Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8TBF2

- PGFS_HUMAN

UniProt

Q8TBF2 - PGFS_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Prostamide/prostaglandin F synthase

Gene

FAM213B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Catalyzes the reduction of prostaglandin-ethanolamide H2 (prostamide H2) to prostamide F(2alpha) with NADPH as proton donor. Also able to reduce prostaglandin H2 to prostaglandin F(2alpha) (By similarity).By similarity

Catalytic activityi

Thioredoxin + prostaglandin H2 = thioredoxin disulfide + prostaglandin F(2-alpha).

GO - Molecular functioni

  1. oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Source: UniProtKB
  2. prostaglandin-F synthase activity Source: UniProt

GO - Biological processi

  1. arachidonic acid metabolic process Source: Reactome
  2. cyclooxygenase pathway Source: Reactome
  3. prostaglandin biosynthetic process Source: UniProtKB
  4. small molecule metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Biological processi

Fatty acid biosynthesis, Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism, Prostaglandin biosynthesis, Prostaglandin metabolism

Keywords - Ligandi

NADP

Enzyme and pathway databases

ReactomeiREACT_150149. Synthesis of Prostaglandins (PG) and Thromboxanes (TX).

Names & Taxonomyi

Protein namesi
Recommended name:
Prostamide/prostaglandin F synthase (EC:1.11.1.20)
Short name:
Prostamide/PG F synthase
Short name:
Prostamide/PGF synthase
Alternative name(s):
Protein FAM213B
Gene namesi
Name:FAM213B
Synonyms:C1orf93
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:28390. FAM213B.

Subcellular locationi

Cytoplasmcytosol By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProt
  2. cytosol Source: Ensembl
  3. endoplasmic reticulum Source: UniProt
  4. extracellular vesicular exosome Source: UniProt
  5. myelin sheath Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672477.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 198198Prostamide/prostaglandin F synthasePRO_0000284637Add
BLAST

Proteomic databases

MaxQBiQ8TBF2.
PaxDbiQ8TBF2.
PRIDEiQ8TBF2.

PTM databases

PhosphoSiteiQ8TBF2.

Expressioni

Gene expression databases

BgeeiQ8TBF2.
CleanExiHS_C1orf93.
ExpressionAtlasiQ8TBF2. baseline and differential.
GenevestigatoriQ8TBF2.

Organism-specific databases

HPAiHPA006403.

Interactioni

Protein-protein interaction databases

BioGridi126049. 7 interactions.
IntActiQ8TBF2. 2 interactions.
MINTiMINT-8247583.
STRINGi9606.ENSP00000367682.

Structurei

3D structure databases

ProteinModelPortaliQ8TBF2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG276778.
GeneTreeiENSGT00530000063724.
HOVERGENiHBG106494.
InParanoidiQ8TBF2.
KOiK15717.
PhylomeDBiQ8TBF2.

Family and domain databases

InterProiIPR012336. Thioredoxin-like_fold.
[Graphical view]
SUPFAMiSSF52833. SSF52833. 1 hit.

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8TBF2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSTVDLARVG ACILKHAVTG EAVELRSLWR EHACVVAGLR RFGCVVCRWI
60 70 80 90 100
AQDLSSLAGL LDQHGVRLVG VGPEALGLQE FLDGDYFAGE LYLDESKQLY
110 120 130 140 150
KELGFKRYNS LSILPAALGK PVRDVAAKAK AVGIQGNLSG DLLQSGGLLV
160 170 180 190
VSKGGDKVLL HFVQKSPGDY VPKEHILQVL GISAEVCASD PPQCDREV
Length:198
Mass (Da):21,223
Last modified:June 1, 2002 - v1
Checksum:i5E846BAFF44BA7FF
GO
Isoform 2 (identifier: Q8TBF2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-198: GGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV → EVPRRLRPQGAHPAGPGHLCGGLCQRPASV

Note: No experimental confirmation available.

Show »
Length:183
Mass (Da):19,465
Checksum:iFD28CF6BCD965AB4
GO
Isoform 3 (identifier: Q8TBF2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     106-106: K → KRLWTQASPEFGQATWCLR

Note: No experimental confirmation available.

Show »
Length:216
Mass (Da):23,355
Checksum:iE48960669AE1407A
GO
Isoform 4 (identifier: Q8TBF2-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     129-164: Missing.

Note: No experimental confirmation available.

Show »
Length:162
Mass (Da):17,621
Checksum:iA86C8C59A5F7456D
GO
Isoform 5 (identifier: Q8TBF2-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSRERGSRSEEPGAGNRESGSREPGLAAAAM
     128-164: Missing.

Note: No experimental confirmation available.

Show »
Length:191
Mass (Da):20,548
Checksum:iAF2E4226898F0347
GO
Isoform 6 (identifier: Q8TBF2-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSRERGSRSEEPGAGNRESGSREPGLAAAAM
     130-164: KAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQ → VPTPDRPRLLASRGTCLGTCCRAEGCWWSAK

Note: No experimental confirmation available.

Show »
Length:224
Mass (Da):24,122
Checksum:iB34697403B2FE08B
GO
Isoform 7 (identifier: Q8TBF2-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     106-106: K → KRLWTQASPEFGQATWCLR
     154-198: GGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV → EVPRRLRPQGAHPAGPGHLCGGLCQRPASV

Note: No experimental confirmation available.

Show »
Length:201
Mass (Da):21,597
Checksum:i5AAB99C720FB6697
GO
Isoform 8 (identifier: Q8TBF2-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSRERGSRSEEPGAGNRESGSREPGLAAAAM

Note: No experimental confirmation available.

Show »
Length:228
Mass (Da):24,278
Checksum:i3DD873AAED8AEA71
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MSRERGSRSEEPGAGNRESG SREPGLAAAAM in isoform 5, isoform 6 and isoform 8. 1 PublicationVSP_040900
Alternative sequencei106 – 1061K → KRLWTQASPEFGQATWCLR in isoform 3 and isoform 7. 1 PublicationVSP_040901
Alternative sequencei128 – 16437Missing in isoform 5. 1 PublicationVSP_040902Add
BLAST
Alternative sequencei129 – 16436Missing in isoform 4. 1 PublicationVSP_040903Add
BLAST
Alternative sequencei130 – 16435KAVGI…LHFVQ → VPTPDRPRLLASRGTCLGTC CRAEGCWWSAK in isoform 6. 1 PublicationVSP_040904Add
BLAST
Alternative sequencei154 – 19845GGDKV…CDREV → EVPRRLRPQGAHPAGPGHLC GGLCQRPASV in isoform 2 and isoform 7. 1 PublicationVSP_024581Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK057027 mRNA. Translation: BAG51845.1.
AK075273 mRNA. Translation: BAC11511.1.
AK291908 mRNA. Translation: BAF84597.1.
AK298926 mRNA. Translation: BAG61031.1.
AK303504 mRNA. Translation: BAG64537.1.
AK316243 mRNA. Translation: BAH14614.1.
AF425266 mRNA. Translation: AAP97295.1.
AL139246 Genomic DNA. Translation: CAX30825.1.
AL139246 Genomic DNA. Translation: CAX30826.1.
AL139246 Genomic DNA. Translation: CAX30827.1.
CH471183 Genomic DNA. Translation: EAW56086.1.
CH471183 Genomic DNA. Translation: EAW56087.1.
CH471183 Genomic DNA. Translation: EAW56088.1.
BC022547 mRNA. Translation: AAH22547.1.
CCDSiCCDS44.2. [Q8TBF2-8]
CCDS55564.1. [Q8TBF2-5]
RefSeqiNP_001182665.1. NM_001195736.1.
NP_001182666.1. NM_001195737.1. [Q8TBF2-6]
NP_001182667.1. NM_001195738.1.
NP_001182669.1. NM_001195740.1.
NP_001182670.1. NM_001195741.1. [Q8TBF2-5]
NP_689584.2. NM_152371.3. [Q8TBF2-8]
UniGeneiHs.462033.

Genome annotation databases

EnsembliENST00000419916; ENSP00000394405; ENSG00000157870. [Q8TBF2-8]
ENST00000537325; ENSP00000443605; ENSG00000157870. [Q8TBF2-5]
GeneIDi127281.
KEGGihsa:127281.
UCSCiuc001ajv.2. human. [Q8TBF2-3]
uc010nzd.2. human. [Q8TBF2-6]
uc010nze.2. human. [Q8TBF2-4]
uc010nzf.2. human. [Q8TBF2-5]

Polymorphism databases

DMDMi74760424.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK057027 mRNA. Translation: BAG51845.1 .
AK075273 mRNA. Translation: BAC11511.1 .
AK291908 mRNA. Translation: BAF84597.1 .
AK298926 mRNA. Translation: BAG61031.1 .
AK303504 mRNA. Translation: BAG64537.1 .
AK316243 mRNA. Translation: BAH14614.1 .
AF425266 mRNA. Translation: AAP97295.1 .
AL139246 Genomic DNA. Translation: CAX30825.1 .
AL139246 Genomic DNA. Translation: CAX30826.1 .
AL139246 Genomic DNA. Translation: CAX30827.1 .
CH471183 Genomic DNA. Translation: EAW56086.1 .
CH471183 Genomic DNA. Translation: EAW56087.1 .
CH471183 Genomic DNA. Translation: EAW56088.1 .
BC022547 mRNA. Translation: AAH22547.1 .
CCDSi CCDS44.2. [Q8TBF2-8 ]
CCDS55564.1. [Q8TBF2-5 ]
RefSeqi NP_001182665.1. NM_001195736.1.
NP_001182666.1. NM_001195737.1. [Q8TBF2-6 ]
NP_001182667.1. NM_001195738.1.
NP_001182669.1. NM_001195740.1.
NP_001182670.1. NM_001195741.1. [Q8TBF2-5 ]
NP_689584.2. NM_152371.3. [Q8TBF2-8 ]
UniGenei Hs.462033.

3D structure databases

ProteinModelPortali Q8TBF2.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 126049. 7 interactions.
IntActi Q8TBF2. 2 interactions.
MINTi MINT-8247583.
STRINGi 9606.ENSP00000367682.

PTM databases

PhosphoSitei Q8TBF2.

Polymorphism databases

DMDMi 74760424.

Proteomic databases

MaxQBi Q8TBF2.
PaxDbi Q8TBF2.
PRIDEi Q8TBF2.

Protocols and materials databases

DNASUi 127281.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000419916 ; ENSP00000394405 ; ENSG00000157870 . [Q8TBF2-8 ]
ENST00000537325 ; ENSP00000443605 ; ENSG00000157870 . [Q8TBF2-5 ]
GeneIDi 127281.
KEGGi hsa:127281.
UCSCi uc001ajv.2. human. [Q8TBF2-3 ]
uc010nzd.2. human. [Q8TBF2-6 ]
uc010nze.2. human. [Q8TBF2-4 ]
uc010nzf.2. human. [Q8TBF2-5 ]

Organism-specific databases

CTDi 127281.
GeneCardsi GC01P002517.
HGNCi HGNC:28390. FAM213B.
HPAi HPA006403.
neXtProti NX_Q8TBF2.
PharmGKBi PA142672477.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG276778.
GeneTreei ENSGT00530000063724.
HOVERGENi HBG106494.
InParanoidi Q8TBF2.
KOi K15717.
PhylomeDBi Q8TBF2.

Enzyme and pathway databases

Reactomei REACT_150149. Synthesis of Prostaglandins (PG) and Thromboxanes (TX).

Miscellaneous databases

GenomeRNAii 127281.
NextBioi 35535316.
PROi Q8TBF2.

Gene expression databases

Bgeei Q8TBF2.
CleanExi HS_C1orf93.
ExpressionAtlasi Q8TBF2. baseline and differential.
Genevestigatori Q8TBF2.

Family and domain databases

InterProi IPR012336. Thioredoxin-like_fold.
[Graphical view ]
SUPFAMi SSF52833. SSF52833. 1 hit.
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4; 5 AND 6).
    Tissue: Neuroepithelioma, Teratocarcinoma, Thymus and Thyroid.
  2. Guo J.H., She X.Y., Yu L.
    Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.

Entry informationi

Entry nameiPGFS_HUMAN
AccessioniPrimary (citable) accession number: Q8TBF2
Secondary accession number(s): A8K793
, B3KPY3, B4DQR9, B4E0S5, B7ZAC8, B9DI90, B9DI92, J3KQD0, Q8N2H0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: June 1, 2002
Last modified: October 29, 2014
This is version 99 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3