Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Placental protein 13-like

Gene

LGALS14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Apoptosis

Keywords - Ligandi

Lectin

Names & Taxonomyi

Protein namesi
Recommended name:
Placental protein 13-like
Alternative name(s):
Charcot-Leyden crystal protein 2
Short name:
CLC2
Galectin-14
Short name:
Gal-14
Gene namesi
Name:LGALS14
Synonyms:PPL13
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:30054. LGALS14.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134882378.

Polymorphism and mutation databases

BioMutaiLGALS14.
DMDMi229462736.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 139139Placental protein 13-likePRO_0000076964Add
BLAST

Proteomic databases

PaxDbiQ8TCE9.
PRIDEiQ8TCE9.

Expressioni

Tissue specificityi

Highly expressed in placenta.2 Publications

Gene expression databases

BgeeiQ8TCE9.
CleanExiHS_LGALS14.
ExpressionAtlasiQ8TCE9. baseline and differential.
GenevisibleiQ8TCE9. HS.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ADAMTSL4Q6UY14-33EBI-10274069,EBI-10173507
BANPQ8N9N53EBI-10274069,EBI-744695
CRLF3Q8IUI83EBI-10274069,EBI-2872414
FCHO1O145263EBI-10274069,EBI-719823
FLNAP21333-23EBI-10274069,EBI-9641086
GFAPP141363EBI-10274069,EBI-744302
IKZF3Q9UKT93EBI-10274069,EBI-747204
LNX1Q8TBB13EBI-10274069,EBI-739832
MID2Q9UJV3-23EBI-10274069,EBI-10172526
RELQ048643EBI-10274069,EBI-307352
SDCBP2Q9H1903EBI-10274069,EBI-742426
SPAG5Q96R063EBI-10274069,EBI-413317
TCF4P158843EBI-10274069,EBI-533224
TNRA1L3063EBI-10274069,EBI-10182881
TRIM27P143733EBI-10274069,EBI-719493

Protein-protein interaction databases

BioGridi121221. 15 interactions.
IntActiQ8TCE9. 15 interactions.
STRINGi9606.ENSP00000353893.

Structurei

3D structure databases

ProteinModelPortaliQ8TCE9.
SMRiQ8TCE9. Positions 2-138.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini6 – 138133GalectinPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 galectin domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3587. Eukaryota.
ENOG4111EA0. LUCA.
GeneTreeiENSGT00530000064497.
HOGENOMiHOG000015090.
HOVERGENiHBG006255.
InParanoidiQ8TCE9.
KOiK10097.
OrthoDBiEOG7WQ7V1.
PhylomeDBiQ8TCE9.
TreeFamiTF315551.

Family and domain databases

Gene3Di2.60.120.200. 1 hit.
InterProiIPR013320. ConA-like_dom.
IPR030652. Galectin_14.
IPR001079. Galectin_CRD.
[Graphical view]
PANTHERiPTHR11346:SF92. PTHR11346:SF92. 1 hit.
PfamiPF00337. Gal-bind_lectin. 1 hit.
[Graphical view]
SMARTiSM00908. Gal-bind_lectin. 1 hit.
SM00276. GLECT. 1 hit.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 1 hit.
PROSITEiPS51304. GALECTIN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TCE9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSLPVPYTL PVSLPVGSCV IITGTPILTF VKDPQLEVNF YTGMDEDSDI
60 70 80 90 100
AFQFRLHFGH PAIMNSCVFG IWRYEEKCYY LPFEDGKPFE LCIYVRHKEY
110 120 130
KVMVNGQRIY NFAHRFPPAS VKMLQVFRDI SLTRVLISD
Length:139
Mass (Da):16,094
Last modified:May 5, 2009 - v2
Checksum:i9B13695DB3C1E55A
GO
Isoform 2 (identifier: Q8TCE9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MSSLP → MSLTHRLHLCKYWGCAVSNVCRFWEGRPLPLMIV

Note: Gene prediction based on EST data.
Show »
Length:168
Mass (Da):19,578
Checksum:i70A5236771B917FF
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti3 – 64SLPV → ITPG in AAP97241 (Ref. 1) Curated
Sequence conflicti13 – 142SL → PC in AAP97241 (Ref. 1) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti67 – 671C → R.4 Publications
Corresponds to variant rs4830 [ dbSNP | Ensembl ].
VAR_055245
Natural varianti127 – 1271F → L.4 Publications
Corresponds to variant rs10755 [ dbSNP | Ensembl ].
VAR_055246

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 55MSSLP → MSLTHRLHLCKYWGCAVSNV CRFWEGRPLPLMIV in isoform 2. CuratedVSP_047067

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF123762 mRNA. Translation: AAP97241.1.
AF267852 mRNA. Translation: AAF78953.1.
AF367430 mRNA. Translation: AAK56284.1.
AF367431 mRNA. Translation: AAK56285.1.
AF367432 mRNA. Translation: AAK56286.1.
FJ613341 mRNA. Translation: ACR09643.1.
FJ613342 mRNA. Translation: ACR09644.1.
AK312040 mRNA. Translation: BAG34977.1.
AC006133 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW56913.1.
BC022257 mRNA. Translation: AAH22257.1.
CCDSiCCDS12542.1. [Q8TCE9-2]
CCDS46073.1. [Q8TCE9-1]
RefSeqiNP_064514.1. NM_020129.2. [Q8TCE9-1]
NP_982297.1. NM_203471.1. [Q8TCE9-2]
UniGeneiHs.24236.

Genome annotation databases

EnsembliENST00000360675; ENSP00000353893; ENSG00000006659. [Q8TCE9-2]
ENST00000392052; ENSP00000375905; ENSG00000006659. [Q8TCE9-1]
GeneIDi56891.
KEGGihsa:56891.
UCSCiuc002omf.4. human. [Q8TCE9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - Glycan Binding

Galectin-13

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF123762 mRNA. Translation: AAP97241.1.
AF267852 mRNA. Translation: AAF78953.1.
AF367430 mRNA. Translation: AAK56284.1.
AF367431 mRNA. Translation: AAK56285.1.
AF367432 mRNA. Translation: AAK56286.1.
FJ613341 mRNA. Translation: ACR09643.1.
FJ613342 mRNA. Translation: ACR09644.1.
AK312040 mRNA. Translation: BAG34977.1.
AC006133 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW56913.1.
BC022257 mRNA. Translation: AAH22257.1.
CCDSiCCDS12542.1. [Q8TCE9-2]
CCDS46073.1. [Q8TCE9-1]
RefSeqiNP_064514.1. NM_020129.2. [Q8TCE9-1]
NP_982297.1. NM_203471.1. [Q8TCE9-2]
UniGeneiHs.24236.

3D structure databases

ProteinModelPortaliQ8TCE9.
SMRiQ8TCE9. Positions 2-138.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121221. 15 interactions.
IntActiQ8TCE9. 15 interactions.
STRINGi9606.ENSP00000353893.

Polymorphism and mutation databases

BioMutaiLGALS14.
DMDMi229462736.

Proteomic databases

PaxDbiQ8TCE9.
PRIDEiQ8TCE9.

Protocols and materials databases

DNASUi56891.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000360675; ENSP00000353893; ENSG00000006659. [Q8TCE9-2]
ENST00000392052; ENSP00000375905; ENSG00000006659. [Q8TCE9-1]
GeneIDi56891.
KEGGihsa:56891.
UCSCiuc002omf.4. human. [Q8TCE9-1]

Organism-specific databases

CTDi56891.
GeneCardsiLGALS14.
HGNCiHGNC:30054. LGALS14.
MIMi607260. gene.
neXtProtiNX_Q8TCE9.
PharmGKBiPA134882378.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3587. Eukaryota.
ENOG4111EA0. LUCA.
GeneTreeiENSGT00530000064497.
HOGENOMiHOG000015090.
HOVERGENiHBG006255.
InParanoidiQ8TCE9.
KOiK10097.
OrthoDBiEOG7WQ7V1.
PhylomeDBiQ8TCE9.
TreeFamiTF315551.

Miscellaneous databases

GenomeRNAii56891.
PROiQ8TCE9.
SOURCEiSearch...

Gene expression databases

BgeeiQ8TCE9.
CleanExiHS_LGALS14.
ExpressionAtlasiQ8TCE9. baseline and differential.
GenevisibleiQ8TCE9. HS.

Family and domain databases

Gene3Di2.60.120.200. 1 hit.
InterProiIPR013320. ConA-like_dom.
IPR030652. Galectin_14.
IPR001079. Galectin_CRD.
[Graphical view]
PANTHERiPTHR11346:SF92. PTHR11346:SF92. 1 hit.
PfamiPF00337. Gal-bind_lectin. 1 hit.
[Graphical view]
SMARTiSM00908. Gal-bind_lectin. 1 hit.
SM00276. GLECT. 1 hit.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 1 hit.
PROSITEiPS51304. GALECTIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterizing a new human cDNA homologous to human eosinophil Charcot-Leyden crystal protein (lysophospholipase) mRNA."
    Jin L., Yu L., Zhao S.Y.
    Submitted (JAN-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ARG-67 AND LEU-127.
  2. "Cloning and expression of a novel human galectin cDNA, predominantly expressed in placenta."
    Yang Q.-S., Ying K., Yuan H.-L., Chen J.-Z., Meng X.-F., Wang Z., Xie Y., Mao Y.-M.
    Biochim. Biophys. Acta 1574:407-411(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Fetal brain.
  3. Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, TISSUE SPECIFICITY, VARIANTS ARG-67 AND LEU-127.
    Tissue: Placenta.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Tissue: Placenta.
  5. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANTS ARG-67 AND LEU-127.
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ARG-67 AND LEU-127.
    Tissue: Placenta.

Entry informationi

Entry nameiPPL13_HUMAN
AccessioniPrimary (citable) accession number: Q8TCE9
Secondary accession number(s): A8MPV8
, B2R530, C5HZ19, Q7Z4X8, Q96KD4, Q96KD5, Q96KD6, Q9NR03
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 16, 2004
Last sequence update: May 5, 2009
Last modified: June 8, 2016
This is version 123 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.