Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8TBF2

- PGFS_HUMAN

UniProt

Q8TBF2 - PGFS_HUMAN

Protein

Prostamide/prostaglandin F synthase

Gene

FAM213B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 98 (01 Oct 2014)
      Sequence version 1 (01 Jun 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalyzes the reduction of prostaglandin-ethanolamide H2 (prostamide H2) to prostamide F(2alpha) with NADPH as proton donor. Also able to reduce prostaglandin H2 to prostaglandin F(2alpha) By similarity.By similarity

    Catalytic activityi

    Thioredoxin + prostaglandin H2 = thioredoxin disulfide + prostaglandin F(2-alpha).

    GO - Molecular functioni

    1. oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Source: UniProtKB
    2. prostaglandin-F synthase activity Source: UniProt

    GO - Biological processi

    1. arachidonic acid metabolic process Source: Reactome
    2. cyclooxygenase pathway Source: Reactome
    3. prostaglandin biosynthetic process Source: UniProtKB
    4. small molecule metabolic process Source: Reactome

    Keywords - Molecular functioni

    Oxidoreductase

    Keywords - Biological processi

    Fatty acid biosynthesis, Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism, Prostaglandin biosynthesis, Prostaglandin metabolism

    Keywords - Ligandi

    NADP

    Enzyme and pathway databases

    ReactomeiREACT_150149. Synthesis of Prostaglandins (PG) and Thromboxanes (TX).

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Prostamide/prostaglandin F synthase (EC:1.11.1.20)
    Short name:
    Prostamide/PG F synthase
    Short name:
    Prostamide/PGF synthase
    Alternative name(s):
    Protein FAM213B
    Gene namesi
    Name:FAM213B
    Synonyms:C1orf93
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:28390. FAM213B.

    Subcellular locationi

    Cytoplasmcytosol By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProt
    2. cytosol Source: UniProtKB-SubCell
    3. endoplasmic reticulum Source: UniProt
    4. extracellular vesicular exosome Source: UniProt
    5. myelin sheath Source: UniProt

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142672477.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 198198Prostamide/prostaglandin F synthasePRO_0000284637Add
    BLAST

    Proteomic databases

    MaxQBiQ8TBF2.
    PaxDbiQ8TBF2.
    PRIDEiQ8TBF2.

    PTM databases

    PhosphoSiteiQ8TBF2.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8TBF2.
    BgeeiQ8TBF2.
    CleanExiHS_C1orf93.
    GenevestigatoriQ8TBF2.

    Organism-specific databases

    HPAiHPA006403.

    Interactioni

    Protein-protein interaction databases

    BioGridi126049. 3 interactions.
    IntActiQ8TBF2. 2 interactions.
    MINTiMINT-8247583.
    STRINGi9606.ENSP00000367682.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8TBF2.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiNOG276778.
    HOVERGENiHBG106494.
    KOiK15717.
    PhylomeDBiQ8TBF2.

    Family and domain databases

    InterProiIPR012336. Thioredoxin-like_fold.
    [Graphical view]
    SUPFAMiSSF52833. SSF52833. 1 hit.

    Sequences (8)i

    Sequence statusi: Complete.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8TBF2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSTVDLARVG ACILKHAVTG EAVELRSLWR EHACVVAGLR RFGCVVCRWI    50
    AQDLSSLAGL LDQHGVRLVG VGPEALGLQE FLDGDYFAGE LYLDESKQLY 100
    KELGFKRYNS LSILPAALGK PVRDVAAKAK AVGIQGNLSG DLLQSGGLLV 150
    VSKGGDKVLL HFVQKSPGDY VPKEHILQVL GISAEVCASD PPQCDREV 198
    Length:198
    Mass (Da):21,223
    Last modified:June 1, 2002 - v1
    Checksum:i5E846BAFF44BA7FF
    GO
    Isoform 2 (identifier: Q8TBF2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         154-198: GGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV → EVPRRLRPQGAHPAGPGHLCGGLCQRPASV

    Note: No experimental confirmation available.

    Show »
    Length:183
    Mass (Da):19,465
    Checksum:iFD28CF6BCD965AB4
    GO
    Isoform 3 (identifier: Q8TBF2-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         106-106: K → KRLWTQASPEFGQATWCLR

    Note: No experimental confirmation available.

    Show »
    Length:216
    Mass (Da):23,355
    Checksum:iE48960669AE1407A
    GO
    Isoform 4 (identifier: Q8TBF2-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         129-164: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:162
    Mass (Da):17,621
    Checksum:iA86C8C59A5F7456D
    GO
    Isoform 5 (identifier: Q8TBF2-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MSRERGSRSEEPGAGNRESGSREPGLAAAAM
         128-164: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:191
    Mass (Da):20,548
    Checksum:iAF2E4226898F0347
    GO
    Isoform 6 (identifier: Q8TBF2-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MSRERGSRSEEPGAGNRESGSREPGLAAAAM
         130-164: KAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQ → VPTPDRPRLLASRGTCLGTCCRAEGCWWSAK

    Note: No experimental confirmation available.

    Show »
    Length:224
    Mass (Da):24,122
    Checksum:iB34697403B2FE08B
    GO
    Isoform 7 (identifier: Q8TBF2-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         106-106: K → KRLWTQASPEFGQATWCLR
         154-198: GGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV → EVPRRLRPQGAHPAGPGHLCGGLCQRPASV

    Note: No experimental confirmation available.

    Show »
    Length:201
    Mass (Da):21,597
    Checksum:i5AAB99C720FB6697
    GO
    Isoform 8 (identifier: Q8TBF2-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MSRERGSRSEEPGAGNRESGSREPGLAAAAM

    Note: No experimental confirmation available.

    Show »
    Length:228
    Mass (Da):24,278
    Checksum:i3DD873AAED8AEA71
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MSRERGSRSEEPGAGNRESG SREPGLAAAAM in isoform 5, isoform 6 and isoform 8. 1 PublicationVSP_040900
    Alternative sequencei106 – 1061K → KRLWTQASPEFGQATWCLR in isoform 3 and isoform 7. 1 PublicationVSP_040901
    Alternative sequencei128 – 16437Missing in isoform 5. 1 PublicationVSP_040902Add
    BLAST
    Alternative sequencei129 – 16436Missing in isoform 4. 1 PublicationVSP_040903Add
    BLAST
    Alternative sequencei130 – 16435KAVGI…LHFVQ → VPTPDRPRLLASRGTCLGTC CRAEGCWWSAK in isoform 6. 1 PublicationVSP_040904Add
    BLAST
    Alternative sequencei154 – 19845GGDKV…CDREV → EVPRRLRPQGAHPAGPGHLC GGLCQRPASV in isoform 2 and isoform 7. 1 PublicationVSP_024581Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK057027 mRNA. Translation: BAG51845.1.
    AK075273 mRNA. Translation: BAC11511.1.
    AK291908 mRNA. Translation: BAF84597.1.
    AK298926 mRNA. Translation: BAG61031.1.
    AK303504 mRNA. Translation: BAG64537.1.
    AK316243 mRNA. Translation: BAH14614.1.
    AF425266 mRNA. Translation: AAP97295.1.
    AL139246 Genomic DNA. Translation: CAX30825.1.
    AL139246 Genomic DNA. Translation: CAX30826.1.
    AL139246 Genomic DNA. Translation: CAX30827.1.
    CH471183 Genomic DNA. Translation: EAW56086.1.
    CH471183 Genomic DNA. Translation: EAW56087.1.
    CH471183 Genomic DNA. Translation: EAW56088.1.
    BC022547 mRNA. Translation: AAH22547.1.
    CCDSiCCDS44.2. [Q8TBF2-8]
    CCDS55564.1. [Q8TBF2-5]
    RefSeqiNP_001182665.1. NM_001195736.1.
    NP_001182666.1. NM_001195737.1. [Q8TBF2-6]
    NP_001182667.1. NM_001195738.1.
    NP_001182669.1. NM_001195740.1.
    NP_001182670.1. NM_001195741.1. [Q8TBF2-5]
    NP_689584.2. NM_152371.3. [Q8TBF2-8]
    UniGeneiHs.462033.

    Genome annotation databases

    EnsembliENST00000378425; ENSP00000367682; ENSG00000157870. [Q8TBF2-1]
    ENST00000419916; ENSP00000394405; ENSG00000157870. [Q8TBF2-8]
    ENST00000444521; ENSP00000413218; ENSG00000157870. [Q8TBF2-3]
    ENST00000537325; ENSP00000443605; ENSG00000157870. [Q8TBF2-5]
    GeneIDi127281.
    KEGGihsa:127281.
    UCSCiuc001ajv.2. human. [Q8TBF2-3]
    uc010nzd.2. human. [Q8TBF2-6]
    uc010nze.2. human. [Q8TBF2-4]
    uc010nzf.2. human. [Q8TBF2-5]

    Polymorphism databases

    DMDMi74760424.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK057027 mRNA. Translation: BAG51845.1 .
    AK075273 mRNA. Translation: BAC11511.1 .
    AK291908 mRNA. Translation: BAF84597.1 .
    AK298926 mRNA. Translation: BAG61031.1 .
    AK303504 mRNA. Translation: BAG64537.1 .
    AK316243 mRNA. Translation: BAH14614.1 .
    AF425266 mRNA. Translation: AAP97295.1 .
    AL139246 Genomic DNA. Translation: CAX30825.1 .
    AL139246 Genomic DNA. Translation: CAX30826.1 .
    AL139246 Genomic DNA. Translation: CAX30827.1 .
    CH471183 Genomic DNA. Translation: EAW56086.1 .
    CH471183 Genomic DNA. Translation: EAW56087.1 .
    CH471183 Genomic DNA. Translation: EAW56088.1 .
    BC022547 mRNA. Translation: AAH22547.1 .
    CCDSi CCDS44.2. [Q8TBF2-8 ]
    CCDS55564.1. [Q8TBF2-5 ]
    RefSeqi NP_001182665.1. NM_001195736.1.
    NP_001182666.1. NM_001195737.1. [Q8TBF2-6 ]
    NP_001182667.1. NM_001195738.1.
    NP_001182669.1. NM_001195740.1.
    NP_001182670.1. NM_001195741.1. [Q8TBF2-5 ]
    NP_689584.2. NM_152371.3. [Q8TBF2-8 ]
    UniGenei Hs.462033.

    3D structure databases

    ProteinModelPortali Q8TBF2.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 126049. 3 interactions.
    IntActi Q8TBF2. 2 interactions.
    MINTi MINT-8247583.
    STRINGi 9606.ENSP00000367682.

    PTM databases

    PhosphoSitei Q8TBF2.

    Polymorphism databases

    DMDMi 74760424.

    Proteomic databases

    MaxQBi Q8TBF2.
    PaxDbi Q8TBF2.
    PRIDEi Q8TBF2.

    Protocols and materials databases

    DNASUi 127281.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000378425 ; ENSP00000367682 ; ENSG00000157870 . [Q8TBF2-1 ]
    ENST00000419916 ; ENSP00000394405 ; ENSG00000157870 . [Q8TBF2-8 ]
    ENST00000444521 ; ENSP00000413218 ; ENSG00000157870 . [Q8TBF2-3 ]
    ENST00000537325 ; ENSP00000443605 ; ENSG00000157870 . [Q8TBF2-5 ]
    GeneIDi 127281.
    KEGGi hsa:127281.
    UCSCi uc001ajv.2. human. [Q8TBF2-3 ]
    uc010nzd.2. human. [Q8TBF2-6 ]
    uc010nze.2. human. [Q8TBF2-4 ]
    uc010nzf.2. human. [Q8TBF2-5 ]

    Organism-specific databases

    CTDi 127281.
    GeneCardsi GC01P002517.
    HGNCi HGNC:28390. FAM213B.
    HPAi HPA006403.
    neXtProti NX_Q8TBF2.
    PharmGKBi PA142672477.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG276778.
    HOVERGENi HBG106494.
    KOi K15717.
    PhylomeDBi Q8TBF2.

    Enzyme and pathway databases

    Reactomei REACT_150149. Synthesis of Prostaglandins (PG) and Thromboxanes (TX).

    Miscellaneous databases

    GenomeRNAii 127281.
    NextBioi 35535316.
    PROi Q8TBF2.

    Gene expression databases

    ArrayExpressi Q8TBF2.
    Bgeei Q8TBF2.
    CleanExi HS_C1orf93.
    Genevestigatori Q8TBF2.

    Family and domain databases

    InterProi IPR012336. Thioredoxin-like_fold.
    [Graphical view ]
    SUPFAMi SSF52833. SSF52833. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4; 5 AND 6).
      Tissue: Neuroepithelioma, Teratocarcinoma, Thymus and Thyroid.
    2. Guo J.H., She X.Y., Yu L.
      Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    3. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.

    Entry informationi

    Entry nameiPGFS_HUMAN
    AccessioniPrimary (citable) accession number: Q8TBF2
    Secondary accession number(s): A8K793
    , B3KPY3, B4DQR9, B4E0S5, B7ZAC8, B9DI90, B9DI92, J3KQD0, Q8N2H0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 17, 2007
    Last sequence update: June 1, 2002
    Last modified: October 1, 2014
    This is version 98 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3