Q8TBN0 (R3GEF_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 66.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Guanine nucleotide exchange factor for Rab-3A Alternative name(s): Rab-3A-interacting-like protein 1 Short name=Rab3A-interacting-like protein 1 Rabin3-like 1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 382 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Guanine nucleotide exchange factor (GEF) for Rab3A, a GTPase that regulates synaptic vesicle exocytosis By similarity. |
| Subunit structure | Interacts with Rab3A and IHPK1 through the coiled coil domain. This interaction is competitive. IHPK1 kinase activity is not required for this interaction By similarity. |
| Sequence similarities | Belongs to the SEC2 family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| Molecular function | Guanine-nucleotide releasing factor |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| NUDT18 | Q6ZVK8 | 3 | EBI-743796,EBI-740486 | |
| RAB3IP | Q96QF0 | 3 | EBI-743796,EBI-747844 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8TBN0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8TBN0-2) The sequence of this isoform differs from the canonical sequence as follows: 1-4: MWSG → MDSSEEHAGCPARGTCPVFLAMSAGTVRYAPSGLCPVLEGNLREEPWGTDS 147-219: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 382 | 382 | Guanine nucleotide exchange factor for Rab-3A | PRO_0000305295 | |||||
Regions | |||||||||
| Coiled coil | 73 – 161 | 89 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 4 | 4 | MWSG → MDSSEEHAGCPARGTCPVFL AMSAGTVRYAPSGLCPVLEG NLREEPWGTDS in isoform 2. | VSP_028344 | |||||
| Alternative sequence | 147 – 219 | 73 | Missing in isoform 2. | VSP_028345 | |||||
| Natural variant | 49 | 1 | Q → R. Corresponds to variant rs174477 [ dbSNP | Ensembl ]. | VAR_035203 | |||||
| Natural variant | 323 | 1 | H → Y. Corresponds to variant rs3815045 [ dbSNP | Ensembl ]. | VAR_035204 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Bone and Colon. |
| [2] | "Genomic characterization of eight novel genes from within the former Best's disease candidate region in 11q12-q13.1." Marquardt A., Stoehr H., Passmore L.A., Kraemer F., Rivera A., Weber B.H.F. Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 69-382 (ISOFORM 1). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | BC022239 mRNA. Translation: AAH22239.1. BC051820 mRNA. Translation: AAH51820.1. AF084557 mRNA. Translation: AAF28399.1. |
| IPI | IPI00328884. IPI00384251. |
| RefSeq | NP_037533.2. NM_013401.2. |
| UniGene | Hs.13759. |
3D structure databases | |
| ProteinModelPortal | Q8TBN0. |
| SMR | Q8TBN0. Positions 18-164. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8TBN0. 6 interactions. |
| MINT | MINT-1434578. |
| STRING | Q8TBN0. |
PTM databases | |
| PhosphoSite | Q8TBN0. |
Polymorphism databases | |
| DMDM | 74730489. |
Proteomic databases | |
| PRIDE | Q8TBN0. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000335219; ENSP00000334416; ENSG00000167994. |
| GeneID | 5866. |
| KEGG | hsa:5866. |
| UCSC | uc001nso.1. human. uc001nsp.1. human. |
Organism-specific databases | |
| CTD | 5866. |
| GeneCards | GC11M061664. |
| HGNC | HGNC:9780. RAB3IL1. |
| HPA | HPA039723. |
| neXtProt | NX_Q8TBN0. |
| PharmGKB | PA34135. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG10367. |
| GeneTree | ENSGT00390000009036. |
| HOVERGEN | HBG057034. |
| PhylomeDB | Q8TBN0. |
Gene expression databases | |
| ArrayExpress | Q8TBN0. |
| Bgee | Q8TBN0. |
| CleanEx | HS_RAB3IL1. |
| Genevestigator | Q8TBN0. |
Family and domain databases | |
| InterPro | IPR009449. Sec2p. [Graphical view] |
| Pfam | PF06428. Sec2p. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 22782. |
Entry information
| Entry name | R3GEF_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8TBN0 Secondary accession number(s): Q86V32, Q9P1Q8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with