Q8TCX1 (DC2L1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 66.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cytoplasmic dynein 2 light intermediate chain 1 Short name=Dynein 2 light intermediate chain | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 351 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May function as a motor for intraflagellar retrograde transport. Functions in cilia biogenesis By similarity. |
| Subunit structure | The cytoplasmic dynein complex 2 is probably composed by a DYNC2H1 homodimer and a number of DYNC2LI1 light intermediate chains By similarity. |
| Subcellular location | Cytoplasm › cytoskeleton › cilium axoneme By similarity. Cytoplasm By similarity. Note: Localizes to the apical cytoplasm By similarity. |
| Sequence similarities | Belongs to the dynein light intermediate chain family. |
| Sequence caution | The sequence AAD34055.1 differs from that shown. Reason: Frameshift at positions 163 and 167. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8TCX1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8TCX1-2) The sequence of this isoform differs from the canonical sequence as follows: 169-169: P → PQ | ||||||
| Isoform 3 (identifier: Q8TCX1-3) The sequence of this isoform differs from the canonical sequence as follows: 332-351: ELEQYKRSSSKSWKQIELDS → VLS | ||||||
| Isoform 4 (identifier: Q8TCX1-4) The sequence of this isoform differs from the canonical sequence as follows: 170-201: DHELIDPFPVPLVIIGSKYDVFQDFESEKRKV → VSCCLGLLLESLVPFIVNDNITNNFFRFLCMT 202-351: Missing. | ||||||
| Isoform 5 (identifier: Q8TCX1-5) The sequence of this isoform differs from the canonical sequence as follows: 108-144: TFSLVLVLDLSKPNDLWPTMENLLQATKSHVDKVIMK → SWQLSSLLPVSMNLTTPVPHINEIIHYLSFCYLFHLA 145-351: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 351 | 351 | Cytoplasmic dynein 2 light intermediate chain 1 | PRO_0000318750 | |||||
Natural variations | |||||||||
| Alternative sequence | 108 – 144 | 37 | TFSLV…KVIMK → SWQLSSLLPVSMNLTTPVPH INEIIHYLSFCYLFHLA in isoform 5. | VSP_031287 | |||||
| Alternative sequence | 145 – 351 | 207 | Missing in isoform 5. | VSP_031288 | |||||
| Alternative sequence | 169 | 1 | P → PQ in isoform 2. | VSP_031289 | |||||
| Alternative sequence | 170 – 201 | 32 | DHELI…EKRKV → VSCCLGLLLESLVPFIVNDN ITNNFFRFLCMT in isoform 4. | VSP_031290 | |||||
| Alternative sequence | 202 – 351 | 150 | Missing in isoform 4. | VSP_031291 | |||||
| Alternative sequence | 332 – 351 | 20 | ELEQY…IELDS → VLS in isoform 3. | VSP_031292 | |||||
| Natural variant | 33 | 1 | F → S. Ref.3 Ref.7 Corresponds to variant rs2288709 [ dbSNP | Ensembl ]. | VAR_038874 | |||||
| Natural variant | 58 | 1 | P → S. Ref.6 Corresponds to variant rs17854966 [ dbSNP | Ensembl ]. | VAR_038875 | |||||
| Natural variant | 230 | 1 | I → L. Ref.3 Ref.7 Corresponds to variant rs11556157 [ dbSNP | Ensembl ]. | VAR_038876 | |||||
Experimental info | |||||||||
| Sequence conflict | 29 | 1 | I → F in CAB43233. Ref.7 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a novel light intermediate chain (D2LIC) for mammalian cytoplasmic dynein 2." Grissom P.M., Vaisberg E.A., McIntosh J.R. Mol. Biol. Cell 13:817-829(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics." Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C. Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS SER-33 AND LEU-230. Tissue: Testis. |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 4 AND 5), VARIANT SER-58. Tissue: Brain, Kidney, Testis and Urinary bladder. |
| [7] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 18-351 (ISOFORM 3), VARIANTS SER-33 AND LEU-230. Tissue: Brain. |
| [8] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY083346 mRNA. Translation: AAL99216.1. AF151818 mRNA. Translation: AAD34055.1. Frameshift. AK223432 mRNA. Translation: BAD97152.1. AC011242 Genomic DNA. Translation: AAY14702.1. CH471053 Genomic DNA. Translation: EAX00289.1. CH471053 Genomic DNA. Translation: EAX00290.1. CH471053 Genomic DNA. Translation: EAX00291.1. BC006969 mRNA. Translation: AAH06969.1. BC016324 mRNA. Translation: AAH16324.1. BC040558 mRNA. Translation: AAH40558.1. BC058823 mRNA. Translation: AAH58823.1. AL050006 mRNA. Translation: CAB43233.1. |
| IPI | IPI00059632. IPI00217241. IPI00465426. IPI00554555. IPI00885209. |
| PIR | T08695. |
| RefSeq | NP_001180393.1. NM_001193464.1. NP_056337.1. NM_015522.3. NP_057092.2. NM_016008.3. |
| UniGene | Hs.371597. |
3D structure databases | |
| ProteinModelPortal | Q8TCX1. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q8TCX1. |
Polymorphism databases | |
| DMDM | 74715850. |
Proteomic databases | |
| PaxDb | Q8TCX1. |
| PRIDE | Q8TCX1. |
Protocols and materials databases | |
| DNASU | 51626. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000260605; ENSP00000260605; ENSG00000138036. ENST00000398823; ENSP00000381804; ENSG00000138036. ENST00000406852; ENSP00000385738; ENSG00000138036. |
| GeneID | 51626. |
| KEGG | hsa:51626. |
| UCSC | uc002rth.3. human. uc002rti.3. human. uc002rtk.3. human. uc002rtl.3. human. uc021vgq.1. human. |
Organism-specific databases | |
| CTD | 51626. |
| GeneCards | GC02P043913. |
| HGNC | HGNC:24595. DYNC2LI1. |
| neXtProt | NX_Q8TCX1. |
| PharmGKB | PA142671919. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG256387. |
| HOVERGEN | HBG066237. |
| InParanoid | Q8TCX1. |
| KO | K10417. |
| OMA | VICKTLR. |
| OrthoDB | EOG4W0XDP. |
| PhylomeDB | Q8TCX1. |
Enzyme and pathway databases | |
| Reactome | REACT_6900. Immune System. |
Gene expression databases | |
| ArrayExpress | Q8TCX1. |
| Bgee | Q8TCX1. |
| CleanEx | HS_DYNC2LI1. |
| Genevestigator | Q8TCX1. |
Family and domain databases | |
| InterPro | IPR022780. Dynein_light_int_chain. [Graphical view] |
| Pfam | PF05783. DLIC. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | DYNC2LI1. human. |
| GenomeRNAi | 51626. |
| NextBio | 55545. |
Entry information
| Entry name | DC2L1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8TCX1 Secondary accession number(s): A8MVJ5 Q9Y3S9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
