Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prostamide/prostaglandin F synthase

Gene

FAM213B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the reduction of prostaglandin-ethanolamide H2 (prostamide H2) to prostamide F(2alpha) with NADPH as proton donor. Also able to reduce prostaglandin H2 to prostaglandin F(2alpha) (By similarity).By similarity

Catalytic activityi

Thioredoxin + prostaglandin H2 = thioredoxin disulfide + prostaglandin F(2-alpha).

GO - Molecular functioni

  • oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Source: UniProtKB
  • prostaglandin-F synthase activity Source: UniProtKB

GO - Biological processi

  • prostaglandin biosynthetic process Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Biological processi

Fatty acid biosynthesis, Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism, Prostaglandin biosynthesis, Prostaglandin metabolism

Keywords - Ligandi

NADP

Enzyme and pathway databases

ReactomeiR-HSA-2162123. Synthesis of Prostaglandins (PG) and Thromboxanes (TX).

Names & Taxonomyi

Protein namesi
Recommended name:
Prostamide/prostaglandin F synthase (EC:1.11.1.20)
Short name:
Prostamide/PG F synthase
Short name:
Prostamide/PGF synthase
Alternative name(s):
Protein FAM213B
Gene namesi
Name:FAM213B
Synonyms:C1orf93
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:28390. FAM213B.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • cytosol Source: UniProtKB-SubCell
  • endoplasmic reticulum Source: UniProtKB
  • extracellular exosome Source: UniProtKB
  • myelin sheath Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000157870.
ENSG00000275125.
PharmGKBiPA142672477.

Polymorphism and mutation databases

BioMutaiFAM213B.
DMDMi74760424.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002846371 – 198Prostamide/prostaglandin F synthaseAdd BLAST198

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei108PhosphotyrosineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8TBF2.
MaxQBiQ8TBF2.
PaxDbiQ8TBF2.
PeptideAtlasiQ8TBF2.
PRIDEiQ8TBF2.

PTM databases

iPTMnetiQ8TBF2.
PhosphoSitePlusiQ8TBF2.

Expressioni

Gene expression databases

BgeeiENSG00000157870.
CleanExiHS_C1orf93.
ExpressionAtlasiQ8TBF2. baseline and differential.
GenevisibleiQ8TBF2. HS.

Organism-specific databases

HPAiHPA006188.
HPA006403.

Interactioni

Protein-protein interaction databases

BioGridi126049. 7 interactors.
IntActiQ8TBF2. 2 interactors.
MINTiMINT-8247583.
STRINGi9606.ENSP00000394405.

Structurei

3D structure databases

ProteinModelPortaliQ8TBF2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG4498. Eukaryota.
ENOG410YFY9. LUCA.
GeneTreeiENSGT00530000063724.
HOVERGENiHBG106494.
InParanoidiQ8TBF2.
KOiK15717.
PhylomeDBiQ8TBF2.

Family and domain databases

InterProiIPR032802. FAM213.
IPR032801. FAM213/AAED1.
IPR012336. Thioredoxin-like_fold.
[Graphical view]
PANTHERiPTHR28630. PTHR28630. 1 hit.
PTHR28630:SF2. PTHR28630:SF2. 1 hit.
PfamiPF13911. AhpC-TSA_2. 1 hit.
[Graphical view]
SUPFAMiSSF52833. SSF52833. 1 hit.

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TBF2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSTVDLARVG ACILKHAVTG EAVELRSLWR EHACVVAGLR RFGCVVCRWI
60 70 80 90 100
AQDLSSLAGL LDQHGVRLVG VGPEALGLQE FLDGDYFAGE LYLDESKQLY
110 120 130 140 150
KELGFKRYNS LSILPAALGK PVRDVAAKAK AVGIQGNLSG DLLQSGGLLV
160 170 180 190
VSKGGDKVLL HFVQKSPGDY VPKEHILQVL GISAEVCASD PPQCDREV
Length:198
Mass (Da):21,223
Last modified:June 1, 2002 - v1
Checksum:i5E846BAFF44BA7FF
GO
Isoform 2 (identifier: Q8TBF2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-198: GGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV → EVPRRLRPQGAHPAGPGHLCGGLCQRPASV

Note: No experimental confirmation available.
Show »
Length:183
Mass (Da):19,465
Checksum:iFD28CF6BCD965AB4
GO
Isoform 3 (identifier: Q8TBF2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     106-106: K → KRLWTQASPEFGQATWCLR

Note: No experimental confirmation available.
Show »
Length:216
Mass (Da):23,355
Checksum:iE48960669AE1407A
GO
Isoform 4 (identifier: Q8TBF2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     129-164: Missing.

Note: No experimental confirmation available.
Show »
Length:162
Mass (Da):17,621
Checksum:iA86C8C59A5F7456D
GO
Isoform 5 (identifier: Q8TBF2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSRERGSRSEEPGAGNRESGSREPGLAAAAM
     128-164: Missing.

Note: No experimental confirmation available.
Show »
Length:191
Mass (Da):20,548
Checksum:iAF2E4226898F0347
GO
Isoform 6 (identifier: Q8TBF2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSRERGSRSEEPGAGNRESGSREPGLAAAAM
     130-164: KAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQ → VPTPDRPRLLASRGTCLGTCCRAEGCWWSAK

Note: No experimental confirmation available.
Show »
Length:224
Mass (Da):24,122
Checksum:iB34697403B2FE08B
GO
Isoform 7 (identifier: Q8TBF2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     106-106: K → KRLWTQASPEFGQATWCLR
     154-198: GGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV → EVPRRLRPQGAHPAGPGHLCGGLCQRPASV

Note: No experimental confirmation available.
Show »
Length:201
Mass (Da):21,597
Checksum:i5AAB99C720FB6697
GO
Isoform 8 (identifier: Q8TBF2-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSRERGSRSEEPGAGNRESGSREPGLAAAAM

Note: No experimental confirmation available.
Show »
Length:228
Mass (Da):24,278
Checksum:i3DD873AAED8AEA71
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0409001M → MSRERGSRSEEPGAGNRESG SREPGLAAAAM in isoform 5, isoform 6 and isoform 8. 1 Publication1
Alternative sequenceiVSP_040901106K → KRLWTQASPEFGQATWCLR in isoform 3 and isoform 7. 1 Publication1
Alternative sequenceiVSP_040902128 – 164Missing in isoform 5. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_040903129 – 164Missing in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_040904130 – 164KAVGI…LHFVQ → VPTPDRPRLLASRGTCLGTC CRAEGCWWSAK in isoform 6. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_024581154 – 198GGDKV…CDREV → EVPRRLRPQGAHPAGPGHLC GGLCQRPASV in isoform 2 and isoform 7. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK057027 mRNA. Translation: BAG51845.1.
AK075273 mRNA. Translation: BAC11511.1.
AK291908 mRNA. Translation: BAF84597.1.
AK298926 mRNA. Translation: BAG61031.1.
AK303504 mRNA. Translation: BAG64537.1.
AK316243 mRNA. Translation: BAH14614.1.
AF425266 mRNA. Translation: AAP97295.1.
AL139246 Genomic DNA. Translation: CAX30825.1.
AL139246 Genomic DNA. Translation: CAX30826.1.
AL139246 Genomic DNA. Translation: CAX30827.1.
CH471183 Genomic DNA. Translation: EAW56086.1.
CH471183 Genomic DNA. Translation: EAW56087.1.
CH471183 Genomic DNA. Translation: EAW56088.1.
BC022547 mRNA. Translation: AAH22547.1.
CCDSiCCDS44.2. [Q8TBF2-8]
CCDS55564.1. [Q8TBF2-5]
RefSeqiNP_001182665.1. NM_001195736.1.
NP_001182666.1. NM_001195737.1. [Q8TBF2-6]
NP_001182667.1. NM_001195738.1.
NP_001182669.1. NM_001195740.1.
NP_001182670.1. NM_001195741.1. [Q8TBF2-5]
NP_689584.2. NM_152371.3. [Q8TBF2-8]
UniGeneiHs.462033.

Genome annotation databases

EnsembliENST00000419916; ENSP00000394405; ENSG00000157870. [Q8TBF2-8]
ENST00000537325; ENSP00000443605; ENSG00000157870. [Q8TBF2-5]
ENST00000627654; ENSP00000487468; ENSG00000275125. [Q8TBF2-5]
ENST00000629512; ENSP00000485968; ENSG00000275125. [Q8TBF2-8]
GeneIDi127281.
KEGGihsa:127281.
UCSCiuc001aju.4. human. [Q8TBF2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK057027 mRNA. Translation: BAG51845.1.
AK075273 mRNA. Translation: BAC11511.1.
AK291908 mRNA. Translation: BAF84597.1.
AK298926 mRNA. Translation: BAG61031.1.
AK303504 mRNA. Translation: BAG64537.1.
AK316243 mRNA. Translation: BAH14614.1.
AF425266 mRNA. Translation: AAP97295.1.
AL139246 Genomic DNA. Translation: CAX30825.1.
AL139246 Genomic DNA. Translation: CAX30826.1.
AL139246 Genomic DNA. Translation: CAX30827.1.
CH471183 Genomic DNA. Translation: EAW56086.1.
CH471183 Genomic DNA. Translation: EAW56087.1.
CH471183 Genomic DNA. Translation: EAW56088.1.
BC022547 mRNA. Translation: AAH22547.1.
CCDSiCCDS44.2. [Q8TBF2-8]
CCDS55564.1. [Q8TBF2-5]
RefSeqiNP_001182665.1. NM_001195736.1.
NP_001182666.1. NM_001195737.1. [Q8TBF2-6]
NP_001182667.1. NM_001195738.1.
NP_001182669.1. NM_001195740.1.
NP_001182670.1. NM_001195741.1. [Q8TBF2-5]
NP_689584.2. NM_152371.3. [Q8TBF2-8]
UniGeneiHs.462033.

3D structure databases

ProteinModelPortaliQ8TBF2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126049. 7 interactors.
IntActiQ8TBF2. 2 interactors.
MINTiMINT-8247583.
STRINGi9606.ENSP00000394405.

PTM databases

iPTMnetiQ8TBF2.
PhosphoSitePlusiQ8TBF2.

Polymorphism and mutation databases

BioMutaiFAM213B.
DMDMi74760424.

Proteomic databases

EPDiQ8TBF2.
MaxQBiQ8TBF2.
PaxDbiQ8TBF2.
PeptideAtlasiQ8TBF2.
PRIDEiQ8TBF2.

Protocols and materials databases

DNASUi127281.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000419916; ENSP00000394405; ENSG00000157870. [Q8TBF2-8]
ENST00000537325; ENSP00000443605; ENSG00000157870. [Q8TBF2-5]
ENST00000627654; ENSP00000487468; ENSG00000275125. [Q8TBF2-5]
ENST00000629512; ENSP00000485968; ENSG00000275125. [Q8TBF2-8]
GeneIDi127281.
KEGGihsa:127281.
UCSCiuc001aju.4. human. [Q8TBF2-1]

Organism-specific databases

CTDi127281.
GeneCardsiFAM213B.
HGNCiHGNC:28390. FAM213B.
HPAiHPA006188.
HPA006403.
neXtProtiNX_Q8TBF2.
OpenTargetsiENSG00000157870.
ENSG00000275125.
PharmGKBiPA142672477.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4498. Eukaryota.
ENOG410YFY9. LUCA.
GeneTreeiENSGT00530000063724.
HOVERGENiHBG106494.
InParanoidiQ8TBF2.
KOiK15717.
PhylomeDBiQ8TBF2.

Enzyme and pathway databases

ReactomeiR-HSA-2162123. Synthesis of Prostaglandins (PG) and Thromboxanes (TX).

Miscellaneous databases

GenomeRNAii127281.
PROiQ8TBF2.

Gene expression databases

BgeeiENSG00000157870.
CleanExiHS_C1orf93.
ExpressionAtlasiQ8TBF2. baseline and differential.
GenevisibleiQ8TBF2. HS.

Family and domain databases

InterProiIPR032802. FAM213.
IPR032801. FAM213/AAED1.
IPR012336. Thioredoxin-like_fold.
[Graphical view]
PANTHERiPTHR28630. PTHR28630. 1 hit.
PTHR28630:SF2. PTHR28630:SF2. 1 hit.
PfamiPF13911. AhpC-TSA_2. 1 hit.
[Graphical view]
SUPFAMiSSF52833. SSF52833. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiPGFS_HUMAN
AccessioniPrimary (citable) accession number: Q8TBF2
Secondary accession number(s): A8K793
, B3KPY3, B4DQR9, B4E0S5, B7ZAC8, B9DI90, B9DI92, J3KQD0, Q8N2H0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: June 1, 2002
Last modified: November 2, 2016
This is version 115 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.