Q8TBF2 (PGFS_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 85.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Prostamide/prostaglandin F synthase Short name=Prostamide/PG F synthase Short name=Prostamide/PGF synthase EC=1.11.1.20 Alternative name(s): Protein FAM213B | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 198 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Catalyzes the reduction of prostaglandin-ethanolamide H2 (prostamide H2) to prostamide F(2alpha) with NADPH as proton donor. Also able to reduce prostaglandin H2 to prostaglandin F(2alpha) By similarity. |
| Catalytic activity | Thioredoxin + prostaglandin H2 = thioredoxin disulfide + prostaglandin F(2-alpha). |
| Subcellular location | |
| Sequence similarities | Belongs to the peroxiredoxin-like FAM213 family. prostamide/prostaglandin F synthase subfamily. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Fatty acid biosynthesis Fatty acid metabolism Lipid biosynthesis Lipid metabolism Prostaglandin biosynthesis Prostaglandin metabolism |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Ligand | NADP |
| Molecular function | Oxidoreductase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | prostaglandin biosynthetic process Inferred from sequence or structural similarity. Source: UniProtKB |
| Cellular_component | cytosol Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Inferred from sequence or structural similarity. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8TBF2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8TBF2-2) The sequence of this isoform differs from the canonical sequence as follows: 154-198: GGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV → EVPRRLRPQGAHPAGPGHLCGGLCQRPASV | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8TBF2-3) The sequence of this isoform differs from the canonical sequence as follows: 106-106: K → KRLWTQASPEFGQATWCLR | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q8TBF2-4) The sequence of this isoform differs from the canonical sequence as follows: 129-164: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q8TBF2-5) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MSRERGSRSEEPGAGNRESGSREPGLAAAAM 128-164: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: Q8TBF2-6) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MSRERGSRSEEPGAGNRESGSREPGLAAAAM 130-164: KAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQ → VPTPDRPRLLASRGTCLGTCCRAEGCWWSAK | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: Q8TBF2-7) The sequence of this isoform differs from the canonical sequence as follows: 106-106: K → KRLWTQASPEFGQATWCLR 154-198: GGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV → EVPRRLRPQGAHPAGPGHLCGGLCQRPASV | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 198 | 198 | Prostamide/prostaglandin F synthase | PRO_0000284637 | |||||
Amino acid modifications | |||||||||
| Modified residue | 108 | 1 | Phosphotyrosine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MSRERGSRSEEPGAGNRESG SREPGLAAAAM in isoform 5 and isoform 6. | VSP_040900 | |||||
| Alternative sequence | 106 | 1 | K → KRLWTQASPEFGQATWCLR in isoform 3 and isoform 7. | VSP_040901 | |||||
| Alternative sequence | 128 – 164 | 37 | Missing in isoform 5. | VSP_040902 | |||||
| Alternative sequence | 129 – 164 | 36 | Missing in isoform 4. | VSP_040903 | |||||
| Alternative sequence | 130 – 164 | 35 | KAVGI…LHFVQ → VPTPDRPRLLASRGTCLGTC CRAEGCWWSAK in isoform 6. | VSP_040904 | |||||
| Alternative sequence | 154 – 198 | 45 | GGDKV…CDREV → EVPRRLRPQGAHPAGPGHLC GGLCQRPASV in isoform 2 and isoform 7. | VSP_024581 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4; 5 AND 6). Tissue: Neuroepithelioma, Teratocarcinoma, Thymus and Thyroid. |
| [2] | Guo J.H., She X.Y., Yu L. Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK057027 mRNA. Translation: BAG51845.1. AK075273 mRNA. Translation: BAC11511.1. AK291908 mRNA. Translation: BAF84597.1. AK298926 mRNA. Translation: BAG61031.1. AK303504 mRNA. Translation: BAG64537.1. AK316243 mRNA. Translation: BAH14614.1. AF425266 mRNA. Translation: AAP97295.1. AL139246 Genomic DNA. Translation: CAX30825.1. AL139246 Genomic DNA. Translation: CAX30826.1. AL139246 Genomic DNA. Translation: CAX30827.1. CH471183 Genomic DNA. Translation: EAW56086.1. CH471183 Genomic DNA. Translation: EAW56087.1. CH471183 Genomic DNA. Translation: EAW56088.1. BC022547 mRNA. Translation: AAH22547.1. |
| IPI | IPI00152199. IPI00383997. IPI00643409. IPI00908363. IPI00910916. IPI00976876. IPI01008862. |
| RefSeq | NP_001182665.1. NM_001195736.1. NP_001182666.1. NM_001195737.1. NP_001182667.1. NM_001195738.1. NP_001182669.1. NM_001195740.1. NP_001182670.1. NM_001195741.1. NP_689584.2. NM_152371.3. |
| UniGene | Hs.462033. |
3D structure databases | |
| ProteinModelPortal | Q8TBF2. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000367682. |
PTM databases | |
| PhosphoSite | Q8TBF2. |
Polymorphism databases | |
| DMDM | 74760424. |
Proteomic databases | |
| PaxDb | Q8TBF2. |
| PRIDE | Q8TBF2. |
Protocols and materials databases | |
| DNASU | 127281. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000378425; ENSP00000367682; ENSG00000157870. ENST00000444521; ENSP00000413218; ENSG00000157870. ENST00000537325; ENSP00000443605; ENSG00000157870. |
| GeneID | 127281. |
| KEGG | hsa:127281. |
| UCSC | uc001aju.2. human. uc001ajv.2. human. uc001ajw.2. human. uc010nzd.2. human. uc010nze.2. human. uc010nzf.2. human. |
Organism-specific databases | |
| CTD | 127281. |
| GeneCards | GC01P002517. |
| HGNC | HGNC:28390. FAM213B. |
| HPA | HPA006403. |
| neXtProt | NX_Q8TBF2. |
| PharmGKB | PA142672477. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG276778. |
| HOVERGEN | HBG106494. |
| KO | K15717. |
| OrthoDB | EOG42822R. |
| PhylomeDB | Q8TBF2. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. |
Gene expression databases | |
| Bgee | Q8TBF2. |
| CleanEx | HS_C1orf93. |
| Genevestigator | Q8TBF2. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 127281. |
| NextBio | 82055. |
Entry information
| Entry name | PGFS_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8TBF2 Secondary accession number(s): A8K793 Q8N2H0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
