
CH471053 Genomic DNA. Translation: EAX00289.1.
CH471053 Genomic DNA. Translation: EAX00290.1.
CH471053 Genomic DNA. Translation: EAX00291.1.
BC006969 mRNA. Translation: AAH06969.1.
BC016324 mRNA. Translation: AAH16324.1.
BC040558 mRNA. Translation: AAH40558.1.
BC058823 mRNA. Translation: AAH58823.1.
AL050006 mRNA. Translation: CAB43233.1.
CCDSiCCDS1813.1. [Q8TCX1-1]
CCDS46270.1. [Q8TCX1-4]
CCDS62903.1. [Q8TCX1-2]
PIRiT08695.
RefSeqiNP_001180393.1. NM_001193464.1. [Q8TCX1-2]
NP_056337.1. NM_015522.3. [Q8TCX1-4]
NP_057092.2. NM_016008.3. [Q8TCX1-1]
UniGeneiHs.371597.

3D structure databases

ProteinModelPortaliQ8TCX1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119644. 21 interactors.
IntActiQ8TCX1. 12 interactors.
MINTiMINT-6784031.
STRINGi9606.ENSP00000260605.

PTM databases

iPTMnetiQ8TCX1.
PhosphoSitePlusiQ8TCX1.

Polymorphism and mutation databases

BioMutaiDYNC2LI1.
DMDMi74715850.

Proteomic databases

EPDiQ8TCX1.
MaxQBiQ8TCX1.
PaxDbiQ8TCX1.
PeptideAtlasiQ8TCX1.
PRIDEiQ8TCX1.

Protocols and materials databases

DNASUi51626.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000260605; ENSP00000260605; ENSG00000138036. [Q8TCX1-1]
ENST00000398823; ENSP00000381804; ENSG00000138036. [Q8TCX1-5]
ENST00000406852; ENSP00000385738; ENSG00000138036. [Q8TCX1-4]
ENST00000605786; ENSP00000474032; ENSG00000138036. [Q8TCX1-2]
GeneIDi51626.
KEGGihsa:51626.
UCSCiuc002rth.4. human. [Q8TCX1-1]

Organism-specific databases

CTDi51626.
GeneCardsiDYNC2LI1.
HGNCiHGNC:24595. DYNC2LI1.
HPAiHPA062905.
neXtProtiNX_Q8TCX1.
OpenTargetsiENSG00000138036.
PharmGKBiPA142671919.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3929. Eukaryota.
ENOG410XTE5. LUCA.
GeneTreeiENSGT00390000010498.
HOVERGENiHBG066237.
InParanoidiQ8TCX1.
KOiK10417.
OMAiPAKDPQY.
OrthoDBiEOG091G0MQ3.
PhylomeDBiQ8TCX1.
TreeFamiTF314138.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000138036-MONOMER.
ReactomeiR-HSA-2132295. MHC class II antigen presentation.
R-HSA-5620924. Intraflagellar transport.
R-HSA-6807878. COPI-mediated anterograde transport.
R-HSA-6811436. COPI-independent Golgi-to-ER retrograde traffic.

Miscellaneous databases

ChiTaRSiDYNC2LI1. human.
GenomeRNAii51626.
PROiQ8TCX1.

Gene expression databases

BgeeiENSG00000138036.
CleanExiHS_DYNC2LI1.
ExpressionAtlasiQ8TCX1. baseline and differential.
GenevisibleiQ8TCX1. HS.

Family and domain databases

Gene3Di3.40.50.300. 2 hits.
InterProiIPR022780. Dynein_light_int_chain.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF05783. DLIC. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 2 hits.
ProtoNetiSearch...

Entry informationi

Entry nameiDC2L1_HUMAN
AccessioniPrimary (citable) accession number: Q8TCX1
Secondary accession number(s): A8MVJ5
, Q53F57, Q6PDB2, Q8IWA3, Q96B03, Q96J00, Q9Y370, Q9Y3S9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: June 1, 2002
Last modified: November 30, 2016
This is version 100 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.