Reviewed,
UniProtKB/Swiss-Prot Q8TC20 (CAGE1_HUMAN)
Last modified
May 5, 2009.
Version 47.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Cancer-associated gene 1 protein Short name=CAGE-1 Alternative name(s): Cancer/testis antigen 3 Short name=CT3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 777 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Tissue specificity | Testis-specific expression in normal tissues, but wide expression among cancer tissues and cell lines. |
| Sequence caution | The sequence CAI16451.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8TC20-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8TC20-2) The sequence of this isoform differs from the canonical sequence as follows: 1-136: Missing. | ||||||
| Isoform 3 (identifier: Q8TC20-3) The sequence of this isoform differs from the canonical sequence as follows: 668-668: E → ELLKHKDRITTFRELIAKEKAFQDHAIK 765-777: MPALFKENRNDLD → LAYNLYIFIGYRLGAVADACNPSTLGGRGGWIT | ||||||
| Isoform 4 (identifier: Q8TC20-4) The sequence of this isoform differs from the canonical sequence as follows: 669-777: VIDCDSDEAK...LFKENRNDLD → LLKHKDRITTFRELIAKEKAFQDHAIKVFQGV | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 777 | 777 | Cancer-associated gene 1 protein | PRO_0000280750 | |||||
Regions | |||||||||
| Coiled coil | 303 – 560 | 258 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 136 | 136 | Missing in isoform 2. | VSP_023902 | |||||
| Alternative sequence | 668 | 1 | E → ELLKHKDRITTFRELIAKEK AFQDHAIK in isoform 3. | VSP_023969 | |||||
| Alternative sequence | 669 – 777 | 109 | VIDCD…RNDLD → LLKHKDRITTFRELIAKEKA FQDHAIKVFQGV in isoform 4. | VSP_023971 | |||||
| Alternative sequence | 765 – 777 | 13 | MPALF…RNDLD → LAYNLYIFIGYRLGAVADAC NPSTLGGRGGWIT in isoform 3. | VSP_023970 | |||||
| Natural variant | 169 | 1 | T → I: dbSNP rs10223538. | VAR_031200 | |||||
| Natural variant | 282 | 1 | E → A: dbSNP rs2876098. | VAR_031201 | |||||
Experimental info | |||||||||
| Sequence conflict | 20 | 1 | V → A in BAC05162. Ref.2 | ||||||
| Sequence conflict | 196 | 1 | C → R in BAC05162. Ref.2 | ||||||
| Sequence conflict | 596 | 1 | S → P in BAC05162. Ref.2 | ||||||
| Sequence conflict | 667 | 1 | K → E in BAC05162. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| AF414185 mRNA. Translation: AAO47239.1. AK097760 mRNA. Translation: BAC05162.1. AL139095 Genomic DNA. Translation: CAI16451.1. Sequence problems. BC026194 mRNA. Translation: AAH26194.1. BC033545 mRNA. Translation: AAH33545.1. | |
| IPI | IPI00175214. IPI00479345. IPI00514516. IPI00830133. |
| RefSeq | NP_995586.1. |
| UniGene | Hs.715151 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1NKP based on UniProtKB P01106. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q8TC20. |
Genome annotation databases | |
| GeneID | 285782. |
| KEGG | hsa:285782. |
Organism-specific databases | |
| GeneCards | GC06M007273. |
| HGNC | HGNC:21622. CAGE1. |
| MIM | 608304. gene. |
| PharmGKB | PA134933951. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q8TC20. |
Family and domain databases | |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 95779. |
| SOURCE | Search... |
Entry information
| Entry name | CAGE1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8TC20 Secondary accession number(s): Q5TAM0, Q86TM4, Q8N7R5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with


