Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane protein 254

Gene

TMEM254

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane protein 254
Gene namesi
Name:TMEM254
Synonyms:C10orf57
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000133678.13
HGNCiHGNC:25804 TMEM254
neXtProtiNX_Q8TBM7

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei15 – 35HelicalSequence analysisAdd BLAST21
Transmembranei61 – 81HelicalSequence analysisAdd BLAST21
Transmembranei95 – 115HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000133678
PharmGKBiPA134875855

Polymorphism and mutation databases

BioMutaiTMEM254

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000897962 – 123Transmembrane protein 254Add BLAST122

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ8TBM7
MaxQBiQ8TBM7
PaxDbiQ8TBM7
PeptideAtlasiQ8TBM7
PRIDEiQ8TBM7

PTM databases

iPTMnetiQ8TBM7
PhosphoSitePlusiQ8TBM7

Expressioni

Gene expression databases

BgeeiENSG00000133678
CleanExiHS_C10orf57
ExpressionAtlasiQ8TBM7 baseline and differential
GenevisibleiQ8TBM7 HS

Organism-specific databases

HPAiHPA029105

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

IntActiQ8TBM7, 10 interactors
STRINGi9606.ENSP00000361355

Structurei

3D structure databases

ProteinModelPortaliQ8TBM7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J214 Eukaryota
ENOG4111TUV LUCA
GeneTreeiENSGT00390000016042
HOGENOMiHOG000111687
HOVERGENiHBG056277
InParanoidiQ8TBM7
OMAiAMVLCKS
PhylomeDBiQ8TBM7
TreeFamiTF328617

Family and domain databases

InterProiView protein in InterPro
IPR028110 TMEM254
PfamiView protein in Pfam
PF14934 DUF4499, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TBM7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATAAGATYF QRGSLFWFTV ITLSFGYYTW VVFWPQSIPY QNLGPLGPFT
60 70 80 90 100
QYLVDHHHTL LCNGYWLAWL IHVGESLYAI VLCKHKGITS GRAQLLWFLQ
110 120
TFFFGIASLT ILIAYKRKRQ KQT
Length:123
Mass (Da):14,243
Last modified:June 1, 2002 - v1
Checksum:i56BE16322D749904
GO
Isoform 2 (identifier: Q8TBM7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     85-123: Missing.

Note: Gene prediction based on EST data.
Show »
Length:84
Mass (Da):9,692
Checksum:i348B1F6B92639253
GO
Isoform 3 (identifier: Q8TBM7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     85-123: HKGITSGRAQLLWFLQTFFFGIASLTILIAYKRKRQKQT → QNELRIRIKMRKLILRDSE

Note: Gene prediction based on EST data.
Show »
Length:103
Mass (Da):12,086
Checksum:i575A9D86C29FEE54
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti56H → R in BAD96256 (Ref. 3) Curated1
Sequence conflicti76S → F in CAG33591 (Ref. 2) Curated1
Sequence conflicti81V → A in BAB14528 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04706285 – 123Missing in isoform 2. CuratedAdd BLAST39
Alternative sequenceiVSP_04706385 – 123HKGIT…RQKQT → QNELRIRIKMRKLILRDSE in isoform 3. CuratedAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK023325 mRNA Translation: BAB14528.1
CR457310 mRNA Translation: CAG33591.1
AK222536 mRNA Translation: BAD96256.1
AL356095 Genomic DNA No translation available.
CH471142 Genomic DNA Translation: EAW80412.1
CH471142 Genomic DNA Translation: EAW80413.1
BC022252 mRNA Translation: AAH22252.1
CCDSiCCDS58086.1 [Q8TBM7-3]
CCDS58087.1 [Q8TBM7-2]
CCDS7363.1 [Q8TBM7-1]
RefSeqiNP_001257296.1, NM_001270367.1
NP_001257297.1, NM_001270368.1
NP_001257298.1, NM_001270369.1
NP_001257299.1, NM_001270370.1 [Q8TBM7-3]
NP_001257300.1, NM_001270371.1
NP_001257301.1, NM_001270372.1 [Q8TBM7-2]
NP_001257302.1, NM_001270373.1 [Q8TBM7-2]
NP_001257303.1, NM_001270374.1
NP_079401.2, NM_025125.3 [Q8TBM7-1]
UniGeneiHs.169982

Genome annotation databases

EnsembliENST00000372274; ENSP00000361348; ENSG00000133678 [Q8TBM7-3]
ENST00000372275; ENSP00000361349; ENSG00000133678 [Q8TBM7-2]
ENST00000372277; ENSP00000361351; ENSG00000133678 [Q8TBM7-3]
ENST00000372281; ENSP00000361355; ENSG00000133678 [Q8TBM7-1]
GeneIDi80195
KEGGihsa:80195
UCSCiuc001kbl.5 human [Q8TBM7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiTM254_HUMAN
AccessioniPrimary (citable) accession number: Q8TBM7
Secondary accession number(s): D3DWC8
, Q53HP4, Q5JTC0, Q5JTC1, Q6IA45, Q9H8S6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: June 1, 2002
Last modified: February 28, 2018
This is version 101 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health