Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ethanolamine-phosphate phospho-lyase

Gene

ETNPPL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalyzes the pyridoxal-phosphate-dependent breakdown of phosphoethanolamine, converting it to ammonia, inorganic phosphate and acetaldehyde.1 Publication

Caution

Does not seem to possess aminotransferase activity.1 Publication

Catalytic activityi

Ethanolamine phosphate + H2O = acetaldehyde + NH3 + phosphate.1 Publication

Cofactori

pyridoxal 5'-phosphate1 Publication

Kineticsi

  1. KM=680 µM for phosphoethanolamine (at pH 7.4)1 Publication
  1. Vmax=1.46 µmol/min/mg enzyme (at pH 7.4)1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionAminotransferase, Lyase, Transferase
LigandPyridoxal phosphate

Enzyme and pathway databases

ReactomeiR-HSA-1483213 Synthesis of PE

Names & Taxonomyi

Protein namesi
Recommended name:
Ethanolamine-phosphate phospho-lyase (EC:4.2.3.2)
Alternative name(s):
Alanine--glyoxylate aminotransferase 2-like 1
Gene namesi
Name:ETNPPL
Synonyms:AGXT2L1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000164089.8
HGNCiHGNC:14404 ETNPPL
MIMi614682 gene
neXtProtiNX_Q8TBG4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

DisGeNETi64850
OpenTargetsiENSG00000164089
PharmGKBiPA24635

Polymorphism and mutation databases

BioMutaiETNPPL
DMDMi74751376

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002876631 – 499Ethanolamine-phosphate phospho-lyaseAdd BLAST499

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei278N6-(pyridoxal phosphate)lysineBy similarity1

Proteomic databases

MaxQBiQ8TBG4
PaxDbiQ8TBG4
PeptideAtlasiQ8TBG4
PRIDEiQ8TBG4

PTM databases

iPTMnetiQ8TBG4
PhosphoSitePlusiQ8TBG4

Expressioni

Gene expression databases

BgeeiENSG00000164089
CleanExiHS_AGXT2L1
ExpressionAtlasiQ8TBG4 baseline and differential
GenevisibleiQ8TBG4 HS

Organism-specific databases

HPAiHPA044546
HPA072938

Interactioni

Subunit structurei

Homotetramer.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi1223232 interactors.
IntActiQ8TBG4 1 interactor.
STRINGi9606.ENSP00000296486

Structurei

3D structure databases

ProteinModelPortaliQ8TBG4
SMRiQ8TBG4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1403 Eukaryota
COG0160 LUCA
GeneTreeiENSGT00530000062907
HOGENOMiHOG000020206
HOVERGENiHBG004196
InParanoidiQ8TBG4
KOiK14286
OMAiRVGNYLT
OrthoDBiEOG091G08ZM
PhylomeDBiQ8TBG4
TreeFamiTF320468

Family and domain databases

CDDicd00610 OAT_like, 1 hit
Gene3Di3.40.640.101 hit
3.90.1150.102 hits
InterProiView protein in InterPro
IPR005814 Aminotrans_3
IPR015424 PyrdxlP-dep_Trfase
IPR015422 PyrdxlP-dep_Trfase_dom1
IPR015421 PyrdxlP-dep_Trfase_major
PfamiView protein in Pfam
PF00202 Aminotran_3, 1 hit
SUPFAMiSSF53383 SSF53383, 1 hit
PROSITEiView protein in PROSITE
PS00600 AA_TRANSFER_CLASS_3, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TBG4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MCELYSKRDT LGLRKKHIGP SCKVFFASDP IKIVRAQRQY MFDENGEQYL
60 70 80 90 100
DCINNVAHVG HCHPGVVKAA LKQMELLNTN SRFLHDNIVE YAKRLSATLP
110 120 130 140 150
EKLSVCYFTN SGSEANDLAL RLARQFRGHQ DVITLDHAYH GHLSSLIEIS
160 170 180 190 200
PYKFQKGKDV KKEFVHVAPT PDTYRGKYRE DHADSASAYA DEVKKIIEDA
210 220 230 240 250
HNSGRKIAAF IAESMQSCGG QIIPPAGYFQ KVAEYVHGAG GVFIADEVQV
260 270 280 290 300
GFGRVGKHFW SFQMYGEDFV PDIVTMGKPM GNGHPVACVV TTKEIAEAFS
310 320 330 340 350
SSGMEYFNTY GGNPVSCAVG LAVLDIIENE DLQGNAKRVG NYLTELLKKQ
360 370 380 390 400
KAKHTLIGDI RGIGLFIGID LVKDHLKRTP ATAEAQHIIY KMKEKRVLLS
410 420 430 440 450
ADGPHRNVLK IKPPMCFTEE DAKFMVDQLD RILTVLEEAM GTKTESVTSE
460 470 480 490
NTPCKTKMLK EAHIELLRDS TTDSKENPSR KRNGMCTDTH SLLSKRLKT
Length:499
Mass (Da):55,671
Last modified:June 1, 2002 - v1
Checksum:i3C610898060474B4
GO
Isoform 2 (identifier: Q8TBG4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     59-64: Missing.

Show »
Length:493
Mass (Da):55,040
Checksum:i550C3D17990588B3
GO
Isoform 3 (identifier: Q8TBG4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-59: MCELYSKRDTLGLRKKHIGPSCKVFFASDPIKIVRAQRQYMFDENGEQYLDCINNVAHV → M

Note: No experimental confirmation available.
Show »
Length:441
Mass (Da):48,942
Checksum:i922846180BD29061
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti105V → A in BAH11666 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_032342185S → P. Corresponds to variant dbSNP:rs1377210Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0460971 – 59MCELY…NVAHV → M in isoform 3. 1 PublicationAdd BLAST59
Alternative sequenceiVSP_02558359 – 64Missing in isoform 2. 1 Publication6

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ298293 mRNA Translation: CAC22253.1
AK091888 mRNA Translation: BAC03766.1
AK294072 mRNA Translation: BAH11666.1
AC097473 Genomic DNA Translation: AAY40946.1
BC022526 mRNA Translation: AAH22526.1
CCDSiCCDS3682.1 [Q8TBG4-1]
CCDS54792.1 [Q8TBG4-3]
CCDS54793.1 [Q8TBG4-2]
RefSeqiNP_001140062.1, NM_001146590.1 [Q8TBG4-2]
NP_001140099.1, NM_001146627.1 [Q8TBG4-3]
NP_001317960.1, NM_001331031.1
NP_001317961.1, NM_001331032.1
NP_001317962.1, NM_001331033.1
NP_112569.2, NM_031279.3 [Q8TBG4-1]
UniGeneiHs.106576

Genome annotation databases

EnsembliENST00000296486; ENSP00000296486; ENSG00000164089 [Q8TBG4-1]
ENST00000411864; ENSP00000392269; ENSG00000164089 [Q8TBG4-2]
ENST00000512646; ENSP00000427065; ENSG00000164089 [Q8TBG4-3]
GeneIDi64850
KEGGihsa:64850
UCSCiuc003hzc.4 human [Q8TBG4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiAT2L1_HUMAN
AccessioniPrimary (citable) accession number: Q8TBG4
Secondary accession number(s): B7Z1Y0, E9PBY0, Q9H174
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: June 1, 2002
Last modified: February 28, 2018
This is version 126 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome