Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Placental protein 13-like

Gene

LGALS14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processApoptosis
LigandLectin

Names & Taxonomyi

Protein namesi
Recommended name:
Placental protein 13-like
Alternative name(s):
Charcot-Leyden crystal protein 2
Short name:
CLC2
Galectin-14
Short name:
Gal-14
Gene namesi
Name:LGALS14
Synonyms:PPL13
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:30054. LGALS14.

Subcellular locationi

GO - Cellular componenti

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi56891.
OpenTargetsiENSG00000006659.
PharmGKBiPA134882378.

Polymorphism and mutation databases

BioMutaiLGALS14.
DMDMi229462736.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000769641 – 139Placental protein 13-likeAdd BLAST139

Proteomic databases

PaxDbiQ8TCE9.
PRIDEiQ8TCE9.

Expressioni

Tissue specificityi

Highly expressed in placenta.2 Publications

Gene expression databases

BgeeiENSG00000006659.
CleanExiHS_LGALS14.
ExpressionAtlasiQ8TCE9. baseline and differential.
GenevisibleiQ8TCE9. HS.

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi121221. 15 interactors.
IntActiQ8TCE9. 42 interactors.
STRINGi9606.ENSP00000353893.

Structurei

3D structure databases

ProteinModelPortaliQ8TCE9.
SMRiQ8TCE9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini6 – 138GalectinPROSITE-ProRule annotationAdd BLAST133

Phylogenomic databases

eggNOGiKOG3587. Eukaryota.
ENOG4111EA0. LUCA.
GeneTreeiENSGT00530000064497.
HOGENOMiHOG000015090.
HOVERGENiHBG006255.
InParanoidiQ8TCE9.
KOiK10097.
OrthoDBiEOG091G0QKJ.
PhylomeDBiQ8TCE9.
TreeFamiTF315551.

Family and domain databases

Gene3Di2.60.120.200. 1 hit.
InterProiView protein in InterPro
IPR013320. ConA-like_dom.
IPR030652. Galectin_14.
IPR001079. Galectin_CRD.
PANTHERiPTHR11346:SF117. PTHR11346:SF117. 1 hit.
PfamiView protein in Pfam
PF00337. Gal-bind_lectin. 1 hit.
SMARTiView protein in SMART
SM00908. Gal-bind_lectin. 1 hit.
SM00276. GLECT. 1 hit.
SUPFAMiSSF49899. SSF49899. 1 hit.
PROSITEiView protein in PROSITE
PS51304. GALECTIN. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TCE9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSLPVPYTL PVSLPVGSCV IITGTPILTF VKDPQLEVNF YTGMDEDSDI
60 70 80 90 100
AFQFRLHFGH PAIMNSCVFG IWRYEEKCYY LPFEDGKPFE LCIYVRHKEY
110 120 130
KVMVNGQRIY NFAHRFPPAS VKMLQVFRDI SLTRVLISD
Length:139
Mass (Da):16,094
Last modified:May 5, 2009 - v2
Checksum:i9B13695DB3C1E55A
GO
Isoform 2 (identifier: Q8TCE9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MSSLP → MSLTHRLHLCKYWGCAVSNVCRFWEGRPLPLMIV

Note: Gene prediction based on EST data.
Show »
Length:168
Mass (Da):19,578
Checksum:i70A5236771B917FF
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti3 – 6SLPV → ITPG in AAP97241 (Ref. 1) Curated4
Sequence conflicti13 – 14SL → PC in AAP97241 (Ref. 1) Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05524567C → R4 PublicationsCorresponds to variant dbSNP:rs4830Ensembl.1
Natural variantiVAR_055246127F → L4 PublicationsCorresponds to variant dbSNP:rs10755Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0470671 – 5MSSLP → MSLTHRLHLCKYWGCAVSNV CRFWEGRPLPLMIV in isoform 2. Curated5

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF123762 mRNA. Translation: AAP97241.1.
AF267852 mRNA. Translation: AAF78953.1.
AF367430 mRNA. Translation: AAK56284.1.
AF367431 mRNA. Translation: AAK56285.1.
AF367432 mRNA. Translation: AAK56286.1.
FJ613341 mRNA. Translation: ACR09643.1.
FJ613342 mRNA. Translation: ACR09644.1.
AK312040 mRNA. Translation: BAG34977.1.
AC006133 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW56913.1.
BC022257 mRNA. Translation: AAH22257.1.
CCDSiCCDS12542.1. [Q8TCE9-2]
CCDS46073.1. [Q8TCE9-1]
RefSeqiNP_064514.1. NM_020129.2. [Q8TCE9-1]
NP_982297.1. NM_203471.1. [Q8TCE9-2]
UniGeneiHs.24236.

Genome annotation databases

EnsembliENST00000360675; ENSP00000353893; ENSG00000006659. [Q8TCE9-2]
ENST00000392052; ENSP00000375905; ENSG00000006659. [Q8TCE9-1]
GeneIDi56891.
KEGGihsa:56891.
UCSCiuc002omf.4. human. [Q8TCE9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - Glycan Binding

Galectin-13

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF123762 mRNA. Translation: AAP97241.1.
AF267852 mRNA. Translation: AAF78953.1.
AF367430 mRNA. Translation: AAK56284.1.
AF367431 mRNA. Translation: AAK56285.1.
AF367432 mRNA. Translation: AAK56286.1.
FJ613341 mRNA. Translation: ACR09643.1.
FJ613342 mRNA. Translation: ACR09644.1.
AK312040 mRNA. Translation: BAG34977.1.
AC006133 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW56913.1.
BC022257 mRNA. Translation: AAH22257.1.
CCDSiCCDS12542.1. [Q8TCE9-2]
CCDS46073.1. [Q8TCE9-1]
RefSeqiNP_064514.1. NM_020129.2. [Q8TCE9-1]
NP_982297.1. NM_203471.1. [Q8TCE9-2]
UniGeneiHs.24236.

3D structure databases

ProteinModelPortaliQ8TCE9.
SMRiQ8TCE9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121221. 15 interactors.
IntActiQ8TCE9. 42 interactors.
STRINGi9606.ENSP00000353893.

Polymorphism and mutation databases

BioMutaiLGALS14.
DMDMi229462736.

Proteomic databases

PaxDbiQ8TCE9.
PRIDEiQ8TCE9.

Protocols and materials databases

DNASUi56891.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000360675; ENSP00000353893; ENSG00000006659. [Q8TCE9-2]
ENST00000392052; ENSP00000375905; ENSG00000006659. [Q8TCE9-1]
GeneIDi56891.
KEGGihsa:56891.
UCSCiuc002omf.4. human. [Q8TCE9-1]

Organism-specific databases

CTDi56891.
DisGeNETi56891.
GeneCardsiLGALS14.
HGNCiHGNC:30054. LGALS14.
MIMi607260. gene.
neXtProtiNX_Q8TCE9.
OpenTargetsiENSG00000006659.
PharmGKBiPA134882378.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3587. Eukaryota.
ENOG4111EA0. LUCA.
GeneTreeiENSGT00530000064497.
HOGENOMiHOG000015090.
HOVERGENiHBG006255.
InParanoidiQ8TCE9.
KOiK10097.
OrthoDBiEOG091G0QKJ.
PhylomeDBiQ8TCE9.
TreeFamiTF315551.

Miscellaneous databases

GenomeRNAii56891.
PROiPR:Q8TCE9.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000006659.
CleanExiHS_LGALS14.
ExpressionAtlasiQ8TCE9. baseline and differential.
GenevisibleiQ8TCE9. HS.

Family and domain databases

Gene3Di2.60.120.200. 1 hit.
InterProiView protein in InterPro
IPR013320. ConA-like_dom.
IPR030652. Galectin_14.
IPR001079. Galectin_CRD.
PANTHERiPTHR11346:SF117. PTHR11346:SF117. 1 hit.
PfamiView protein in Pfam
PF00337. Gal-bind_lectin. 1 hit.
SMARTiView protein in SMART
SM00908. Gal-bind_lectin. 1 hit.
SM00276. GLECT. 1 hit.
SUPFAMiSSF49899. SSF49899. 1 hit.
PROSITEiView protein in PROSITE
PS51304. GALECTIN. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiPPL13_HUMAN
AccessioniPrimary (citable) accession number: Q8TCE9
Secondary accession number(s): A8MPV8
, B2R530, C5HZ19, Q7Z4X8, Q96KD4, Q96KD5, Q96KD6, Q9NR03
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 16, 2004
Last sequence update: May 5, 2009
Last modified: March 15, 2017
This is version 128 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.