Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable RNA-binding protein 46

Gene

RBM46

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Probable RNA-binding protein 46
Alternative name(s):
Cancer/testis antigen 68
Short name:
CT68
RNA-binding motif protein 46
Gene namesi
Name:RBM46
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:28401. RBM46.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162400810.

Polymorphism and mutation databases

DMDMi74760436.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 533533Probable RNA-binding protein 46PRO_0000305315Add
BLAST

Proteomic databases

EPDiQ8TBY0.
MaxQBiQ8TBY0.
PaxDbiQ8TBY0.
PeptideAtlasiQ8TBY0.
PRIDEiQ8TBY0.

PTM databases

iPTMnetiQ8TBY0.
PhosphoSiteiQ8TBY0.

Expressioni

Gene expression databases

BgeeiQ8TBY0.
CleanExiHS_RBM46.
ExpressionAtlasiQ8TBY0. baseline and differential.
GenevisibleiQ8TBY0. HS.

Organism-specific databases

HPAiHPA050601.

Interactioni

Protein-protein interaction databases

BioGridi127937. 2 interactions.
STRINGi9606.ENSP00000281722.

Structurei

3D structure databases

ProteinModelPortaliQ8TBY0.
SMRiQ8TBY0. Positions 62-314.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini61 – 13979RRM 1PROSITE-ProRule annotationAdd
BLAST
Domaini141 – 22383RRM 2PROSITE-ProRule annotationAdd
BLAST
Domaini236 – 30873RRM 3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 3 RRM (RNA recognition motif) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0117. Eukaryota.
ENOG410XTJ5. LUCA.
GeneTreeiENSGT00550000074366.
HOGENOMiHOG000186083.
HOVERGENiHBG051917.
InParanoidiQ8TBY0.
OMAiKENTWRQ.
OrthoDBiEOG73JKW2.
PhylomeDBiQ8TBY0.
TreeFamiTF314932.

Family and domain databases

Gene3Di3.30.70.330. 2 hits.
InterProiIPR006535. HnRNP_R/Q_splicing_fac.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 3 hits.
[Graphical view]
SMARTiSM00360. RRM. 3 hits.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 3 hits.
TIGRFAMsiTIGR01648. hnRNP-R-Q. 1 hit.
PROSITEiPS50102. RRM. 3 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TBY0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNEENIDGTN GCSKVRTGIQ NEAALLALME KTGYNMVQEN GQRKFGGPPP
60 70 80 90 100
GWEGPPPPRG CEVFVGKIPR DMYEDELVPV FERAGKIYEF RLMMEFSGEN
110 120 130 140 150
RGYAFVMYTT KEEAQLAIRI LNNYEIRPGK FIGVCVSLDN CRLFIGAIPK
160 170 180 190 200
EKKKEEILDE MKKVTEGVVD VIVYPSATDK TKNRGFAFVE YESHRAAAMA
210 220 230 240 250
RRKLIPGTFQ LWGHTIQVDW ADPEKEVDEE TMQRVKVLYV RNLMISTTEE
260 270 280 290 300
TIKAEFNKFK PGAVERVKKL RDYAFVHFFN REDAVAAMSV MNGKCIDGAS
310 320 330 340 350
IEVTLAKPVN KENTWRQHLN GQISPNSENL IVFANKEESH PKTLGKLPTL
360 370 380 390 400
PARLNGQHSP SPPEVERCTY PFYPGTKLTP ISMYSLKSNH FNSAVMHLDY
410 420 430 440 450
YCNKNNWAPP EYYLYSTTSQ DGKVLLVYKI VIPAIANGSQ SYFMPDKLCT
460 470 480 490 500
TLEDAKELAA QFTLLHLDYN FHRSSINSLS PVSATLSSGT PSVLPYTSRP
510 520 530
YSYPGYPLSP TISLANGSHV GQRLCISNQA SFF
Length:533
Mass (Da):60,023
Last modified:June 1, 2002 - v1
Checksum:iA466A5AA76CD8BBE
GO
Isoform 2 (identifier: Q8TBY0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     468-533: DYNFHRSSINSLSPVSATLSSGTPSVLPYTSRPYSYPGYPLSPTISLANGSHVGQRLCISNQASFF → GPF

Note: No experimental confirmation available.
Show »
Length:470
Mass (Da):53,245
Checksum:i45A7F3761F83B486
GO
Isoform 3 (identifier: Q8TBY0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     469-533: YNFHRSSINS...LCISNQASFF → REHNLFSLDLCRRIWRK

Note: No experimental confirmation available.
Show »
Length:485
Mass (Da):55,283
Checksum:i283D315FC6E062A9
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei468 – 53366DYNFH…QASFF → GPF in isoform 2. 1 PublicationVSP_055251Add
BLAST
Alternative sequencei469 – 53365YNFHR…QASFF → REHNLFSLDLCRRIWRK in isoform 3. 1 PublicationVSP_055252Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK125877 mRNA. Translation: BAG54260.1.
AK302720 mRNA. Translation: BAG63939.1.
AC009567 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04902.1.
CH471056 Genomic DNA. Translation: EAX04903.1.
BC028588 mRNA. Translation: AAH28588.1.
CCDSiCCDS3790.1. [Q8TBY0-1]
CCDS64085.1. [Q8TBY0-3]
CCDS64086.1. [Q8TBY0-2]
RefSeqiNP_001264100.1. NM_001277171.1. [Q8TBY0-3]
NP_001264102.1. NM_001277173.1. [Q8TBY0-2]
NP_659416.1. NM_144979.4. [Q8TBY0-1]
XP_006714182.1. XM_006714119.2. [Q8TBY0-3]
XP_006714183.1. XM_006714120.1. [Q8TBY0-2]
XP_011529994.1. XM_011531692.1. [Q8TBY0-1]
XP_011529995.1. XM_011531693.1. [Q8TBY0-1]
XP_011529996.1. XM_011531694.1. [Q8TBY0-1]
XP_011529997.1. XM_011531695.1. [Q8TBY0-1]
XP_011529998.1. XM_011531696.1. [Q8TBY0-1]
UniGeneiHs.133095.
Hs.745556.

Genome annotation databases

EnsembliENST00000281722; ENSP00000281722; ENSG00000151962. [Q8TBY0-1]
ENST00000510397; ENSP00000422813; ENSG00000151962. [Q8TBY0-2]
ENST00000514866; ENSP00000424500; ENSG00000151962. [Q8TBY0-3]
GeneIDi166863.
KEGGihsa:166863.
UCSCiuc003ioo.5. human. [Q8TBY0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK125877 mRNA. Translation: BAG54260.1.
AK302720 mRNA. Translation: BAG63939.1.
AC009567 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04902.1.
CH471056 Genomic DNA. Translation: EAX04903.1.
BC028588 mRNA. Translation: AAH28588.1.
CCDSiCCDS3790.1. [Q8TBY0-1]
CCDS64085.1. [Q8TBY0-3]
CCDS64086.1. [Q8TBY0-2]
RefSeqiNP_001264100.1. NM_001277171.1. [Q8TBY0-3]
NP_001264102.1. NM_001277173.1. [Q8TBY0-2]
NP_659416.1. NM_144979.4. [Q8TBY0-1]
XP_006714182.1. XM_006714119.2. [Q8TBY0-3]
XP_006714183.1. XM_006714120.1. [Q8TBY0-2]
XP_011529994.1. XM_011531692.1. [Q8TBY0-1]
XP_011529995.1. XM_011531693.1. [Q8TBY0-1]
XP_011529996.1. XM_011531694.1. [Q8TBY0-1]
XP_011529997.1. XM_011531695.1. [Q8TBY0-1]
XP_011529998.1. XM_011531696.1. [Q8TBY0-1]
UniGeneiHs.133095.
Hs.745556.

3D structure databases

ProteinModelPortaliQ8TBY0.
SMRiQ8TBY0. Positions 62-314.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127937. 2 interactions.
STRINGi9606.ENSP00000281722.

PTM databases

iPTMnetiQ8TBY0.
PhosphoSiteiQ8TBY0.

Polymorphism and mutation databases

DMDMi74760436.

Proteomic databases

EPDiQ8TBY0.
MaxQBiQ8TBY0.
PaxDbiQ8TBY0.
PeptideAtlasiQ8TBY0.
PRIDEiQ8TBY0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000281722; ENSP00000281722; ENSG00000151962. [Q8TBY0-1]
ENST00000510397; ENSP00000422813; ENSG00000151962. [Q8TBY0-2]
ENST00000514866; ENSP00000424500; ENSG00000151962. [Q8TBY0-3]
GeneIDi166863.
KEGGihsa:166863.
UCSCiuc003ioo.5. human. [Q8TBY0-1]

Organism-specific databases

CTDi166863.
GeneCardsiRBM46.
HGNCiHGNC:28401. RBM46.
HPAiHPA050601.
neXtProtiNX_Q8TBY0.
PharmGKBiPA162400810.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0117. Eukaryota.
ENOG410XTJ5. LUCA.
GeneTreeiENSGT00550000074366.
HOGENOMiHOG000186083.
HOVERGENiHBG051917.
InParanoidiQ8TBY0.
OMAiKENTWRQ.
OrthoDBiEOG73JKW2.
PhylomeDBiQ8TBY0.
TreeFamiTF314932.

Miscellaneous databases

GenomeRNAii166863.
PROiQ8TBY0.

Gene expression databases

BgeeiQ8TBY0.
CleanExiHS_RBM46.
ExpressionAtlasiQ8TBY0. baseline and differential.
GenevisibleiQ8TBY0. HS.

Family and domain databases

Gene3Di3.30.70.330. 2 hits.
InterProiIPR006535. HnRNP_R/Q_splicing_fac.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 3 hits.
[Graphical view]
SMARTiSM00360. RRM. 3 hits.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 3 hits.
TIGRFAMsiTIGR01648. hnRNP-R-Q. 1 hit.
PROSITEiPS50102. RRM. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Testis.
  2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.

Entry informationi

Entry nameiRBM46_HUMAN
AccessioniPrimary (citable) accession number: Q8TBY0
Secondary accession number(s): B3KWU8, B4DZ27
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: June 1, 2002
Last modified: July 6, 2016
This is version 122 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.