Q8TCC3 (RM30_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 92.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 39S ribosomal protein L30, mitochondrial Short name=L30mt Short name=MRP-L30 Alternative name(s): 39S ribosomal protein L28, mitochondrial Short name=L28mt Short name=MRP-L28 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 161 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Mitochondrion By similarity. |
| Sequence similarities | Belongs to the ribosomal protein L30P family. |
| Sequence caution | The sequence AAF36169.1 differs from that shown. Reason: Frameshift at positions 1 and 36. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transit peptide |
| Molecular function | Ribonucleoprotein Ribosomal protein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | mitochondrion Inferred from electronic annotation. Source: UniProtKB-SubCell ribosomeInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8TCC3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8TCC3-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MSSTLGKLSNQVEETLPLLKKPLKRAITTLM | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8TCC3-3) The sequence of this isoform differs from the canonical sequence as follows: 119-161: IKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES → FVVSSQLFLKCIA | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 34 | 34 | Mitochondrion By similarity | ||||||
| Chain | 35 – 161 | 127 | 39S ribosomal protein L30, mitochondrial | PRO_0000261649 | |||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MSSTLGKLSNQVEETLPLLK KPLKRAITTLM in isoform 2. | VSP_021746 | |||||
| Alternative sequence | 119 – 161 | 43 | IKPLK…KAHES → FVVSSQLFLKCIA in isoform 3. | VSP_021747 | |||||
| Natural variant | 130 | 1 | A → T. Ref.2 Ref.4 Ref.5 Corresponds to variant rs1044575 [ dbSNP | Ensembl ]. | VAR_034462 | |||||
Experimental info | |||||||||
| Sequence conflict | 45 | 1 | V → A in BAC86542. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells." Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. Chen Z.Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Umbilical cord blood. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT THR-130. Tissue: Uterus. |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT THR-130. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-130. Tissue: Brain and Kidney. |
| [6] | "The human mitochondrial ribosomal protein genes: mapping of 54 genes to the chromosomes and implications for human disorders." Kenmochi N., Suzuki T., Uechi T., Magoori M., Kuniba M., Higa S., Watanabe K., Tanaka T. Genomics 77:65-70(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 94-161. |
| [7] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF151083 mRNA. Translation: AAF36169.1. Frameshift. AK126402 mRNA. Translation: BAC86542.1. AC092587 Genomic DNA. Translation: AAX88929.1. CH471127 Genomic DNA. Translation: EAX01876.1. CH471127 Genomic DNA. Translation: EAX01878.1. CH471127 Genomic DNA. Translation: EAX01880.1. CH471127 Genomic DNA. Translation: EAX01881.1. CH471127 Genomic DNA. Translation: EAX01882.1. CH471127 Genomic DNA. Translation: EAX01883.1. BC000217 mRNA. Translation: AAH00217.1. BC022391 mRNA. Translation: AAH22391.1. AB051342 Genomic DNA. Translation: BAB54932.1. |
| IPI | IPI00465176. IPI00748207. IPI00807606. |
| RefSeq | NP_660213.1. NM_145212.3. |
| UniGene | Hs.346736. |
3D structure databases | |
| ProteinModelPortal | Q8TCC3. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000311103. |
PTM databases | |
| PhosphoSite | Q8TCC3. |
Polymorphism databases | |
| DMDM | 74730583. |
Proteomic databases | |
| PRIDE | Q8TCC3. |
Protocols and materials databases | |
| DNASU | 51263. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000338148; ENSP00000338057; ENSG00000185414. ENST00000409841; ENSP00000386752; ENSG00000185414. ENST00000410042; ENSP00000387111; ENSG00000185414. |
| GeneID | 51263. |
| KEGG | hsa:51263. |
| UCSC | uc002szr.3. human. uc002szu.3. human. |
Organism-specific databases | |
| CTD | 51263. |
| GeneCards | GC02P099772. |
| H-InvDB | HIX0077794. |
| HGNC | HGNC:14036. MRPL30. |
| HPA | HPA047255. |
| MIM | 611838. gene. |
| neXtProt | NX_Q8TCC3. |
| PharmGKB | PA30961. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | HBG082601. |
| InParanoid | Q8TCC3. |
| KO | K02907. |
| OMA | LVVQWHL. |
| PhylomeDB | Q8TCC3. |
Gene expression databases | |
| ArrayExpress | Q8TCC3. |
| Bgee | Q8TCC3. |
| CleanEx | HS_MRPL28. HS_MRPL30. |
| Genevestigator | Q8TCC3. |
| GermOnline | ENSG00000185414. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.1390.20. 1 hit. |
| InterPro | IPR016082. Ribosomal_L30_ferredoxin-like. [Graphical view] |
| Pfam | PF00327. Ribosomal_L30. 1 hit. [Graphical view] |
| SUPFAM | SSF55129. Ribosomal_L30. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | MRPL30. human. |
| GenomeRNAi | 51263. |
| NextBio | 54435. |
| SOURCE | Search... |
Entry information
| Entry name | RM30_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8TCC3 Secondary accession number(s): A6NIC6 Q9P0N0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Ribosomal proteins Ribosomal proteins families and list of entries |
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
