Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cancer-associated gene 1 protein

Gene

CAGE1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Cancer-associated gene 1 protein
Short name:
CAGE-1
Alternative name(s):
Cancer/testis antigen 3
Short name:
CT3
Gene namesi
Name:CAGE1
Synonyms:CTAG3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:21622. CAGE1.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134933951.

Polymorphism and mutation databases

BioMutaiCAGE1.
DMDMi134035395.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 777777Cancer-associated gene 1 proteinPRO_0000280750Add
BLAST

Proteomic databases

PeptideAtlasiQ8TC20.
PRIDEiQ8TC20.

PTM databases

iPTMnetiQ8TC20.
PhosphoSiteiQ8TC20.

Expressioni

Tissue specificityi

Testis-specific expression in normal tissues, but wide expression among cancer tissues and cell lines.

Gene expression databases

BgeeiENSG00000164304.
ExpressionAtlasiQ8TC20. baseline and differential.
GenevisibleiQ8TC20. HS.

Organism-specific databases

HPAiHPA029830.
HPA029831.
HPA029832.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
DKFZp451B226Q5HYH73EBI-10196469,EBI-10173842
HAUS1Q96CS23EBI-10196469,EBI-2514791
MPPED2Q157773EBI-10196469,EBI-2350461
MRFAP1L1Q96HT83EBI-10196469,EBI-748896
TBC1D23Q9NUY83EBI-10196469,EBI-2853126
TBC1D23Q9NUY8-23EBI-10196469,EBI-10314276
TPM1P094933EBI-10196469,EBI-351158

Protein-protein interaction databases

BioGridi130213. 7 interactions.
IntActiQ8TC20. 6 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ8TC20.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili303 – 560258Sequence analysisAdd
BLAST

Keywords - Domaini

Coiled coil

Phylogenomic databases

GeneTreeiENSGT00390000001805.
HOGENOMiHOG000000676.
HOVERGENiHBG080983.
InParanoidiQ8TC20.
OMAiESKEDHC.
OrthoDBiEOG091G04HS.
PhylomeDBiQ8TC20.
TreeFamiTF337775.

Family and domain databases

InterProiIPR029381. CAGE1.
[Graphical view]
PfamiPF15066. CAGE1. 2 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TC20-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNKDYQKFWS SPSDPVHFEV DTSHEKVESM SESDTMNVSN LSQGVMLSHS
60 70 80 90 100
PICMETTGTT CDLPQNEIKN FERENEYEST LCEDAYGTLD NLLNDNNIEN
110 120 130 140 150
YSTNALIQPV DTISISSLRQ FETVCKFHWV EAFDDEMTEK PEFQSQVYNY
160 170 180 190 200
AKDNNIKQDS FKEENPMETS VSANTDQLGN EYFRQPPPRS PPLIHCSGEM
210 220 230 240 250
LKFTEKSLAK SIAKESALNP SQPPSFLCKT AVPSKEIQNY GEIPEMSVSY
260 270 280 290 300
EKEVTAEGVE RPEIVSTWSS AGISWRSEAC RENCEMPDWE QSAESLQPVQ
310 320 330 340 350
EDMALNEVLQ KLKHTNRKQE VRIQELQCSN LYLEKRVKEL QMKITKQQVF
360 370 380 390 400
IDVINKLKEN VEELIEDKYK IILEKNDTKK TLQNLEEVLA NTQKHLQESR
410 420 430 440 450
NDKEMLQLQF KKIKANYVCL QERYMTEMQQ KNKSVSQYLE MDKTLSKKEE
460 470 480 490 500
EVERLQQLKK ELEKATASAL DLLKREKEAQ EQEFLSLQEE FQKLEKENLE
510 520 530 540 550
ERQKLKSRLE KLLTQVRNLQ FMSENERTKN IKLQQQINEV KNENAKLKQQ
560 570 580 590 600
VARSEEQNYV PKFETAQLKD QLEEVLKSDI TKDTKTTHSN LLPDCSPCEE
610 620 630 640 650
RLNPADIKRA SQLASKMHSL LALMVGLLTC QDIINSDAEH FKESEKVSDI
660 670 680 690 700
MLQKLKSLHL KKKTLDKEVI DCDSDEAKSI RDVPTLLGAK LDKYHSLNEE
710 720 730 740 750
LDFLVTSYEE IIECADQRLA ISHSQIAHLE ERNKHLEDLI RKPREKARKP
760 770
RSKSLENHPK SMTMMPALFK ENRNDLD
Length:777
Mass (Da):90,250
Last modified:March 20, 2007 - v2
Checksum:iF69E220ADD5572EA
GO
Isoform 2 (identifier: Q8TC20-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-136: Missing.

Show »
Length:641
Mass (Da):74,693
Checksum:iD3F479E4294C1B0A
GO
Isoform 3 (identifier: Q8TC20-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     668-668: E → ELLKHKDRITTFRELIAKEKAFQDHAIK
     765-777: MPALFKENRNDLD → LAYNLYIFIGYRLGAVADACNPSTLGGRGGWIT

Show »
Length:824
Mass (Da):95,424
Checksum:i9AA090C11DEF4A08
GO
Isoform 4 (identifier: Q8TC20-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     669-777: VIDCDSDEAK...LFKENRNDLD → LLKHKDRITTFRELIAKEKAFQDHAIKVFQGV

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:700
Mass (Da):81,361
Checksum:iA2B72A74D31C8F44
GO
Isoform 5 (identifier: Q8TC20-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     668-668: E → ELLKHKDRITTFRELIAKEKAFQDHAIK
     704-704: L → LITKLGHLLESKENHCNRLIEENDKYQRHLGNLIKK

Note: Gene prediction based on EST data.
Show »
Length:839
Mass (Da):97,651
Checksum:i06494A9EE2297C37
GO

Sequence cautioni

The sequence CAI16451 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti20 – 201V → A in BAC05162 (PubMed:14702039).Curated
Sequence conflicti196 – 1961C → R in BAC05162 (PubMed:14702039).Curated
Sequence conflicti596 – 5961S → P in BAC05162 (PubMed:14702039).Curated
Sequence conflicti667 – 6671K → E in BAC05162 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti169 – 1691T → I.
Corresponds to variant rs10223538 [ dbSNP | Ensembl ].
VAR_031200
Natural varianti282 – 2821E → A.
Corresponds to variant rs2876098 [ dbSNP | Ensembl ].
VAR_031201

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 136136Missing in isoform 2. 1 PublicationVSP_023902Add
BLAST
Alternative sequencei668 – 6681E → ELLKHKDRITTFRELIAKEK AFQDHAIK in isoform 3 and isoform 5. 1 PublicationVSP_023969
Alternative sequencei669 – 777109VIDCD…RNDLD → LLKHKDRITTFRELIAKEKA FQDHAIKVFQGV in isoform 4. 1 PublicationVSP_023971Add
BLAST
Alternative sequencei704 – 7041L → LITKLGHLLESKENHCNRLI EENDKYQRHLGNLIKK in isoform 5. CuratedVSP_047149
Alternative sequencei765 – 77713MPALF…RNDLD → LAYNLYIFIGYRLGAVADAC NPSTLGGRGGWIT in isoform 3. 1 PublicationVSP_023970Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF414185 mRNA. Translation: AAO47239.1.
AK097760 mRNA. Translation: BAC05162.1.
AL139095 Genomic DNA. Translation: CAI16451.1. Sequence problems.
BC026194 mRNA. Translation: AAH26194.1.
BC033545 mRNA. Translation: AAH33545.1.
CCDSiCCDS47367.1. [Q8TC20-2]
CCDS54964.1. [Q8TC20-3]
CCDS54965.1. [Q8TC20-5]
RefSeqiNP_001164163.1. NM_001170692.1. [Q8TC20-5]
NP_001164164.1. NM_001170693.1. [Q8TC20-3]
NP_995586.1. NM_205864.2. [Q8TC20-2]
UniGeneiHs.721486.

Genome annotation databases

EnsembliENST00000296742; ENSP00000296742; ENSG00000164304. [Q8TC20-2]
ENST00000338150; ENSP00000338107; ENSG00000164304. [Q8TC20-3]
ENST00000458291; ENSP00000390644; ENSG00000164304. [Q8TC20-4]
ENST00000502583; ENSP00000425493; ENSG00000164304. [Q8TC20-5]
ENST00000512086; ENSP00000427583; ENSG00000164304. [Q8TC20-1]
GeneIDi285782.
KEGGihsa:285782.
UCSCiuc063lrc.1. human. [Q8TC20-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF414185 mRNA. Translation: AAO47239.1.
AK097760 mRNA. Translation: BAC05162.1.
AL139095 Genomic DNA. Translation: CAI16451.1. Sequence problems.
BC026194 mRNA. Translation: AAH26194.1.
BC033545 mRNA. Translation: AAH33545.1.
CCDSiCCDS47367.1. [Q8TC20-2]
CCDS54964.1. [Q8TC20-3]
CCDS54965.1. [Q8TC20-5]
RefSeqiNP_001164163.1. NM_001170692.1. [Q8TC20-5]
NP_001164164.1. NM_001170693.1. [Q8TC20-3]
NP_995586.1. NM_205864.2. [Q8TC20-2]
UniGeneiHs.721486.

3D structure databases

ProteinModelPortaliQ8TC20.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi130213. 7 interactions.
IntActiQ8TC20. 6 interactions.

PTM databases

iPTMnetiQ8TC20.
PhosphoSiteiQ8TC20.

Polymorphism and mutation databases

BioMutaiCAGE1.
DMDMi134035395.

Proteomic databases

PeptideAtlasiQ8TC20.
PRIDEiQ8TC20.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000296742; ENSP00000296742; ENSG00000164304. [Q8TC20-2]
ENST00000338150; ENSP00000338107; ENSG00000164304. [Q8TC20-3]
ENST00000458291; ENSP00000390644; ENSG00000164304. [Q8TC20-4]
ENST00000502583; ENSP00000425493; ENSG00000164304. [Q8TC20-5]
ENST00000512086; ENSP00000427583; ENSG00000164304. [Q8TC20-1]
GeneIDi285782.
KEGGihsa:285782.
UCSCiuc063lrc.1. human. [Q8TC20-1]

Organism-specific databases

CTDi285782.
GeneCardsiCAGE1.
HGNCiHGNC:21622. CAGE1.
HPAiHPA029830.
HPA029831.
HPA029832.
MIMi608304. gene.
neXtProtiNX_Q8TC20.
PharmGKBiPA134933951.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000001805.
HOGENOMiHOG000000676.
HOVERGENiHBG080983.
InParanoidiQ8TC20.
OMAiESKEDHC.
OrthoDBiEOG091G04HS.
PhylomeDBiQ8TC20.
TreeFamiTF337775.

Miscellaneous databases

GenomeRNAii285782.
PROiQ8TC20.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000164304.
ExpressionAtlasiQ8TC20. baseline and differential.
GenevisibleiQ8TC20. HS.

Family and domain databases

InterProiIPR029381. CAGE1.
[Graphical view]
PfamiPF15066. CAGE1. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCAGE1_HUMAN
AccessioniPrimary (citable) accession number: Q8TC20
Secondary accession number(s): D6RCT9
, Q5TAM0, Q86TM4, Q8N7R5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 20, 2007
Last modified: September 7, 2016
This is version 106 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.