Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable E3 ubiquitin-protein ligase RNF217

Gene

RNF217

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.By similarity

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri263 – 30846RING-type; degenerateAdd
BLAST
Zinc fingeri338 – 39659IBR-type 1Add
BLAST
Zinc fingeri416 – 45742IBR-type 2Add
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.
UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
Probable E3 ubiquitin-protein ligase RNF217 (EC:6.3.2.-)
Alternative name(s):
IBR domain-containing protein 1
RING finger protein 217
Gene namesi
Name:RNF217
Synonyms:C6orf172, IBRDC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:21487. RNF217.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei503 – 52321HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162401868.

Polymorphism and mutation databases

DMDMi313104196.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 542542Probable E3 ubiquitin-protein ligase RNF217PRO_0000084128Add
BLAST

Proteomic databases

MaxQBiQ8TC41.
PaxDbiQ8TC41.
PRIDEiQ8TC41.

PTM databases

iPTMnetiQ8TC41.
PhosphoSiteiQ8TC41.

Expressioni

Gene expression databases

BgeeiQ8TC41.
CleanExiHS_RNF217.
ExpressionAtlasiQ8TC41. baseline and differential.
GenevisibleiQ8TC41. HS.

Organism-specific databases

HPAiHPA029598.

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi127540. 6 interactions.
STRINGi9606.ENSP00000352734.

Structurei

3D structure databases

ProteinModelPortaliQ8TC41.
SMRiQ8TC41. Positions 263-465.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the RBR family. RNF217 subfamily.Curated
Contains 2 IBR-type zinc fingers.Curated
Contains 1 RING-type zinc finger.Curated

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri263 – 30846RING-type; degenerateAdd
BLAST
Zinc fingeri338 – 39659IBR-type 1Add
BLAST
Zinc fingeri416 – 45742IBR-type 2Add
BLAST

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix, Zinc-finger

Phylogenomic databases

eggNOGiKOG1815. Eukaryota.
ENOG410XP9Y. LUCA.
GeneTreeiENSGT00730000111285.
HOVERGENiHBG096781.
InParanoidiQ8TC41.
KOiK11977.
OrthoDBiEOG7Z0JW7.
TreeFamiTF330860.

Family and domain databases

InterProiIPR031127. E3_UB_ligase_RBR.
IPR002867. IBR_dom.
[Graphical view]
PANTHERiPTHR11685. PTHR11685. 2 hits.
PfamiPF01485. IBR. 2 hits.
[Graphical view]
SMARTiSM00647. IBR. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TC41-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGEEQSTVSG GGGPQESQTL ASGTAGHPEP PRPQGDSARA PPLRAASAEP
60 70 80 90 100
SGGGCGSDWG CADTSAPEPA RSLGPPGWSK SRAPAQPAGL ALTGPLNPQT
110 120 130 140 150
LPLQLELEEE EEEAGDRKEG GDEQQEAPPG EELEPRTRVG AADGLVLDVL
160 170 180 190 200
GQRRPSLAKR QVFCSVYCVE SDLPEAPASE QLSPPASPPG APPVLNPPST
210 220 230 240 250
RSSFPSPRLS LPTDSLSPDG GSIELEFYLA PEPFSMPSLL GAPPYSGLGG
260 270 280 290 300
VGDPYVPLMV LMCRVCLEDK PIKPLPCCKK AVCEECLKVY LSAQVQLGQV
310 320 330 340 350
EIKCPITECF EFLEETTVVY NLTHEDSIKY KYFLELGRID SSTKPCPQCK
360 370 380 390 400
HFTTFKKKGH IPTPSRSESK YKIQCPTCQF VWCFKCHSPW HEGVNCKEYK
410 420 430 440 450
KGDKLLRHWA SEIEHGQRNA QKCPKCKIHI QRTEGCDHMT CSQCNTNFCY
460 470 480 490 500
RCGERYRQLR FFGDHTSNLS IFGCKYRYLP ERPHLRRLVR GSVCAGKLFI
510 520 530 540
APLIMVLGLA LGAIAVVIGL FVFPIYCLCK KQRKRSRTGM HW
Note: No experimental confirmation available. Gene prediction based on partial mRNA and EST data.
Length:542
Mass (Da):59,372
Last modified:May 14, 2014 - v4
Checksum:i99A463D91873CC6E
GO
Isoform 2 (identifier: Q8TC41-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-294: MGEEQSTVSG...ECLKVYLSAQ → MK
     519-542: GLFVFPIYCLCKKQRKRSRTGMHW → VEEIKTYWNLISGRTRNQTQHLAPQPVLLSDMLYCLKQVFICISYLLPL

Note: No experimental confirmation available.
Show »
Length:275
Mass (Da):31,981
Checksum:i8F783A7973859456
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti381 – 3811V → I.
Corresponds to variant rs475076 [ dbSNP | Ensembl ].
VAR_024160

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 294294MGEEQ…YLSAQ → MK in isoform 2. 1 PublicationVSP_054705Add
BLAST
Alternative sequencei519 – 54224GLFVF…TGMHW → VEEIKTYWNLISGRTRNQTQ HLAPQPVLLSDMLYCLKQVF ICISYLLPL in isoform 2. 1 PublicationVSP_054706Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136128 Genomic DNA. Translation: CAC36346.1.
AL136128 Genomic DNA. Translation: CAI22999.1.
AL355296 Genomic DNA. No translation available.
BC026087 mRNA. Translation: AAH26087.1.
CCDSiCCDS5129.1. [Q8TC41-2]
CCDS69191.1. [Q8TC41-1]
RefSeqiNP_001273327.1. NM_001286398.2. [Q8TC41-1]
NP_689766.1. NM_152553.4. [Q8TC41-2]
UniGeneiHs.368639.
Hs.656715.

Genome annotation databases

EnsembliENST00000359704; ENSP00000352734; ENSG00000146373. [Q8TC41-2]
ENST00000521654; ENSP00000428698; ENSG00000146373. [Q8TC41-1]
GeneIDi154214.
KEGGihsa:154214.
UCSCiuc003pzr.5. human. [Q8TC41-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136128 Genomic DNA. Translation: CAC36346.1.
AL136128 Genomic DNA. Translation: CAI22999.1.
AL355296 Genomic DNA. No translation available.
BC026087 mRNA. Translation: AAH26087.1.
CCDSiCCDS5129.1. [Q8TC41-2]
CCDS69191.1. [Q8TC41-1]
RefSeqiNP_001273327.1. NM_001286398.2. [Q8TC41-1]
NP_689766.1. NM_152553.4. [Q8TC41-2]
UniGeneiHs.368639.
Hs.656715.

3D structure databases

ProteinModelPortaliQ8TC41.
SMRiQ8TC41. Positions 263-465.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127540. 6 interactions.
STRINGi9606.ENSP00000352734.

PTM databases

iPTMnetiQ8TC41.
PhosphoSiteiQ8TC41.

Polymorphism and mutation databases

DMDMi313104196.

Proteomic databases

MaxQBiQ8TC41.
PaxDbiQ8TC41.
PRIDEiQ8TC41.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000359704; ENSP00000352734; ENSG00000146373. [Q8TC41-2]
ENST00000521654; ENSP00000428698; ENSG00000146373. [Q8TC41-1]
GeneIDi154214.
KEGGihsa:154214.
UCSCiuc003pzr.5. human. [Q8TC41-1]

Organism-specific databases

CTDi154214.
GeneCardsiRNF217.
HGNCiHGNC:21487. RNF217.
HPAiHPA029598.
neXtProtiNX_Q8TC41.
PharmGKBiPA162401868.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1815. Eukaryota.
ENOG410XP9Y. LUCA.
GeneTreeiENSGT00730000111285.
HOVERGENiHBG096781.
InParanoidiQ8TC41.
KOiK11977.
OrthoDBiEOG7Z0JW7.
TreeFamiTF330860.

Enzyme and pathway databases

UniPathwayiUPA00143.
ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.

Miscellaneous databases

ChiTaRSiRNF217. human.
GenomeRNAii154214.
PROiQ8TC41.

Gene expression databases

BgeeiQ8TC41.
CleanExiHS_RNF217.
ExpressionAtlasiQ8TC41. baseline and differential.
GenevisibleiQ8TC41. HS.

Family and domain databases

InterProiIPR031127. E3_UB_ligase_RBR.
IPR002867. IBR_dom.
[Graphical view]
PANTHERiPTHR11685. PTHR11685. 2 hits.
PfamiPF01485. IBR. 2 hits.
[Graphical view]
SMARTiSM00647. IBR. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.

Entry informationi

Entry nameiRN217_HUMAN
AccessioniPrimary (citable) accession number: Q8TC41
Secondary accession number(s): H7C5V4, Q5TCA4, Q9BX48
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 4, 2005
Last sequence update: May 14, 2014
Last modified: July 6, 2016
This is version 110 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.