Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

39S ribosomal protein L30, mitochondrial

Gene

MRPL30

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Biological processi

  1. mitochondrial translation Source: Reactome
  2. mitochondrial translational elongation Source: Reactome
  3. mitochondrial translational initiation Source: Reactome
  4. mitochondrial translational termination Source: Reactome
  5. organelle organization Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Ribonucleoprotein, Ribosomal protein

Enzyme and pathway databases

ReactomeiREACT_267602. Mitochondrial translation termination.
REACT_267677. Mitochondrial translation elongation.
REACT_267680. Mitochondrial translation initiation.

Names & Taxonomyi

Protein namesi
Recommended name:
39S ribosomal protein L30, mitochondrial
Short name:
L30mt
Short name:
MRP-L30
Alternative name(s):
39S ribosomal protein L28, mitochondrial
Short name:
L28mt
Short name:
MRP-L28
Gene namesi
Name:MRPL30
Synonyms:MRPL28, RPML28
ORF Names:HSPC249
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:14036. MRPL30.

Subcellular locationi

Mitochondrion By similarity

GO - Cellular componenti

  1. mitochondrial inner membrane Source: Reactome
  2. ribosome Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30961.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transit peptidei1 – 3434MitochondrionBy similarityAdd
BLAST
Chaini35 – 16112739S ribosomal protein L30, mitochondrialPRO_0000261649Add
BLAST

Proteomic databases

MaxQBiQ8TCC3.
PRIDEiQ8TCC3.

PTM databases

PhosphoSiteiQ8TCC3.

Expressioni

Gene expression databases

BgeeiQ8TCC3.
CleanExiHS_MRPL28.
HS_MRPL30.
ExpressionAtlasiQ8TCC3. baseline and differential.
GenevestigatoriQ8TCC3.

Organism-specific databases

HPAiHPA047255.

Interactioni

Protein-protein interaction databases

BioGridi119417. 16 interactions.
STRINGi9606.ENSP00000311103.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3J7Yelectron microscopy3.40Z1-161[»]
ProteinModelPortaliQ8TCC3.
SMRiQ8TCC3. Positions 35-151.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the ribosomal protein L30P family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

GeneTreeiENSGT00390000016769.
HOVERGENiHBG082601.
InParanoidiQ8TCC3.
KOiK02907.
OMAiLVVQWHL.
OrthoDBiEOG7BP841.
PhylomeDBiQ8TCC3.
TreeFamiTF314611.

Family and domain databases

Gene3Di3.30.1390.20. 1 hit.
InterProiIPR016082. Ribosomal_L30_ferredoxin-like.
[Graphical view]
PfamiPF00327. Ribosomal_L30. 1 hit.
[Graphical view]
SUPFAMiSSF55129. SSF55129. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TCC3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGILRLVVQ WPPGRLQTVT KGVESLICTD WIRHKFTRSR IPEKVFQASP
60 70 80 90 100
EDHEKYGGDP QNPHKLHIVT RIKSTRRRPY WEKDIIKMLG LEKAHTPQVH
110 120 130 140 150
KNIPSVNAKL KVVKHLIRIK PLKLPQGLPA EENMSNTCLK STGELVVQWH
160
LKPVEQKAHE S
Length:161
Mass (Da):18,546
Last modified:June 1, 2002 - v1
Checksum:iE818AD8B8AA7DD23
GO
Isoform 2 (identifier: Q8TCC3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSSTLGKLSNQVEETLPLLKKPLKRAITTLM

Note: No experimental confirmation available.

Show »
Length:191
Mass (Da):21,839
Checksum:i98159061F494ABD5
GO
Isoform 3 (identifier: Q8TCC3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     119-161: IKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES → FVVSSQLFLKCIA

Note: No experimental confirmation available.

Show »
Length:131
Mass (Da):15,191
Checksum:i0CCC141A971552CE
GO

Sequence cautioni

The sequence AAF36169.1 differs from that shown. Reason: Frameshift at positions 1 and 36. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti45 – 451V → A in BAC86542 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti130 – 1301A → T.3 Publications
Corresponds to variant rs1044575 [ dbSNP | Ensembl ].
VAR_034462

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MSSTLGKLSNQVEETLPLLK KPLKRAITTLM in isoform 2. 1 PublicationVSP_021746
Alternative sequencei119 – 16143IKPLK…KAHES → FVVSSQLFLKCIA in isoform 3. 1 PublicationVSP_021747Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF151083 mRNA. Translation: AAF36169.1. Frameshift.
AK126402 mRNA. Translation: BAC86542.1.
AC092587 Genomic DNA. Translation: AAX88929.1.
CH471127 Genomic DNA. Translation: EAX01876.1.
CH471127 Genomic DNA. Translation: EAX01878.1.
CH471127 Genomic DNA. Translation: EAX01880.1.
CH471127 Genomic DNA. Translation: EAX01881.1.
CH471127 Genomic DNA. Translation: EAX01882.1.
CH471127 Genomic DNA. Translation: EAX01883.1.
BC000217 mRNA. Translation: AAH00217.1.
BC022391 mRNA. Translation: AAH22391.1.
AB051342 Genomic DNA. Translation: BAB54932.1.
CCDSiCCDS2041.1. [Q8TCC3-1]
RefSeqiNP_660213.1. NM_145212.3. [Q8TCC3-1]
UniGeneiHs.346736.

Genome annotation databases

EnsembliENST00000338148; ENSP00000338057; ENSG00000185414. [Q8TCC3-1]
ENST00000409841; ENSP00000386752; ENSG00000185414. [Q8TCC3-1]
GeneIDi51263.
KEGGihsa:51263.
UCSCiuc002szr.3. human. [Q8TCC3-3]
uc002szu.3. human. [Q8TCC3-1]

Polymorphism databases

DMDMi74730583.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF151083 mRNA. Translation: AAF36169.1. Frameshift.
AK126402 mRNA. Translation: BAC86542.1.
AC092587 Genomic DNA. Translation: AAX88929.1.
CH471127 Genomic DNA. Translation: EAX01876.1.
CH471127 Genomic DNA. Translation: EAX01878.1.
CH471127 Genomic DNA. Translation: EAX01880.1.
CH471127 Genomic DNA. Translation: EAX01881.1.
CH471127 Genomic DNA. Translation: EAX01882.1.
CH471127 Genomic DNA. Translation: EAX01883.1.
BC000217 mRNA. Translation: AAH00217.1.
BC022391 mRNA. Translation: AAH22391.1.
AB051342 Genomic DNA. Translation: BAB54932.1.
CCDSiCCDS2041.1. [Q8TCC3-1]
RefSeqiNP_660213.1. NM_145212.3. [Q8TCC3-1]
UniGeneiHs.346736.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3J7Yelectron microscopy3.40Z1-161[»]
ProteinModelPortaliQ8TCC3.
SMRiQ8TCC3. Positions 35-151.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119417. 16 interactions.
STRINGi9606.ENSP00000311103.

PTM databases

PhosphoSiteiQ8TCC3.

Polymorphism databases

DMDMi74730583.

Proteomic databases

MaxQBiQ8TCC3.
PRIDEiQ8TCC3.

Protocols and materials databases

DNASUi51263.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338148; ENSP00000338057; ENSG00000185414. [Q8TCC3-1]
ENST00000409841; ENSP00000386752; ENSG00000185414. [Q8TCC3-1]
GeneIDi51263.
KEGGihsa:51263.
UCSCiuc002szr.3. human. [Q8TCC3-3]
uc002szu.3. human. [Q8TCC3-1]

Organism-specific databases

CTDi51263.
GeneCardsiGC02P099775.
GC02P099800.
H-InvDBHIX0077794.
HGNCiHGNC:14036. MRPL30.
HPAiHPA047255.
MIMi611838. gene.
neXtProtiNX_Q8TCC3.
PharmGKBiPA30961.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000016769.
HOVERGENiHBG082601.
InParanoidiQ8TCC3.
KOiK02907.
OMAiLVVQWHL.
OrthoDBiEOG7BP841.
PhylomeDBiQ8TCC3.
TreeFamiTF314611.

Enzyme and pathway databases

ReactomeiREACT_267602. Mitochondrial translation termination.
REACT_267677. Mitochondrial translation elongation.
REACT_267680. Mitochondrial translation initiation.

Miscellaneous databases

ChiTaRSiMRPL30. human.
GeneWikiiMRPL30.
GenomeRNAii51263.
NextBioi54435.
PROiQ8TCC3.
SOURCEiSearch...

Gene expression databases

BgeeiQ8TCC3.
CleanExiHS_MRPL28.
HS_MRPL30.
ExpressionAtlasiQ8TCC3. baseline and differential.
GenevestigatoriQ8TCC3.

Family and domain databases

Gene3Di3.30.1390.20. 1 hit.
InterProiIPR016082. Ribosomal_L30_ferredoxin-like.
[Graphical view]
PfamiPF00327. Ribosomal_L30. 1 hit.
[Graphical view]
SUPFAMiSSF55129. SSF55129. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
    Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X.
    , Gu J., Chen S.-J., Chen Z.
    Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Umbilical cord blood.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT THR-130.
    Tissue: Uterus.
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT THR-130.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-130.
    Tissue: Brain and Kidney.
  6. "The human mitochondrial ribosomal protein genes: mapping of 54 genes to the chromosomes and implications for human disorders."
    Kenmochi N., Suzuki T., Uechi T., Magoori M., Kuniba M., Higa S., Watanabe K., Tanaka T.
    Genomics 77:65-70(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 94-161.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiRM30_HUMAN
AccessioniPrimary (citable) accession number: Q8TCC3
Secondary accession number(s): A6NIC6
, D3DVI0, D3DVI3, Q0D2Q7, Q6ZTP4, Q96Q69, Q9P0N0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: June 1, 2002
Last modified: March 4, 2015
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Ribosomal proteins
    Ribosomal proteins families and list of entries
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.