Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8TCC3 (RM30_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 102. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
39S ribosomal protein L30, mitochondrial

Short name=L30mt
Short name=MRP-L30
Alternative name(s):
39S ribosomal protein L28, mitochondrial
Short name=L28mt
Short name=MRP-L28
Gene names
Name:MRPL30
Synonyms:MRPL28, RPML28
ORF Names:HSPC249
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length161 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Subcellular location

Mitochondrion By similarity.

Sequence similarities

Belongs to the ribosomal protein L30P family.

Sequence caution

The sequence AAF36169.1 differs from that shown. Reason: Frameshift at positions 1 and 36.

Ontologies

Keywords
   Cellular componentMitochondrion
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainTransit peptide
   Molecular functionRibonucleoprotein
Ribosomal protein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentmitochondrion

Inferred from electronic annotation. Source: UniProtKB-SubCell

ribosome

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8TCC3-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8TCC3-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSSTLGKLSNQVEETLPLLKKPLKRAITTLM
Note: No experimental confirmation available.
Isoform 3 (identifier: Q8TCC3-3)

The sequence of this isoform differs from the canonical sequence as follows:
     119-161: IKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES → FVVSSQLFLKCIA
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Transit peptide1 – 3434Mitochondrion By similarity
Chain35 – 16112739S ribosomal protein L30, mitochondrial
PRO_0000261649

Natural variations

Alternative sequence11M → MSSTLGKLSNQVEETLPLLK KPLKRAITTLM in isoform 2.
VSP_021746
Alternative sequence119 – 16143IKPLK…KAHES → FVVSSQLFLKCIA in isoform 3.
VSP_021747
Natural variant1301A → T. Ref.2 Ref.4 Ref.5
Corresponds to variant rs1044575 [ dbSNP | Ensembl ].
VAR_034462

Experimental info

Sequence conflict451V → A in BAC86542. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2002. Version 1.
Checksum: E818AD8B8AA7DD23

FASTA16118,546
        10         20         30         40         50         60 
MAGILRLVVQ WPPGRLQTVT KGVESLICTD WIRHKFTRSR IPEKVFQASP EDHEKYGGDP 

        70         80         90        100        110        120 
QNPHKLHIVT RIKSTRRRPY WEKDIIKMLG LEKAHTPQVH KNIPSVNAKL KVVKHLIRIK 

       130        140        150        160 
PLKLPQGLPA EENMSNTCLK STGELVVQWH LKPVEQKAHE S 

« Hide

Isoform 2 [UniParc].

Checksum: 98159061F494ABD5
Show »

FASTA19121,839
Isoform 3 [UniParc].

Checksum: 0CCC141A971552CE
Show »

FASTA13115,191

References

« Hide 'large scale' references
[1]"Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. expand/collapse author list , Gu J., Chen S.-J., Chen Z.
Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Umbilical cord blood.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT THR-130.
Tissue: Uterus.
[3]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT THR-130.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-130.
Tissue: Brain and Kidney.
[6]"The human mitochondrial ribosomal protein genes: mapping of 54 genes to the chromosomes and implications for human disorders."
Kenmochi N., Suzuki T., Uechi T., Magoori M., Kuniba M., Higa S., Watanabe K., Tanaka T.
Genomics 77:65-70(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 94-161.
[7]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF151083 mRNA. Translation: AAF36169.1. Frameshift.
AK126402 mRNA. Translation: BAC86542.1.
AC092587 Genomic DNA. Translation: AAX88929.1.
CH471127 Genomic DNA. Translation: EAX01876.1.
CH471127 Genomic DNA. Translation: EAX01878.1.
CH471127 Genomic DNA. Translation: EAX01880.1.
CH471127 Genomic DNA. Translation: EAX01881.1.
CH471127 Genomic DNA. Translation: EAX01882.1.
CH471127 Genomic DNA. Translation: EAX01883.1.
BC000217 mRNA. Translation: AAH00217.1.
BC022391 mRNA. Translation: AAH22391.1.
AB051342 Genomic DNA. Translation: BAB54932.1.
CCDSCCDS2041.1. [Q8TCC3-1]
RefSeqNP_660213.1. NM_145212.3. [Q8TCC3-1]
UniGeneHs.346736.

3D structure databases

ProteinModelPortalQ8TCC3.
SMRQ8TCC3. Positions 65-123.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119417. 4 interactions.
STRING9606.ENSP00000311103.

PTM databases

PhosphoSiteQ8TCC3.

Polymorphism databases

DMDM74730583.

Proteomic databases

MaxQBQ8TCC3.
PRIDEQ8TCC3.

Protocols and materials databases

DNASU51263.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000338148; ENSP00000338057; ENSG00000185414. [Q8TCC3-1]
ENST00000409841; ENSP00000386752; ENSG00000185414. [Q8TCC3-1]
GeneID51263.
KEGGhsa:51263.
UCSCuc002szr.3. human. [Q8TCC3-3]
uc002szu.3. human. [Q8TCC3-1]

Organism-specific databases

CTD51263.
GeneCardsGC02P099773.
H-InvDBHIX0077794.
HGNCHGNC:14036. MRPL30.
HPAHPA047255.
MIM611838. gene.
neXtProtNX_Q8TCC3.
PharmGKBPA30961.
GenAtlasSearch...

Phylogenomic databases

HOVERGENHBG082601.
InParanoidQ8TCC3.
KOK02907.
OMALVVQWHL.
OrthoDBEOG7BP841.
PhylomeDBQ8TCC3.
TreeFamTF314611.

Gene expression databases

BgeeQ8TCC3.
CleanExHS_MRPL28.
HS_MRPL30.
GenevestigatorQ8TCC3.

Family and domain databases

Gene3D3.30.1390.20. 1 hit.
InterProIPR016082. Ribosomal_L30_ferredoxin-like.
[Graphical view]
PfamPF00327. Ribosomal_L30. 1 hit.
[Graphical view]
SUPFAMSSF55129. SSF55129. 1 hit.
ProtoNetSearch...

Other

ChiTaRSMRPL30. human.
GeneWikiMRPL30.
GenomeRNAi51263.
NextBio54435.
PROQ8TCC3.
SOURCESearch...

Entry information

Entry nameRM30_HUMAN
AccessionPrimary (citable) accession number: Q8TCC3
Secondary accession number(s): A6NIC6 expand/collapse secondary AC list , D3DVI0, D3DVI3, Q0D2Q7, Q6ZTP4, Q96Q69, Q9P0N0
Entry history
Integrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: June 1, 2002
Last modified: July 9, 2014
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Ribosomal proteins

Ribosomal proteins families and list of entries

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM