Q8TBG4 (AT2L1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 89.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ethanolamine-phosphate phospho-lyase EC=4.2.3.2 Alternative name(s): Alanine--glyoxylate aminotransferase 2-like 1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 499 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the pyridoxal-phosphate-dependent breakdown of phosphoethanolamine, converting it to ammonia, inorganic phosphate and acetaldehyde. Ref.5 |
| Catalytic activity | Ethanolamine phosphate + H2O = acetaldehyde + NH3 + phosphate. Ref.5 |
| Cofactor | Pyridoxal phosphate. Ref.5 |
| Subunit structure | Homotetramer By similarity. |
| Subcellular location | Mitochondrion Potential. |
| Sequence similarities | Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. |
| Caution | Does not seem to possess aminotransferase activity (Ref.5). |
| Biophysicochemical properties | Kinetic parameters: KM=680 µM for phosphoethanolamine (at pH 7.4) Ref.5 Vmax=1.46 µmol/min/mg enzyme (at pH 7.4) |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | Pyridoxal phosphate |
| Molecular function | Aminotransferase Lyase Transferase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cellular amino acid metabolic process Non-traceable author statement. Source: UniProtKB |
| Cellular_component | mitochondrion Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | alanine-glyoxylate transaminase activity Non-traceable author statement. Source: UniProtKB ethanolamine-phosphate phospho-lyase activityInferred from electronic annotation. Source: EC pyridoxal phosphate bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8TBG4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8TBG4-2) The sequence of this isoform differs from the canonical sequence as follows: 59-64: Missing. | ||||||
| Isoform 3 (identifier: Q8TBG4-3) The sequence of this isoform differs from the canonical sequence as follows: 1-59: MCELYSKRDTLGLRKKHIGPSCKVFFASDPIKIVRAQRQYMFDENGEQYLDCINNVAHV → M | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 499 | 499 | Ethanolamine-phosphate phospho-lyase | PRO_0000287663 | |||||
Amino acid modifications | |||||||||
| Modified residue | 278 | 1 | N6-(pyridoxal phosphate)lysine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 59 | 59 | MCELY…NVAHV → M in isoform 3. | VSP_046097 | |||||
| Alternative sequence | 59 – 64 | 6 | Missing in isoform 2. | VSP_025583 | |||||
| Natural variant | 185 | 1 | S → P. Corresponds to variant rs1377210 [ dbSNP | Ensembl ]. | VAR_032342 | |||||
Experimental info | |||||||||
| Sequence conflict | 105 | 1 | V → A in BAH11666. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and sequencing of a cDNA encoding alanine-glyoxylate aminotransferase 2 from rat kidney." Matsui-Lee I.S., Muragaki Y., Ideguchi T., Hase T., Tsuji M., Ooshima A., Okuno E., Kido R. J. Biochem. 117:856-862(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Brain cortex and Kidney. |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [5] | "Molecular identification of hydroxylysine kinase and of ammoniophospholyases acting on 5-phosphohydroxy-L-lysine and phosphoethanolamine." Veiga-da-Cunha M., Hadi F., Balligand T., Stroobant V., Van Schaftingen E. J. Biol. Chem. 287:7246-7255(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY, COFACTOR, BIOPHYSICOCHEMICAL PROPERTIES. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ298293 mRNA. Translation: CAC22253.1. AK091888 mRNA. Translation: BAC03766.1. AK294072 mRNA. Translation: BAH11666.1. AC097473 Genomic DNA. Translation: AAY40946.1. BC022526 mRNA. Translation: AAH22526.1. |
| IPI | IPI00152204. IPI00845332. IPI00929120. |
| RefSeq | NP_001140062.1. NM_001146590.1. NP_001140099.1. NM_001146627.1. NP_112569.2. NM_031279.3. |
| UniGene | Hs.106576. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1QJ3 based on UniProtKB P12995. |
| ProteinModelPortal | Q8TBG4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000296486. |
PTM databases | |
| PhosphoSite | Q8TBG4. |
Polymorphism databases | |
| DMDM | 74751376. |
Proteomic databases | |
| PaxDb | Q8TBG4. |
| PRIDE | Q8TBG4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000296486; ENSP00000296486; ENSG00000164089. ENST00000411864; ENSP00000392269; ENSG00000164089. ENST00000512646; ENSP00000427065; ENSG00000164089. |
| GeneID | 64850. |
| KEGG | hsa:64850. |
| UCSC | uc003hzc.3. human. uc010imc.3. human. |
Organism-specific databases | |
| CTD | 64850. |
| GeneCards | GC04M109663. |
| HGNC | HGNC:14404. AGXT2L1. |
| HPA | HPA044546. |
| MIM | 614682. gene. |
| neXtProt | NX_Q8TBG4. |
| PharmGKB | PA24635. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0160. |
| HOGENOM | HOG000020206. |
| HOVERGEN | HBG004196. |
| InParanoid | Q8TBG4. |
| KO | K14286. |
| OMA | KIIEDAH. |
| OrthoDB | EOG4TTGHM. |
| PhylomeDB | Q8TBG4. |
Gene expression databases | |
| ArrayExpress | Q8TBG4. |
| Bgee | Q8TBG4. |
| CleanEx | HS_AGXT2L1. |
| Genevestigator | Q8TBG4. |
Family and domain databases | |
| Gene3D | 3.40.640.10. 1 hit. 3.90.1150.10. 1 hit. |
| InterPro | IPR005814. Aminotrans_3. IPR015424. PyrdxlP-dep_Trfase. IPR015421. PyrdxlP-dep_Trfase_major_sub1. IPR015422. PyrdxlP-dep_Trfase_major_sub2. [Graphical view] |
| PANTHER | PTHR11986. PTHR11986. 1 hit. |
| Pfam | PF00202. Aminotran_3. 1 hit. [Graphical view] |
| SUPFAM | SSF53383. PyrdxlP-dep_Trfase_major. 1 hit. |
| PROSITE | PS00600. AA_TRANSFER_CLASS_3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 64850. |
| NextBio | 66972. |
| SOURCE | Search... |
Entry information
| Entry name | AT2L1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8TBG4 Secondary accession number(s): B7Z1Y0, E9PBY0, Q9H174 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
