Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger and SCAN domain-containing protein 18

Gene

ZSCAN18

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri413 – 43523C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri441 – 46323C2H2-type 2PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger and SCAN domain-containing protein 18
Alternative name(s):
Zinc finger protein 447
Gene namesi
Name:ZSCAN18
Synonyms:ZNF447
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:21037. ZSCAN18.

Subcellular locationi

  • Nucleus PROSITE-ProRule annotation

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162410959.

Polymorphism and mutation databases

BioMutaiZSCAN18.
DMDMi148887469.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 510510Zinc finger and SCAN domain-containing protein 18PRO_0000243921Add
BLAST

Proteomic databases

EPDiQ8TBC5.
MaxQBiQ8TBC5.
PaxDbiQ8TBC5.
PeptideAtlasiQ8TBC5.
PRIDEiQ8TBC5.

PTM databases

iPTMnetiQ8TBC5.
PhosphoSiteiQ8TBC5.

Expressioni

Gene expression databases

BgeeiQ8TBC5.
CleanExiHS_ZSCAN18.
ExpressionAtlasiQ8TBC5. baseline and differential.
GenevisibleiQ8TBC5. HS.

Organism-specific databases

HPAiHPA024318.

Interactioni

Protein-protein interaction databases

BioGridi122432. 11 interactions.
IntActiQ8TBC5. 2 interactions.
STRINGi9606.ENSP00000470123.

Structurei

3D structure databases

ProteinModelPortaliQ8TBC5.
SMRiQ8TBC5. Positions 46-127, 411-499.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini49 – 13183SCAN boxPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 2 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 SCAN box domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri413 – 43523C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri441 – 46323C2H2-type 2PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00680000099963.
HOGENOMiHOG000069918.
HOVERGENiHBG102360.
InParanoidiQ8TBC5.
KOiK09230.
OMAiTKRPHPE.
OrthoDBiEOG75J0M6.
PhylomeDBiQ8TBC5.

Family and domain databases

Gene3Di3.30.160.60. 2 hits.
InterProiIPR027775. C2H2_Znf_fam.
IPR008916. Retrov_capsid_C.
IPR003309. SCAN_dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PANTHERiPTHR10032. PTHR10032. 1 hit.
PfamiPF02023. SCAN. 1 hit.
[Graphical view]
SMARTiSM00431. SCAN. 1 hit.
SM00355. ZnF_C2H2. 2 hits.
[Graphical view]
SUPFAMiSSF47353. SSF47353. 1 hit.
PROSITEiPS50804. SCAN_BOX. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 2 hits.
PS50157. ZINC_FINGER_C2H2_2. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TBC5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLPLEKAFAS PRSSPAPPDL PTPGSAAGVQ QEEPETIPER TPADLEFSRL
60 70 80 90 100
RFREFVYQEA AGPHQTLARL HELCRQWLMP EARSKEQMLE LLVLEQFLGI
110 120 130 140 150
LPDKVRPWVV AQYPESCKKA ASLVEGLADV LEEPGMLLGS PAGSSSILSD
160 170 180 190 200
GVYERHMDPL LLPGELASPS QALGAGEIPA PSETPWLSPD PLFLEQRRVR
210 220 230 240 250
EAKTEEDGPA NTEQKLKSFP EDPQHLGEWG HLDPAEENLK SYRKLLLWGY
260 270 280 290 300
QLSQPDAASR LDTEELRLVE RDPQGSSLPE GGRRQESAGC ACEEAAPAGV
310 320 330 340 350
LPELPTEAPP GDALADPPSG TTEEEEEQPG KAPDPQDPQD AESDSATGSQ
360 370 380 390 400
RQSVIQQPAP DRGTAKLGTK RPHPEDGDGQ SLEGVSSSGD SAGLEAGQGP
410 420 430 440 450
GADEPGLSRG KPYACGECGE AFAWLSHLME HHSSHGGRKR YACQGCWKTF
460 470 480 490 500
HFSLALAEHQ KTHEKEKSYA LGGARGPQPS TREAQAGARA GGPPESVEGE
510
APPAPPEAQR
Length:510
Mass (Da):54,804
Last modified:June 12, 2007 - v2
Checksum:iCC767376B4E029FD
GO
Isoform 2 (identifier: Q8TBC5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     280-280: Missing.

Note: No experimental confirmation available.
Show »
Length:509
Mass (Da):54,675
Checksum:i8F5B7A99588DDAAA
GO
Isoform 3 (identifier: Q8TBC5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRRVGGRADEDATAAGSLWVLAPPEPTGHLVIPGTSPLEPPCPWLDSHIFQCRFGKM

Note: No experimental confirmation available.
Show »
Length:566
Mass (Da):60,825
Checksum:iE2F71AF88B3D83E5
GO
Isoform 4 (identifier: Q8TBC5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-135: Missing.
     280-280: Missing.

Note: No experimental confirmation available.
Show »
Length:374
Mass (Da):39,590
Checksum:i3CC33B737BF19B2E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti389 – 3891G → S in BAB14332 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti379 – 3791G → E.2 Publications
Corresponds to variant rs2258557 [ dbSNP | Ensembl ].
VAR_026871

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 135135Missing in isoform 4. CuratedVSP_047060Add
BLAST
Alternative sequencei1 – 11M → MRRVGGRADEDATAAGSLWV LAPPEPTGHLVIPGTSPLEP PCPWLDSHIFQCRFGKM in isoform 3. 1 PublicationVSP_043272
Alternative sequencei280 – 2801Missing in isoform 2 and isoform 4. 1 PublicationVSP_019497

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY280799 mRNA. Translation: AAQ16303.1.
AK022957 mRNA. Translation: BAB14332.1.
AK294376 mRNA. Translation: BAG57634.1.
AC008751 Genomic DNA. No translation available.
BC006205 mRNA. Translation: AAH06205.2.
BC022846 mRNA. Translation: AAH22846.1.
CCDSiCCDS12971.1. [Q8TBC5-1]
CCDS46214.1. [Q8TBC5-3]
CCDS46215.1. [Q8TBC5-4]
RefSeqiNP_001139014.1. NM_001145542.1. [Q8TBC5-3]
NP_001139015.1. NM_001145543.1. [Q8TBC5-1]
NP_001139016.1. NM_001145544.1. [Q8TBC5-4]
NP_076415.3. NM_023926.4. [Q8TBC5-1]
XP_005259231.1. XM_005259174.3. [Q8TBC5-1]
XP_006723398.1. XM_006723335.2. [Q8TBC5-1]
XP_011525540.1. XM_011527238.1. [Q8TBC5-1]
XP_011525541.1. XM_011527239.1. [Q8TBC5-1]
UniGeneiHs.235390.

Genome annotation databases

EnsembliENST00000240727; ENSP00000240727; ENSG00000121413. [Q8TBC5-1]
ENST00000421612; ENSP00000392653; ENSG00000121413. [Q8TBC5-4]
ENST00000600404; ENSP00000470123; ENSG00000121413. [Q8TBC5-3]
ENST00000601144; ENSP00000468934; ENSG00000121413. [Q8TBC5-1]
GeneIDi65982.
KEGGihsa:65982.
UCSCiuc002qrh.3. human. [Q8TBC5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY280799 mRNA. Translation: AAQ16303.1.
AK022957 mRNA. Translation: BAB14332.1.
AK294376 mRNA. Translation: BAG57634.1.
AC008751 Genomic DNA. No translation available.
BC006205 mRNA. Translation: AAH06205.2.
BC022846 mRNA. Translation: AAH22846.1.
CCDSiCCDS12971.1. [Q8TBC5-1]
CCDS46214.1. [Q8TBC5-3]
CCDS46215.1. [Q8TBC5-4]
RefSeqiNP_001139014.1. NM_001145542.1. [Q8TBC5-3]
NP_001139015.1. NM_001145543.1. [Q8TBC5-1]
NP_001139016.1. NM_001145544.1. [Q8TBC5-4]
NP_076415.3. NM_023926.4. [Q8TBC5-1]
XP_005259231.1. XM_005259174.3. [Q8TBC5-1]
XP_006723398.1. XM_006723335.2. [Q8TBC5-1]
XP_011525540.1. XM_011527238.1. [Q8TBC5-1]
XP_011525541.1. XM_011527239.1. [Q8TBC5-1]
UniGeneiHs.235390.

3D structure databases

ProteinModelPortaliQ8TBC5.
SMRiQ8TBC5. Positions 46-127, 411-499.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122432. 11 interactions.
IntActiQ8TBC5. 2 interactions.
STRINGi9606.ENSP00000470123.

PTM databases

iPTMnetiQ8TBC5.
PhosphoSiteiQ8TBC5.

Polymorphism and mutation databases

BioMutaiZSCAN18.
DMDMi148887469.

Proteomic databases

EPDiQ8TBC5.
MaxQBiQ8TBC5.
PaxDbiQ8TBC5.
PeptideAtlasiQ8TBC5.
PRIDEiQ8TBC5.

Protocols and materials databases

DNASUi65982.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000240727; ENSP00000240727; ENSG00000121413. [Q8TBC5-1]
ENST00000421612; ENSP00000392653; ENSG00000121413. [Q8TBC5-4]
ENST00000600404; ENSP00000470123; ENSG00000121413. [Q8TBC5-3]
ENST00000601144; ENSP00000468934; ENSG00000121413. [Q8TBC5-1]
GeneIDi65982.
KEGGihsa:65982.
UCSCiuc002qrh.3. human. [Q8TBC5-1]

Organism-specific databases

CTDi65982.
GeneCardsiZSCAN18.
HGNCiHGNC:21037. ZSCAN18.
HPAiHPA024318.
neXtProtiNX_Q8TBC5.
PharmGKBiPA162410959.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00680000099963.
HOGENOMiHOG000069918.
HOVERGENiHBG102360.
InParanoidiQ8TBC5.
KOiK09230.
OMAiTKRPHPE.
OrthoDBiEOG75J0M6.
PhylomeDBiQ8TBC5.

Miscellaneous databases

ChiTaRSiZSCAN18. human.
GenomeRNAii65982.
PROiQ8TBC5.

Gene expression databases

BgeeiQ8TBC5.
CleanExiHS_ZSCAN18.
ExpressionAtlasiQ8TBC5. baseline and differential.
GenevisibleiQ8TBC5. HS.

Family and domain databases

Gene3Di3.30.160.60. 2 hits.
InterProiIPR027775. C2H2_Znf_fam.
IPR008916. Retrov_capsid_C.
IPR003309. SCAN_dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PANTHERiPTHR10032. PTHR10032. 1 hit.
PfamiPF02023. SCAN. 1 hit.
[Graphical view]
SMARTiSM00431. SCAN. 1 hit.
SM00355. ZnF_C2H2. 2 hits.
[Graphical view]
SUPFAMiSSF47353. SSF47353. 1 hit.
PROSITEiPS50804. SCAN_BOX. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 2 hits.
PS50157. ZINC_FINGER_C2H2_2. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of a human novel znf gene."
    Luo K.T., Yu L.
    Submitted (APR-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT GLU-379.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Amygdala, Spleen and Teratocarcinoma.
  3. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 103-510 (ISOFORM 2), VARIANT GLU-379.
    Tissue: Muscle and Skin.

Entry informationi

Entry nameiZSC18_HUMAN
AccessioniPrimary (citable) accession number: Q8TBC5
Secondary accession number(s): B4DG23
, E9PBI0, Q9BRK7, Q9H9A0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 12, 2007
Last modified: July 6, 2016
This is version 124 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.