Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8TCC3

- RM30_HUMAN

UniProt

Q8TCC3 - RM30_HUMAN

Protein

39S ribosomal protein L30, mitochondrial

Gene

MRPL30

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 103 (01 Oct 2014)
      Sequence version 1 (01 Jun 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Keywords - Molecular functioni

    Ribonucleoprotein, Ribosomal protein

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    39S ribosomal protein L30, mitochondrial
    Short name:
    L30mt
    Short name:
    MRP-L30
    Alternative name(s):
    39S ribosomal protein L28, mitochondrial
    Short name:
    L28mt
    Short name:
    MRP-L28
    Gene namesi
    Name:MRPL30
    Synonyms:MRPL28, RPML28
    ORF Names:HSPC249
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:14036. MRPL30.

    Subcellular locationi

    Mitochondrion By similarity

    GO - Cellular componenti

    1. mitochondrion Source: UniProtKB-SubCell
    2. ribosome Source: UniProtKB-KW

    Keywords - Cellular componenti

    Mitochondrion

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30961.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transit peptidei1 – 3434MitochondrionBy similarityAdd
    BLAST
    Chaini35 – 16112739S ribosomal protein L30, mitochondrialPRO_0000261649Add
    BLAST

    Proteomic databases

    MaxQBiQ8TCC3.
    PRIDEiQ8TCC3.

    PTM databases

    PhosphoSiteiQ8TCC3.

    Expressioni

    Gene expression databases

    BgeeiQ8TCC3.
    CleanExiHS_MRPL28.
    HS_MRPL30.
    GenevestigatoriQ8TCC3.

    Organism-specific databases

    HPAiHPA047255.

    Interactioni

    Protein-protein interaction databases

    BioGridi119417. 4 interactions.
    STRINGi9606.ENSP00000311103.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8TCC3.
    SMRiQ8TCC3. Positions 65-123.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the ribosomal protein L30P family.Curated

    Keywords - Domaini

    Transit peptide

    Phylogenomic databases

    HOVERGENiHBG082601.
    InParanoidiQ8TCC3.
    KOiK02907.
    OMAiLVVQWHL.
    OrthoDBiEOG7BP841.
    PhylomeDBiQ8TCC3.
    TreeFamiTF314611.

    Family and domain databases

    Gene3Di3.30.1390.20. 1 hit.
    InterProiIPR016082. Ribosomal_L30_ferredoxin-like.
    [Graphical view]
    PfamiPF00327. Ribosomal_L30. 1 hit.
    [Graphical view]
    SUPFAMiSSF55129. SSF55129. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8TCC3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAGILRLVVQ WPPGRLQTVT KGVESLICTD WIRHKFTRSR IPEKVFQASP    50
    EDHEKYGGDP QNPHKLHIVT RIKSTRRRPY WEKDIIKMLG LEKAHTPQVH 100
    KNIPSVNAKL KVVKHLIRIK PLKLPQGLPA EENMSNTCLK STGELVVQWH 150
    LKPVEQKAHE S 161
    Length:161
    Mass (Da):18,546
    Last modified:June 1, 2002 - v1
    Checksum:iE818AD8B8AA7DD23
    GO
    Isoform 2 (identifier: Q8TCC3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MSSTLGKLSNQVEETLPLLKKPLKRAITTLM

    Note: No experimental confirmation available.

    Show »
    Length:191
    Mass (Da):21,839
    Checksum:i98159061F494ABD5
    GO
    Isoform 3 (identifier: Q8TCC3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         119-161: IKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES → FVVSSQLFLKCIA

    Note: No experimental confirmation available.

    Show »
    Length:131
    Mass (Da):15,191
    Checksum:i0CCC141A971552CE
    GO

    Sequence cautioni

    The sequence AAF36169.1 differs from that shown. Reason: Frameshift at positions 1 and 36.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti45 – 451V → A in BAC86542. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti130 – 1301A → T.3 Publications
    Corresponds to variant rs1044575 [ dbSNP | Ensembl ].
    VAR_034462

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MSSTLGKLSNQVEETLPLLK KPLKRAITTLM in isoform 2. 1 PublicationVSP_021746
    Alternative sequencei119 – 16143IKPLK…KAHES → FVVSSQLFLKCIA in isoform 3. 1 PublicationVSP_021747Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF151083 mRNA. Translation: AAF36169.1. Frameshift.
    AK126402 mRNA. Translation: BAC86542.1.
    AC092587 Genomic DNA. Translation: AAX88929.1.
    CH471127 Genomic DNA. Translation: EAX01876.1.
    CH471127 Genomic DNA. Translation: EAX01878.1.
    CH471127 Genomic DNA. Translation: EAX01880.1.
    CH471127 Genomic DNA. Translation: EAX01881.1.
    CH471127 Genomic DNA. Translation: EAX01882.1.
    CH471127 Genomic DNA. Translation: EAX01883.1.
    BC000217 mRNA. Translation: AAH00217.1.
    BC022391 mRNA. Translation: AAH22391.1.
    AB051342 Genomic DNA. Translation: BAB54932.1.
    CCDSiCCDS2041.1. [Q8TCC3-1]
    RefSeqiNP_660213.1. NM_145212.3. [Q8TCC3-1]
    UniGeneiHs.346736.

    Genome annotation databases

    EnsembliENST00000338148; ENSP00000338057; ENSG00000185414. [Q8TCC3-1]
    ENST00000409841; ENSP00000386752; ENSG00000185414. [Q8TCC3-1]
    GeneIDi51263.
    KEGGihsa:51263.
    UCSCiuc002szr.3. human. [Q8TCC3-3]
    uc002szu.3. human. [Q8TCC3-1]

    Polymorphism databases

    DMDMi74730583.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF151083 mRNA. Translation: AAF36169.1 . Frameshift.
    AK126402 mRNA. Translation: BAC86542.1 .
    AC092587 Genomic DNA. Translation: AAX88929.1 .
    CH471127 Genomic DNA. Translation: EAX01876.1 .
    CH471127 Genomic DNA. Translation: EAX01878.1 .
    CH471127 Genomic DNA. Translation: EAX01880.1 .
    CH471127 Genomic DNA. Translation: EAX01881.1 .
    CH471127 Genomic DNA. Translation: EAX01882.1 .
    CH471127 Genomic DNA. Translation: EAX01883.1 .
    BC000217 mRNA. Translation: AAH00217.1 .
    BC022391 mRNA. Translation: AAH22391.1 .
    AB051342 Genomic DNA. Translation: BAB54932.1 .
    CCDSi CCDS2041.1. [Q8TCC3-1 ]
    RefSeqi NP_660213.1. NM_145212.3. [Q8TCC3-1 ]
    UniGenei Hs.346736.

    3D structure databases

    ProteinModelPortali Q8TCC3.
    SMRi Q8TCC3. Positions 65-123.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119417. 4 interactions.
    STRINGi 9606.ENSP00000311103.

    PTM databases

    PhosphoSitei Q8TCC3.

    Polymorphism databases

    DMDMi 74730583.

    Proteomic databases

    MaxQBi Q8TCC3.
    PRIDEi Q8TCC3.

    Protocols and materials databases

    DNASUi 51263.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000338148 ; ENSP00000338057 ; ENSG00000185414 . [Q8TCC3-1 ]
    ENST00000409841 ; ENSP00000386752 ; ENSG00000185414 . [Q8TCC3-1 ]
    GeneIDi 51263.
    KEGGi hsa:51263.
    UCSCi uc002szr.3. human. [Q8TCC3-3 ]
    uc002szu.3. human. [Q8TCC3-1 ]

    Organism-specific databases

    CTDi 51263.
    GeneCardsi GC02P099773.
    H-InvDB HIX0077794.
    HGNCi HGNC:14036. MRPL30.
    HPAi HPA047255.
    MIMi 611838. gene.
    neXtProti NX_Q8TCC3.
    PharmGKBi PA30961.
    GenAtlasi Search...

    Phylogenomic databases

    HOVERGENi HBG082601.
    InParanoidi Q8TCC3.
    KOi K02907.
    OMAi LVVQWHL.
    OrthoDBi EOG7BP841.
    PhylomeDBi Q8TCC3.
    TreeFami TF314611.

    Miscellaneous databases

    ChiTaRSi MRPL30. human.
    GeneWikii MRPL30.
    GenomeRNAii 51263.
    NextBioi 54435.
    PROi Q8TCC3.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8TCC3.
    CleanExi HS_MRPL28.
    HS_MRPL30.
    Genevestigatori Q8TCC3.

    Family and domain databases

    Gene3Di 3.30.1390.20. 1 hit.
    InterProi IPR016082. Ribosomal_L30_ferredoxin-like.
    [Graphical view ]
    Pfami PF00327. Ribosomal_L30. 1 hit.
    [Graphical view ]
    SUPFAMi SSF55129. SSF55129. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
      Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X.
      , Gu J., Chen S.-J., Chen Z.
      Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Umbilical cord blood.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT THR-130.
      Tissue: Uterus.
    3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT THR-130.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-130.
      Tissue: Brain and Kidney.
    6. "The human mitochondrial ribosomal protein genes: mapping of 54 genes to the chromosomes and implications for human disorders."
      Kenmochi N., Suzuki T., Uechi T., Magoori M., Kuniba M., Higa S., Watanabe K., Tanaka T.
      Genomics 77:65-70(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 94-161.
    7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiRM30_HUMAN
    AccessioniPrimary (citable) accession number: Q8TCC3
    Secondary accession number(s): A6NIC6
    , D3DVI0, D3DVI3, Q0D2Q7, Q6ZTP4, Q96Q69, Q9P0N0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 28, 2006
    Last sequence update: June 1, 2002
    Last modified: October 1, 2014
    This is version 103 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. Ribosomal proteins
      Ribosomal proteins families and list of entries
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3