Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8TCX1 (DC2L1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 77. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cytoplasmic dynein 2 light intermediate chain 1

Short name=Dynein 2 light intermediate chain
Gene names
Name:DYNC2LI1
Synonyms:D2LIC, LIC3
ORF Names:CGI-60
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length351 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May function as a motor for intraflagellar retrograde transport. Functions in cilia biogenesis By similarity.

Subunit structure

The cytoplasmic dynein complex 2 is probably composed by a DYNC2H1 homodimer and a number of DYNC2LI1 light intermediate chains By similarity.

Subcellular location

Cytoplasmcytoskeletoncilium axoneme By similarity. Cytoplasm By similarity. Note: Localizes to the apical cytoplasm By similarity.

Sequence similarities

Belongs to the dynein light intermediate chain family.

Sequence caution

The sequence AAD34055.1 differs from that shown. Reason: Frameshift at positions 163 and 167.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

SOD1P004413EBI-8568003,EBI-990792

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8TCX1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8TCX1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     169-169: P → PQ
Isoform 3 (identifier: Q8TCX1-3)

The sequence of this isoform differs from the canonical sequence as follows:
     332-351: ELEQYKRSSSKSWKQIELDS → VLS
Isoform 4 (identifier: Q8TCX1-4)

The sequence of this isoform differs from the canonical sequence as follows:
     170-201: DHELIDPFPVPLVIIGSKYDVFQDFESEKRKV → VSCCLGLLLESLVPFIVNDNITNNFFRFLCMT
     202-351: Missing.
Isoform 5 (identifier: Q8TCX1-5)

The sequence of this isoform differs from the canonical sequence as follows:
     108-144: TFSLVLVLDLSKPNDLWPTMENLLQATKSHVDKVIMK → SWQLSSLLPVSMNLTTPVPHINEIIHYLSFCYLFHLA
     145-351: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 351351Cytoplasmic dynein 2 light intermediate chain 1
PRO_0000318750

Natural variations

Alternative sequence108 – 14437TFSLV…KVIMK → SWQLSSLLPVSMNLTTPVPH INEIIHYLSFCYLFHLA in isoform 5.
VSP_031287
Alternative sequence145 – 351207Missing in isoform 5.
VSP_031288
Alternative sequence1691P → PQ in isoform 2.
VSP_031289
Alternative sequence170 – 20132DHELI…EKRKV → VSCCLGLLLESLVPFIVNDN ITNNFFRFLCMT in isoform 4.
VSP_031290
Alternative sequence202 – 351150Missing in isoform 4.
VSP_031291
Alternative sequence332 – 35120ELEQY…IELDS → VLS in isoform 3.
VSP_031292
Natural variant331F → S. Ref.3 Ref.7
Corresponds to variant rs2288709 [ dbSNP | Ensembl ].
VAR_038874
Natural variant581P → S. Ref.6
Corresponds to variant rs17854966 [ dbSNP | Ensembl ].
VAR_038875
Natural variant2301I → L. Ref.3 Ref.7
Corresponds to variant rs11556157 [ dbSNP | Ensembl ].
VAR_038876

Experimental info

Sequence conflict291I → F in CAB43233. Ref.7

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2002. Version 1.
Checksum: BB4BB8B528D4A99A

FASTA35139,625
        10         20         30         40         50         60 
MPSETLWEIA KAEVEKRGIN GSEGDGAEIA EKFVFFIGSK NGGKTTIILR CLDRDEPPKP 

        70         80         90        100        110        120 
TLALEYTYGR RAKGHNTPKD IAHFWELGGG TSLLDLISIP ITGDTLRTFS LVLVLDLSKP 

       130        140        150        160        170        180 
NDLWPTMENL LQATKSHVDK VIMKLGKTNA KAVSEMRQKI WNNMPKDHPD HELIDPFPVP 

       190        200        210        220        230        240 
LVIIGSKYDV FQDFESEKRK VICKTLRFVA HYYGASLMFT SKSEALLLKI RGVINQLAFG 

       250        260        270        280        290        300 
IDKSKSICVD QNKPLFITAG LDSFGQIGSP PVPENDIGKL HAHSPMELWK KVYEKLFPPK 

       310        320        330        340        350 
SINTLKDIKD PARDPQYAEN EVDEMRIQKD LELEQYKRSS SKSWKQIELD S 

« Hide

Isoform 2 [UniParc].

Checksum: 156B9FAB4FDABAC1
Show »

FASTA35239,753
Isoform 3 [UniParc].

Checksum: C4D1D8FF4A49656F
Show »

FASTA33437,500
Isoform 4 [UniParc].

Checksum: 88D40AFF3FB35E50
Show »

FASTA20122,433
Isoform 5 [UniParc].

Checksum: 4A235A2C5B2D1F15
Show »

FASTA14415,997

References

« Hide 'large scale' references
[1]"Identification of a novel light intermediate chain (D2LIC) for mammalian cytoplasmic dynein 2."
Grissom P.M., Vaisberg E.A., McIntosh J.R.
Mol. Biol. Cell 13:817-829(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics."
Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.
Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[3]Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS SER-33 AND LEU-230.
Tissue: Testis.
[4]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 4 AND 5), VARIANT SER-58.
Tissue: Brain, Kidney, Testis and Urinary bladder.
[7]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 18-351 (ISOFORM 3), VARIANTS SER-33 AND LEU-230.
Tissue: Brain.
[8]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY083346 mRNA. Translation: AAL99216.1.
AF151818 mRNA. Translation: AAD34055.1. Frameshift.
AK223432 mRNA. Translation: BAD97152.1.
AC011242 Genomic DNA. Translation: AAY14702.1.
CH471053 Genomic DNA. Translation: EAX00289.1.
CH471053 Genomic DNA. Translation: EAX00290.1.
CH471053 Genomic DNA. Translation: EAX00291.1.
BC006969 mRNA. Translation: AAH06969.1.
BC016324 mRNA. Translation: AAH16324.1.
BC040558 mRNA. Translation: AAH40558.1.
BC058823 mRNA. Translation: AAH58823.1.
AL050006 mRNA. Translation: CAB43233.1.
CCDSCCDS1813.1. [Q8TCX1-1]
CCDS46270.1. [Q8TCX1-4]
CCDS62903.1. [Q8TCX1-2]
PIRT08695.
RefSeqNP_001180393.1. NM_001193464.1. [Q8TCX1-2]
NP_056337.1. NM_015522.3. [Q8TCX1-4]
NP_057092.2. NM_016008.3. [Q8TCX1-1]
UniGeneHs.371597.

3D structure databases

ProteinModelPortalQ8TCX1.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119644. 2 interactions.
IntActQ8TCX1. 3 interactions.
MINTMINT-6784031.

PTM databases

PhosphoSiteQ8TCX1.

Polymorphism databases

DMDM74715850.

Proteomic databases

MaxQBQ8TCX1.
PaxDbQ8TCX1.
PRIDEQ8TCX1.

Protocols and materials databases

DNASU51626.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000260605; ENSP00000260605; ENSG00000138036. [Q8TCX1-1]
ENST00000398823; ENSP00000381804; ENSG00000138036. [Q8TCX1-5]
ENST00000406852; ENSP00000385738; ENSG00000138036. [Q8TCX1-4]
ENST00000605786; ENSP00000474032; ENSG00000138036. [Q8TCX1-2]
GeneID51626.
KEGGhsa:51626.
UCSCuc002rth.3. human. [Q8TCX1-4]
uc002rti.3. human. [Q8TCX1-5]
uc002rtk.3. human. [Q8TCX1-1]
uc002rtl.3. human. [Q8TCX1-2]

Organism-specific databases

CTD51626.
GeneCardsGC02P043913.
HGNCHGNC:24595. DYNC2LI1.
neXtProtNX_Q8TCX1.
PharmGKBPA142671919.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG256387.
HOVERGENHBG066237.
InParanoidQ8TCX1.
KOK10417.
OMAKLEPREN.
OrthoDBEOG70CR6X.
PhylomeDBQ8TCX1.
TreeFamTF314138.

Enzyme and pathway databases

ReactomeREACT_6900. Immune System.

Gene expression databases

ArrayExpressQ8TCX1.
BgeeQ8TCX1.
CleanExHS_DYNC2LI1.
GenevestigatorQ8TCX1.

Family and domain databases

Gene3D3.40.50.300. 2 hits.
InterProIPR022780. Dynein_light_int_chain.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamPF05783. DLIC. 1 hit.
[Graphical view]
SUPFAMSSF52540. SSF52540. 2 hits.
ProtoNetSearch...

Other

ChiTaRSDYNC2LI1. human.
GenomeRNAi51626.
NextBio55545.
PROQ8TCX1.

Entry information

Entry nameDC2L1_HUMAN
AccessionPrimary (citable) accession number: Q8TCX1
Secondary accession number(s): A8MVJ5 expand/collapse secondary AC list , Q53F57, Q6PDB2, Q8IWA3, Q96B03, Q96J00, Q9Y370, Q9Y3S9
Entry history
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: June 1, 2002
Last modified: July 9, 2014
This is version 77 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM