Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8TBF2 (PGFS_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 94. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Prostamide/prostaglandin F synthase

Short name=Prostamide/PG F synthase
Short name=Prostamide/PGF synthase
EC=1.11.1.20
Alternative name(s):
Protein FAM213B
Gene names
Name:FAM213B
Synonyms:C1orf93
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length198 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Catalyzes the reduction of prostaglandin-ethanolamide H2 (prostamide H2) to prostamide F(2alpha) with NADPH as proton donor. Also able to reduce prostaglandin H2 to prostaglandin F(2alpha) By similarity.

Catalytic activity

Thioredoxin + prostaglandin H2 = thioredoxin disulfide + prostaglandin F(2-alpha).

Subcellular location

Cytoplasmcytosol By similarity.

Sequence similarities

Belongs to the peroxiredoxin-like FAM213 family. Prostamide/prostaglandin F synthase subfamily.

Ontologies

Alternative products

This entry describes 8 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8TBF2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8TBF2-2)

The sequence of this isoform differs from the canonical sequence as follows:
     154-198: GGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV → EVPRRLRPQGAHPAGPGHLCGGLCQRPASV
Note: No experimental confirmation available.
Isoform 3 (identifier: Q8TBF2-3)

The sequence of this isoform differs from the canonical sequence as follows:
     106-106: K → KRLWTQASPEFGQATWCLR
Note: No experimental confirmation available.
Isoform 4 (identifier: Q8TBF2-4)

The sequence of this isoform differs from the canonical sequence as follows:
     129-164: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: Q8TBF2-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSRERGSRSEEPGAGNRESGSREPGLAAAAM
     128-164: Missing.
Note: No experimental confirmation available.
Isoform 6 (identifier: Q8TBF2-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSRERGSRSEEPGAGNRESGSREPGLAAAAM
     130-164: KAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQ → VPTPDRPRLLASRGTCLGTCCRAEGCWWSAK
Note: No experimental confirmation available.
Isoform 7 (identifier: Q8TBF2-7)

The sequence of this isoform differs from the canonical sequence as follows:
     106-106: K → KRLWTQASPEFGQATWCLR
     154-198: GGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV → EVPRRLRPQGAHPAGPGHLCGGLCQRPASV
Note: No experimental confirmation available.
Isoform 8 (identifier: Q8TBF2-8)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSRERGSRSEEPGAGNRESGSREPGLAAAAM
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 198198Prostamide/prostaglandin F synthase
PRO_0000284637

Natural variations

Alternative sequence11M → MSRERGSRSEEPGAGNRESG SREPGLAAAAM in isoform 5, isoform 6 and isoform 8.
VSP_040900
Alternative sequence1061K → KRLWTQASPEFGQATWCLR in isoform 3 and isoform 7.
VSP_040901
Alternative sequence128 – 16437Missing in isoform 5.
VSP_040902
Alternative sequence129 – 16436Missing in isoform 4.
VSP_040903
Alternative sequence130 – 16435KAVGI…LHFVQ → VPTPDRPRLLASRGTCLGTC CRAEGCWWSAK in isoform 6.
VSP_040904
Alternative sequence154 – 19845GGDKV…CDREV → EVPRRLRPQGAHPAGPGHLC GGLCQRPASV in isoform 2 and isoform 7.
VSP_024581

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2002. Version 1.
Checksum: 5E846BAFF44BA7FF

FASTA19821,223
        10         20         30         40         50         60 
MSTVDLARVG ACILKHAVTG EAVELRSLWR EHACVVAGLR RFGCVVCRWI AQDLSSLAGL 

        70         80         90        100        110        120 
LDQHGVRLVG VGPEALGLQE FLDGDYFAGE LYLDESKQLY KELGFKRYNS LSILPAALGK 

       130        140        150        160        170        180 
PVRDVAAKAK AVGIQGNLSG DLLQSGGLLV VSKGGDKVLL HFVQKSPGDY VPKEHILQVL 

       190 
GISAEVCASD PPQCDREV 

« Hide

Isoform 2 [UniParc].

Checksum: FD28CF6BCD965AB4
Show »

FASTA18319,465
Isoform 3 [UniParc].

Checksum: E48960669AE1407A
Show »

FASTA21623,355
Isoform 4 [UniParc].

Checksum: A86C8C59A5F7456D
Show »

FASTA16217,621
Isoform 5 [UniParc].

Checksum: AF2E4226898F0347
Show »

FASTA19120,548
Isoform 6 [UniParc].

Checksum: B34697403B2FE08B
Show »

FASTA22424,122
Isoform 7 [UniParc].

Checksum: 5AAB99C720FB6697
Show »

FASTA20121,597
Isoform 8 [UniParc].

Checksum: 3DD873AAED8AEA71
Show »

FASTA22824,278

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4; 5 AND 6).
Tissue: Neuroepithelioma, Teratocarcinoma, Thymus and Thyroid.
[2]Guo J.H., She X.Y., Yu L.
Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[3]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK057027 mRNA. Translation: BAG51845.1.
AK075273 mRNA. Translation: BAC11511.1.
AK291908 mRNA. Translation: BAF84597.1.
AK298926 mRNA. Translation: BAG61031.1.
AK303504 mRNA. Translation: BAG64537.1.
AK316243 mRNA. Translation: BAH14614.1.
AF425266 mRNA. Translation: AAP97295.1.
AL139246 Genomic DNA. Translation: CAX30825.1.
AL139246 Genomic DNA. Translation: CAX30826.1.
AL139246 Genomic DNA. Translation: CAX30827.1.
CH471183 Genomic DNA. Translation: EAW56086.1.
CH471183 Genomic DNA. Translation: EAW56087.1.
CH471183 Genomic DNA. Translation: EAW56088.1.
BC022547 mRNA. Translation: AAH22547.1.
RefSeqNP_001182665.1. NM_001195736.1.
NP_001182666.1. NM_001195737.1.
NP_001182667.1. NM_001195738.1.
NP_001182669.1. NM_001195740.1.
NP_001182670.1. NM_001195741.1.
NP_689584.2. NM_152371.3.
UniGeneHs.462033.

3D structure databases

ProteinModelPortalQ8TBF2.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid126049. 3 interactions.
IntActQ8TBF2. 2 interactions.
MINTMINT-8247583.
STRING9606.ENSP00000367682.

PTM databases

PhosphoSiteQ8TBF2.

Polymorphism databases

DMDM74760424.

Proteomic databases

PaxDbQ8TBF2.
PRIDEQ8TBF2.

Protocols and materials databases

DNASU127281.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000378425; ENSP00000367682; ENSG00000157870. [Q8TBF2-1]
ENST00000419916; ENSP00000394405; ENSG00000157870.
ENST00000444521; ENSP00000413218; ENSG00000157870. [Q8TBF2-3]
ENST00000537325; ENSP00000443605; ENSG00000157870. [Q8TBF2-5]
GeneID127281.
KEGGhsa:127281.
UCSCuc001ajv.2. human. [Q8TBF2-3]
uc010nzd.2. human. [Q8TBF2-6]
uc010nze.2. human. [Q8TBF2-4]
uc010nzf.2. human. [Q8TBF2-5]

Organism-specific databases

CTD127281.
GeneCardsGC01P002517.
HGNCHGNC:28390. FAM213B.
HPAHPA006403.
neXtProtNX_Q8TBF2.
PharmGKBPA142672477.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG276778.
HOVERGENHBG106494.
KOK15717.
PhylomeDBQ8TBF2.

Enzyme and pathway databases

ReactomeREACT_111217. Metabolism.

Gene expression databases

ArrayExpressQ8TBF2.
BgeeQ8TBF2.
CleanExHS_C1orf93.
GenevestigatorQ8TBF2.

Family and domain databases

InterProIPR012336. Thioredoxin-like_fold.
[Graphical view]
SUPFAMSSF52833. SSF52833. 1 hit.
ProtoNetSearch...

Other

GenomeRNAi127281.
NextBio35535316.
PROQ8TBF2.

Entry information

Entry namePGFS_HUMAN
AccessionPrimary (citable) accession number: Q8TBF2
Secondary accession number(s): A8K793 expand/collapse secondary AC list , B3KPY3, B4DQR9, B4E0S5, B7ZAC8, B9DI90, B9DI92, J3KQD0, Q8N2H0
Entry history
Integrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: June 1, 2002
Last modified: April 16, 2014
This is version 94 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM