Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prostamide/prostaglandin F synthase

Gene

FAM213B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalyzes the reduction of prostaglandin-ethanolamide H2 (prostamide H2) to prostamide F(2alpha) with NADPH as proton donor. Also able to reduce prostaglandin H2 to prostaglandin F(2alpha) (By similarity).By similarity

Catalytic activityi

Thioredoxin + prostaglandin H2 = thioredoxin disulfide + prostaglandin F(2-alpha).

GO - Molecular functioni

  • antioxidant activity Source: GO_Central
  • oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Source: UniProtKB
  • prostaglandin-F synthase activity Source: UniProtKB

GO - Biological processi

  • oxidation-reduction process Source: GO_Central
  • prostaglandin biosynthetic process Source: UniProtKB

Keywordsi

Molecular functionOxidoreductase
Biological processFatty acid biosynthesis, Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism, Prostaglandin biosynthesis, Prostaglandin metabolism
LigandNADP

Enzyme and pathway databases

ReactomeiR-HSA-2162123 Synthesis of Prostaglandins (PG) and Thromboxanes (TX)

Names & Taxonomyi

Protein namesi
Recommended name:
Prostamide/prostaglandin F synthase (EC:1.11.1.20)
Short name:
Prostamide/PG F synthase
Short name:
Prostamide/PGF synthase
Alternative name(s):
Protein FAM213B
Gene namesi
Name:FAM213B
Synonyms:C1orf93
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

EuPathDBiHostDB:ENSG00000157870.14
HGNCiHGNC:28390 FAM213B
neXtProtiNX_Q8TBF2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672477

Polymorphism and mutation databases

BioMutaiFAM213B
DMDMi74760424

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002846371 – 198Prostamide/prostaglandin F synthaseAdd BLAST198

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei108PhosphotyrosineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8TBF2
MaxQBiQ8TBF2
PaxDbiQ8TBF2
PeptideAtlasiQ8TBF2
PRIDEiQ8TBF2

PTM databases

iPTMnetiQ8TBF2
PhosphoSitePlusiQ8TBF2

Expressioni

Gene expression databases

BgeeiENSG00000157870
CleanExiHS_C1orf93
ExpressionAtlasiQ8TBF2 baseline and differential
GenevisibleiQ8TBF2 HS

Organism-specific databases

HPAiHPA006403

Interactioni

Protein-protein interaction databases

BioGridi126049, 7 interactors
IntActiQ8TBF2, 4 interactors
MINTiQ8TBF2
STRINGi9606.ENSP00000394405

Structurei

3D structure databases

ProteinModelPortaliQ8TBF2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG4498 Eukaryota
ENOG410YFY9 LUCA
HOVERGENiHBG106494
InParanoidiQ8TBF2
KOiK15717
PhylomeDBiQ8TBF2

Family and domain databases

InterProiView protein in InterPro
IPR032801 FAM213/AAED1
IPR036249 Thioredoxin-like_sf
PANTHERiPTHR28630 PTHR28630, 2 hits
PfamiView protein in Pfam
PF13911 AhpC-TSA_2, 1 hit
SUPFAMiSSF52833 SSF52833, 1 hit

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TBF2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSTVDLARVG ACILKHAVTG EAVELRSLWR EHACVVAGLR RFGCVVCRWI
60 70 80 90 100
AQDLSSLAGL LDQHGVRLVG VGPEALGLQE FLDGDYFAGE LYLDESKQLY
110 120 130 140 150
KELGFKRYNS LSILPAALGK PVRDVAAKAK AVGIQGNLSG DLLQSGGLLV
160 170 180 190
VSKGGDKVLL HFVQKSPGDY VPKEHILQVL GISAEVCASD PPQCDREV
Length:198
Mass (Da):21,223
Last modified:June 1, 2002 - v1
Checksum:i5E846BAFF44BA7FF
GO
Isoform 2 (identifier: Q8TBF2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-198: GGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV → EVPRRLRPQGAHPAGPGHLCGGLCQRPASV

Note: No experimental confirmation available.
Show »
Length:183
Mass (Da):19,465
Checksum:iFD28CF6BCD965AB4
GO
Isoform 3 (identifier: Q8TBF2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     106-106: K → KRLWTQASPEFGQATWCLR

Note: No experimental confirmation available.
Show »
Length:216
Mass (Da):23,355
Checksum:iE48960669AE1407A
GO
Isoform 4 (identifier: Q8TBF2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     129-164: Missing.

Note: No experimental confirmation available.
Show »
Length:162
Mass (Da):17,621
Checksum:iA86C8C59A5F7456D
GO
Isoform 5 (identifier: Q8TBF2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     130-164: KAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQ → VPTPDRPRLLASRGTCLGTCCRAEGCWWSAK

Note: No experimental confirmation available.
Show »
Length:194
Mass (Da):21,066
Checksum:i5A87DACE7026D656
GO
Isoform 6 (identifier: Q8TBF2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     106-106: K → KRLWTQASPEFGQATWCLR
     154-198: GGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV → EVPRRLRPQGAHPAGPGHLCGGLCQRPASV

Note: No experimental confirmation available.
Show »
Length:201
Mass (Da):21,597
Checksum:i5AAB99C720FB6697
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_040901106K → KRLWTQASPEFGQATWCLR in isoform 3 and isoform 6. 1 Publication1
Alternative sequenceiVSP_040903129 – 164Missing in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_040904130 – 164KAVGI…LHFVQ → VPTPDRPRLLASRGTCLGTC CRAEGCWWSAK in isoform 5. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_024581154 – 198GGDKV…CDREV → EVPRRLRPQGAHPAGPGHLC GGLCQRPASV in isoform 2 and isoform 6. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK057027 mRNA Translation: BAG51845.1
AK075273 mRNA Translation: BAC11511.1
AK291908 mRNA Translation: BAF84597.1
AK298926 mRNA Translation: BAG61031.1
AK303504 mRNA Translation: BAG64537.1
AK316243 mRNA Translation: BAH14614.1
AF425266 mRNA Translation: AAP97295.1
AL139246 Genomic DNA Translation: CAX30825.1
AL139246 Genomic DNA Translation: CAX30826.1
AL139246 Genomic DNA Translation: CAX30827.1
CH471183 Genomic DNA Translation: EAW56086.1
CH471183 Genomic DNA Translation: EAW56087.1
CH471183 Genomic DNA Translation: EAW56088.1
BC022547 mRNA Translation: AAH22547.1
CCDSiCCDS44.2 [Q8TBF2-1]
CCDS72690.1 [Q8TBF2-3]
CCDS72691.1 [Q8TBF2-4]
RefSeqiNP_001182665.1, NM_001195736.1
NP_001182666.1, NM_001195737.1 [Q8TBF2-6]
NP_001182667.1, NM_001195738.1
NP_001182669.1, NM_001195740.1
UniGeneiHs.462033

Genome annotation databases

GeneIDi127281
KEGGihsa:127281
UCSCiuc001aju.4 human [Q8TBF2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPGFS_HUMAN
AccessioniPrimary (citable) accession number: Q8TBF2
Secondary accession number(s): A8K793
, B3KPY3, B4DQR9, B4E0S5, B7ZAC8, B9DI90, B9DI92, J3KQD0, Q8N2H0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: June 1, 2002
Last modified: April 25, 2018
This is version 124 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health