Q8TCT9 (HM13_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 113.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Minor histocompatibility antigen H13 EC=3.4.23.- Alternative name(s): Intramembrane protease 1 Short name=IMP-1 Short name=IMPAS-1 Short name=hIMP1 Presenilin-like protein 3 Signal peptide peptidase | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 377 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein, resulting in the release of the fragment from the ER membrane into the cytoplasm. Required to generate lymphocyte cell surface (HLA-E) epitopes derived from MHC class I signal peptides. May play a role in graft rejection By similarity. May be necessary for the removal of the signal peptide that remains attached to the hepatitis C virus core protein after the initial proteolytic processing of the polyprotein. Involved in the intramembrane cleavage of the integral membrane protein PSEN1. Ref.1 Ref.12 Ref.13 Ref.14 |
| Subunit structure | Interacts with RNF139. Ref.16 |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein By similarity. Isoform 4: Cell membrane; Multi-pass membrane protein By similarity. |
| Tissue specificity | Widely expressed with highest levels in kidney, liver, placenta, lung, leukocytes and small intestine and reduced expression in heart and skeletal muscle. Expressed abundantly in the CNS with highest levels in thalamus and medulla. Ref.2 Ref.3 |
| Domain | The first transmembrane domain may act as a type I signal anchor By similarity. The PAL motif is required for normal active site conformation By similarity. |
| Post-translational modification | N-glycosylated. Ref.1 |
| Sequence similarities | Belongs to the peptidase A22B family. |
| Sequence caution | The sequence AAQ13609.1 differs from that shown. Reason: Frameshift at positions 320, 329, 330 and 358. The sequence BAC11138.1 differs from that shown. Reason: Intron retention. The sequence CAI19152.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI20173.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8TCT9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8TCT9-2) The sequence of this isoform differs from the canonical sequence as follows: 347-347: E → ESSAEILPHTPRLTHFPTVSGSPASLADSMQQKLAGPRRRRPQNPSAIYE | ||||||
| Isoform 4 (identifier: Q8TCT9-4) The sequence of this isoform differs from the canonical sequence as follows: 348-377: ESNPKDPAAVTESKEGTEASASKGLEKKEK → SSAEILPHTP...RRRPQNPSAM | ||||||
| Isoform 5 (identifier: Q8TCT9-5) The sequence of this isoform differs from the canonical sequence as follows: 181-222: Missing. | ||||||
| Note: No experimental confirmation available. Gene prediction based on EST data. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 377 | 377 | Minor histocompatibility antigen H13 | PRO_0000073907 | |||||
Regions | |||||||||
| Topological domain | 1 – 31 | 31 | Lumenal Potential | ||||||
| Transmembrane | 32 – 52 | 21 | Helical; Potential | ||||||
| Topological domain | 53 – 77 | 25 | Cytoplasmic Potential | ||||||
| Transmembrane | 78 – 98 | 21 | Helical; Potential | ||||||
| Topological domain | 99 – 100 | 2 | Lumenal Potential | ||||||
| Transmembrane | 101 – 121 | 21 | Helical; Potential | ||||||
| Topological domain | 122 – 157 | 36 | Cytoplasmic Potential | ||||||
| Transmembrane | 158 – 178 | 21 | Helical; Potential | ||||||
| Topological domain | 179 – 181 | 3 | Lumenal Potential | ||||||
| Transmembrane | 182 – 202 | 21 | Helical; Potential | ||||||
| Topological domain | 203 – 209 | 7 | Cytoplasmic Potential | ||||||
| Transmembrane | 210 – 230 | 21 | Helical; Potential | ||||||
| Topological domain | 231 – 256 | 26 | Lumenal Potential | ||||||
| Transmembrane | 257 – 277 | 21 | Helical; Potential | ||||||
| Topological domain | 278 – 290 | 13 | Cytoplasmic Potential | ||||||
| Transmembrane | 291 – 311 | 21 | Helical; Potential | ||||||
| Topological domain | 312 – 314 | 3 | Lumenal Potential | ||||||
| Transmembrane | 315 – 335 | 21 | Helical; Potential | ||||||
| Topological domain | 336 – 377 | 42 | Cytoplasmic Potential | ||||||
| Motif | 317 – 319 | 3 | PAL | ||||||
Sites | |||||||||
| Active site | 219 | 1 | By similarity | ||||||
| Active site | 265 | 1 | By similarity | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 10 | 1 | N-linked (GlcNAc...) Ref.17 | ||||||
| Glycosylation | 20 | 1 | N-linked (GlcNAc...) Ref.17 | ||||||
Natural variations | |||||||||
| Alternative sequence | 181 – 222 | 42 | Missing in isoform 5. | VSP_015082 | |||||
| Alternative sequence | 347 | 1 | E → ESSAEILPHTPRLTHFPTVS GSPASLADSMQQKLAGPRRR RPQNPSAIYE in isoform 2. | VSP_005196 | |||||
| Alternative sequence | 348 – 377 | 30 | ESNPK…EKKEK → SSAEILPHTPRLTHFPTVSG SPASLADSMQQKLAGPRRRR PQNPSAM in isoform 4. | VSP_015083 | |||||
| Natural variant | 259 | 1 | A → P. Corresponds to variant rs1044419 [ dbSNP | Ensembl ]. | VAR_014274 | |||||
Experimental info | |||||||||
| Mutagenesis | 10 | 1 | N → Q: Abolishes N-glycosylation; when associated with Q-20. Ref.1 | ||||||
| Mutagenesis | 20 | 1 | N → Q: Abolishes N-glycosylation; when associated with Q-10. Ref.1 | ||||||
| Mutagenesis | 219 | 1 | D → A: Abolishes proteolysis of PSEN1. Ref.14 | ||||||
| Mutagenesis | 264 | 1 | G → A: No effect on proteolysis of PSEN1. Ref.14 | ||||||
| Mutagenesis | 265 | 1 | D → A: No effect on inhibitor binding; abolishes catalytic activity. Abolishes proteolysis of PSEN1. Ref.1 Ref.14 | ||||||
| Mutagenesis | 317 | 1 | P → L: Abolishes proteolysis of PSEN1. Ref.14 | ||||||
| Sequence conflict | 132 | 1 | S → N AA sequence Ref.1 | ||||||
| Sequence conflict | 150 | 1 | K → R in BAC11519. Ref.8 | ||||||
| Sequence conflict | 159 | 1 | D → A AA sequence Ref.1 | ||||||
| Sequence conflict | 235 | 1 | S → F in AAH08938. Ref.11 | ||||||
| Sequence conflict | 235 | 1 | S → F in AAH08959. Ref.11 | ||||||
| Sequence conflict | 295 | 1 | F → Y in AAQ13609. Ref.7 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of signal peptide peptidase, a presenilin-type aspartic protease." Weihofen A., Binns K., Lemberg M.K., Ashman K., Martoglio B. Science 296:2215-2218(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 62-73; 128-136; 137-161; 242-251 AND 338-352, FUNCTION, GLYCOSYLATION, MUTAGENESIS OF ASN-10; ASN-20 AND ASP-265. Tissue: Cervix carcinoma. |
| [2] | "Expression of the presenilin-like signal peptide peptidase (SPP) in mouse adult brain and during development." Urny J., Hermans-Borgmeyer I., Gercken G., Chica Schaller H. Gene Expr. Patterns 3:685-691(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Placenta. |
| [3] | "Novel class of polytopic proteins with domains associated with putative protease activity." Grigorenko A.P., Moliaka Y.K., Korovaitseva G.I., Rogaev E.I. Biokhimiia 67:826-834(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 4), TISSUE SPECIFICITY. Tissue: Blood and Hippocampus. |
| [4] | "Cell-surface expression of a new splice variant of the mouse signal peptide peptidase." Urny J., Hermans-Borgmeyer I., Schaller H.C. Biochim. Biophys. Acta 1759:159-165(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). |
| [5] | "Characterization of a new protein family with homology to presenilins." Irmler M., Tomiuk S., Korner M.R., Hofmann K., Conradt M. Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [6] | "Genomic analysis of the H13 minor histocompatibility antigen gene." Brown A.C., Roopenian D.C. Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [7] | Liu Y.Q., Gong J., Yu L.T., Sheng H., Qin B.M., Zhao B., Liu B., Wang X.Y., Zhang Q., Song L., Gao Y., Zhang C.L., Ye J., Ji X.J., Liu B.H., Lu H., Xu H.S., Chen J.Z. Hui R.T.Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Aorta. |
| [8] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Mammary gland, Retinoblastoma and Testis. |
| [9] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [11] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain and Muscle. |
| [12] | "Intramembrane proteolysis of signal peptides: an essential step in the generation of HLA-E epitopes." Lemberg M.K., Bland F.A., Weihofen A., Braud V.M., Martoglio B. J. Immunol. 167:6441-6446(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [13] | "Intramembrane proteolysis promotes trafficking of hepatitis C virus core protein to lipid droplets." McLauchlan J., Lemberg M.K., Hope G., Martoglio B. EMBO J. 21:3980-3988(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [14] | "Impas 1 possesses endoproteolytic activity against multipass membrane protein substrate cleaving the presenilin 1 holoprotein." Moliaka Y.K., Grigorenko A., Madera D., Rogaev E.I. FEBS Lett. 557:185-192(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF ASP-219; GLY-264; ASP-265 AND PRO-317. |
| [15] | "Consensus analysis of signal peptide peptidase and homologous human aspartic proteases reveals opposite topology of catalytic domains compared with presenilins." Friedmann E., Lemberg M.K., Weihofen A., Dev K.K., Dengler U., Rovelli G., Martoglio B. J. Biol. Chem. 279:50790-50798(2004) [PubMed] [Europe PMC] [Abstract] Cited for: TOPOLOGY. |
| [16] | "The TRC8 E3 ligase ubiquitinates MHC class I molecules before dislocation from the ER." Stagg H.R., Thomas M., van den Boomen D., Wiertz E.J., Drabkin H.A., Gemmill R.M., Lehner P.J. J. Cell Biol. 186:685-692(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RNF139. |
| [17] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-10 AND ASN-20, MASS SPECTROMETRY. Tissue: Liver. |
| [18] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ420895 mRNA. Translation: CAD13132.1. AF515663 mRNA. Translation: AAN77099.1. AY169310 mRNA. Translation: AAO12535.1. AY169311 mRNA. Translation: AAO12536.1. AY169312 mRNA. Translation: AAO12537.1. DQ168450 mRNA. Translation: ABA56163.1. AJ345029 mRNA. Translation: CAC87790.1. AF483215 mRNA. Translation: AAM22076.1. AF172086 mRNA. Translation: AAQ13609.1. Frameshift. AK074686 mRNA. Translation: BAC11138.1. Sequence problems. AK075283 mRNA. Translation: BAC11519.1. AK314410 mRNA. Translation: BAG37032.1. AL110115, AL121751 Genomic DNA. Translation: CAI20173.1. Sequence problems. AL110115, AL121751 Genomic DNA. Translation: CAI20174.1. AL110115, AL121751 Genomic DNA. Translation: CAI20175.2. AL121751, AL110115 Genomic DNA. Translation: CAI19152.1. Sequence problems. AL121751, AL110115 Genomic DNA. Translation: CAI19153.1. AL121751, AL110115 Genomic DNA. Translation: CAI19154.2. CH471077 Genomic DNA. Translation: EAW76436.1. CH471077 Genomic DNA. Translation: EAW76437.1. CH471077 Genomic DNA. Translation: EAW76435.1. CH471077 Genomic DNA. Translation: EAW76438.1. BC008938 mRNA. Translation: AAH08938.1. BC008959 mRNA. Translation: AAH08959.1. BC062595 mRNA. Translation: AAH62595.1. |
| IPI | IPI00152441. IPI00220687. IPI00329296. IPI00552772. |
| RefSeq | NP_110416.1. NM_030789.2. NP_848695.1. NM_178580.1. NP_848696.1. NM_178581.1. NP_848697.1. NM_178582.1. |
| UniGene | Hs.373741. |
3D structure databases | |
| ProteinModelPortal | Q8TCT9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8TCT9. 6 interactions. |
Protein family/group databases | |
| MEROPS | A22.003. |
PTM databases | |
| PhosphoSite | Q8TCT9. |
Polymorphism databases | |
| DMDM | 25008563. |
Proteomic databases | |
| PaxDb | Q8TCT9. |
| PRIDE | Q8TCT9. |
Protocols and materials databases | |
| DNASU | 81502. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000335574; ENSP00000335294; ENSG00000101294. ENST00000340852; ENSP00000343032; ENSG00000101294. ENST00000344042; ENSP00000341347; ENSG00000101294. ENST00000376127; ENSP00000365296; ENSG00000101294. ENST00000398174; ENSP00000381237; ENSG00000101294. |
| GeneID | 81502. |
| KEGG | hsa:81502. |
| UCSC | uc002wwc.3. human. uc002wwd.3. human. uc002wwe.3. human. |
Organism-specific databases | |
| CTD | 81502. |
| GeneCards | GC20P030106. |
| HGNC | HGNC:16435. HM13. |
| HPA | HPA045089. |
| MIM | 607106. gene. |
| neXtProt | NX_Q8TCT9. |
| PharmGKB | PA29314. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG313636. |
| HOVERGEN | HBG024161. |
| KO | K09595. |
| OMA | TGCILLC. |
| OrthoDB | EOG4TF0K9. |
Gene expression databases | |
| Bgee | Q8TCT9. |
| Genevestigator | Q8TCT9. |
| GermOnline | ENSG00000101294. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR006639. Peptidase_A22. IPR007369. Peptidase_A22B_SPP. [Graphical view] |
| PANTHER | PTHR12174. PTHR12174. 1 hit. |
| Pfam | PF04258. Peptidase_A22B. 1 hit. [Graphical view] |
| SMART | SM00730. PSN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | HM13. human. |
| GenomeRNAi | 81502. |
| NextBio | 71746. |
| SOURCE | Search... |
Entry information
| Entry name | HM13_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8TCT9 Secondary accession number(s): B2RAY5 Q9H111 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
