Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8TBB1

- LNX1_HUMAN

UniProt

Q8TBB1 - LNX1_HUMAN

Protein

E3 ubiquitin-protein ligase LNX

Gene

LNX1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 122 (01 Oct 2014)
      Sequence version 1 (01 Jun 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of NUMB. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates ubiquitination of isoform p66 and isoform p72 of NUMB, but not that of isoform p71 or isoform p65 By similarity.By similarity
    Isoform 2 provides an endocytic scaffold for IGSF5/JAM4.By similarity

    Pathwayi

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri41 – 7939RING-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. ligase activity Source: UniProtKB-KW
    2. protein binding Source: IntAct
    3. ubiquitin-protein transferase activity Source: Ensembl
    4. zinc ion binding Source: InterPro

    GO - Biological processi

    1. protein homooligomerization Source: Ensembl
    2. protein ubiquitination involved in ubiquitin-dependent protein catabolic process Source: Ensembl

    Keywords - Molecular functioni

    Ligase

    Keywords - Biological processi

    Ubl conjugation pathway

    Keywords - Ligandi

    Metal-binding, Zinc

    Enzyme and pathway databases

    UniPathwayiUPA00143.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    E3 ubiquitin-protein ligase LNX (EC:6.3.2.-)
    Alternative name(s):
    Ligand of Numb-protein X 1
    Numb-binding protein 1
    PDZ domain-containing RING finger protein 2
    Gene namesi
    Name:LNX1
    Synonyms:LNX, PDZRN2
    ORF Names:UNQ574/PRO1136
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:6657. LNX1.

    Subcellular locationi

    Cytoplasm By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30419.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 728728E3 ubiquitin-protein ligase LNXPRO_0000055913Add
    BLAST

    Proteomic databases

    PaxDbiQ8TBB1.
    PRIDEiQ8TBB1.

    PTM databases

    PhosphoSiteiQ8TBB1.

    Expressioni

    Tissue specificityi

    Expressed in heart, placenta, kidney, pancreas and brain.1 Publication

    Gene expression databases

    ArrayExpressiQ8TBB1.
    BgeeiQ8TBB1.
    CleanExiHS_LNX1.
    GenevestigatoriQ8TBB1.

    Organism-specific databases

    HPAiHPA002235.

    Interactioni

    Subunit structurei

    Interacts with the phosphotyrosine interaction domain of all isoforms of NUMB By similarity. Interacts with MAGEB18 and MAGEF1. Interacts with the Coxsackievirus and adenovirus receptor CXADR. Interacts with endogenous retrovirus K protein Np9. IGSF5/JAM4 interacts with isoform 2 through the second PDZ domain, other isoforms may also interact with IGSF5/JAM4 By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    COILP384322EBI-739832,EBI-945751
    INPP5KQ9BT403EBI-739832,EBI-749162
    MAGEB18Q96M616EBI-739832,EBI-741835
    NAGKQ9UJ702EBI-739832,EBI-372578
    PAFAH1B3Q151022EBI-739832,EBI-711522
    SRCP129316EBI-739832,EBI-621482

    Protein-protein interaction databases

    BioGridi124219. 146 interactions.
    IntActiQ8TBB1. 54 interactions.
    MINTiMINT-1441889.
    STRINGi9606.ENSP00000263925.

    Structurei

    Secondary structure

    1
    728
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi504 – 5118
    Beta strandi520 – 5245
    Beta strandi535 – 5406
    Helixi545 – 5495
    Beta strandi557 – 5615
    Helixi566 – 5683
    Helixi571 – 5799
    Beta strandi583 – 59412

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3B76X-ray1.75A/B504-594[»]
    ProteinModelPortaliQ8TBB1.
    SMRiQ8TBB1. Positions 41-129, 273-722.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ8TBB1.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini274 – 35986PDZ 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini381 – 46484PDZ 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini507 – 59387PDZ 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini638 – 72487PDZ 4PROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni186 – 24459Interaction with MAGEB18Add
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi181 – 1844NPXY motif

    Domaini

    The NPXY motif is required for the interaction with the PID domain of NUMB. It is however not sufficient.
    The PDZ 1 domain participates in the interaction with the PID domain of NUMB, and participates in the isoform-specific ubiquitination of NUMB. The PDZ 2 domain of isoform 2 participates in the interaction with IGSF5/JAM4, other isoforms containing this domain may also interact with IGSF5/JAM4 By similarity.By similarity

    Sequence similaritiesi

    Contains 4 PDZ (DHR) domains.PROSITE-ProRule annotation
    Contains 1 RING-type zinc finger.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri41 – 7939RING-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG236845.
    HOGENOMiHOG000261605.
    HOVERGENiHBG039539.
    InParanoidiQ8TBB1.
    KOiK10692.
    OMAiVFPRLYH.
    OrthoDBiEOG75F4CJ.
    PhylomeDBiQ8TBB1.
    TreeFamiTF330709.

    Family and domain databases

    Gene3Di2.30.42.10. 4 hits.
    3.30.40.10. 1 hit.
    InterProiIPR001478. PDZ.
    IPR018957. Znf_C3HC4_RING-type.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    IPR017907. Znf_RING_CS.
    [Graphical view]
    PfamiPF00595. PDZ. 4 hits.
    PF00097. zf-C3HC4. 1 hit.
    [Graphical view]
    SMARTiSM00228. PDZ. 4 hits.
    SM00184. RING. 1 hit.
    [Graphical view]
    SUPFAMiSSF50156. SSF50156. 4 hits.
    PROSITEiPS50106. PDZ. 4 hits.
    PS00518. ZF_RING_1. 1 hit.
    PS50089. ZF_RING_2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8TBB1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MNQPESANDP EPLCAVCGQA HSLEENHFYS YPEEVDDDLI CHICLQALLD    50
    PLDTPCGHTY CTLCLTNFLV EKDFCPMDRK PLVLQHCKKS SILVNKLLNK 100
    LLVTCPFREH CTQVLQRCDL EHHFQTSCKG ASHYGLTKDR KRRSQDGCPD 150
    GCASLTATAP SPEVSAAATI SLMTDEPGLD NPAYVSSAED GQPAISPVDS 200
    GRSNRTRARP FERSTIRSRS FKKINRALSV LRRTKSGSAV ANHADQGREN 250
    SENTTAPEVF PRLYHLIPDG EITSIKINRV DPSESLSIRL VGGSETPLVH 300
    IIIQHIYRDG VIARDGRLLP GDIILKVNGM DISNVPHNYA VRLLRQPCQV 350
    LWLTVMREQK FRSRNNGQAP DAYRPRDDSF HVILNKSSPE EQLGIKLVRK 400
    VDEPGVFIFN VLDGGVAYRH GQLEENDRVL AINGHDLRYG SPESAAHLIQ 450
    ASERRVHLVV SRQVRQRSPD IFQEAGWNSN GSWSPGPGER SNTPKPLHPT 500
    ITCHEKVVNI QKDPGESLGM TVAGGASHRE WDLPIYVISV EPGGVISRDG 550
    RIKTGDILLN VDGVELTEVS RSEAVALLKR TSSSIVLKAL EVKEYEPQED 600
    CSSPAALDSN HNMAPPSDWS PSWVMWLELP RCLYNCKDIV LRRNTAGSLG 650
    FCIVGGYEEY NGNKPFFIKS IVEGTPAYND GRIRCGDILL AVNGRSTSGM 700
    IHACLARLLK ELKGRITLTI VSWPGTFL 728
    Length:728
    Mass (Da):80,629
    Last modified:June 1, 2002 - v1
    Checksum:i5590E8D8976AE093
    GO
    Isoform 2 (identifier: Q8TBB1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-127: MNQPESANDP...CDLEHHFQTS → MKALLLLVLPWLSPANYIDNVGNLHFLYSEL

    Show »
    Length:632
    Mass (Da):69,643
    Checksum:i1B343BEF469CB005
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti132 – 1321S → F in AAK15039. (PubMed:11521506)Curated
    Sequence conflicti321 – 3211G → R in BAB71291. (PubMed:14702039)Curated
    Sequence conflicti366 – 3661N → T in BAB71291. (PubMed:14702039)Curated
    Sequence conflicti411 – 4111V → A in BAB71291. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 127127MNQPE…HFQTS → MKALLLLVLPWLSPANYIDN VGNLHFLYSEL in isoform 2. 3 PublicationsVSP_005733Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF237782 mRNA. Translation: AAK15039.1.
    AY358326 mRNA. Translation: AAQ88692.1.
    AK056823 mRNA. Translation: BAB71291.1.
    AC058822 Genomic DNA. No translation available.
    AC095040 Genomic DNA. Translation: AAY41000.1.
    BC022983 mRNA. Translation: AAH22983.1.
    BC034737 mRNA. Translation: AAH34737.1.
    CCDSiCCDS3492.1. [Q8TBB1-2]
    CCDS47057.1. [Q8TBB1-1]
    RefSeqiNP_001119800.1. NM_001126328.2. [Q8TBB1-1]
    NP_116011.2. NM_032622.2. [Q8TBB1-2]
    XP_005265842.1. XM_005265785.2. [Q8TBB1-1]
    XP_005265843.1. XM_005265786.2. [Q8TBB1-1]
    UniGeneiHs.518760.

    Genome annotation databases

    EnsembliENST00000263925; ENSP00000263925; ENSG00000072201. [Q8TBB1-1]
    ENST00000306888; ENSP00000302879; ENSG00000072201. [Q8TBB1-2]
    GeneIDi84708.
    KEGGihsa:84708.
    UCSCiuc003haf.4. human. [Q8TBB1-2]
    uc003hag.5. human. [Q8TBB1-1]

    Polymorphism databases

    DMDMi29840786.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF237782 mRNA. Translation: AAK15039.1 .
    AY358326 mRNA. Translation: AAQ88692.1 .
    AK056823 mRNA. Translation: BAB71291.1 .
    AC058822 Genomic DNA. No translation available.
    AC095040 Genomic DNA. Translation: AAY41000.1 .
    BC022983 mRNA. Translation: AAH22983.1 .
    BC034737 mRNA. Translation: AAH34737.1 .
    CCDSi CCDS3492.1. [Q8TBB1-2 ]
    CCDS47057.1. [Q8TBB1-1 ]
    RefSeqi NP_001119800.1. NM_001126328.2. [Q8TBB1-1 ]
    NP_116011.2. NM_032622.2. [Q8TBB1-2 ]
    XP_005265842.1. XM_005265785.2. [Q8TBB1-1 ]
    XP_005265843.1. XM_005265786.2. [Q8TBB1-1 ]
    UniGenei Hs.518760.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3B76 X-ray 1.75 A/B 504-594 [» ]
    ProteinModelPortali Q8TBB1.
    SMRi Q8TBB1. Positions 41-129, 273-722.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124219. 146 interactions.
    IntActi Q8TBB1. 54 interactions.
    MINTi MINT-1441889.
    STRINGi 9606.ENSP00000263925.

    PTM databases

    PhosphoSitei Q8TBB1.

    Polymorphism databases

    DMDMi 29840786.

    Proteomic databases

    PaxDbi Q8TBB1.
    PRIDEi Q8TBB1.

    Protocols and materials databases

    DNASUi 84708.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000263925 ; ENSP00000263925 ; ENSG00000072201 . [Q8TBB1-1 ]
    ENST00000306888 ; ENSP00000302879 ; ENSG00000072201 . [Q8TBB1-2 ]
    GeneIDi 84708.
    KEGGi hsa:84708.
    UCSCi uc003haf.4. human. [Q8TBB1-2 ]
    uc003hag.5. human. [Q8TBB1-1 ]

    Organism-specific databases

    CTDi 84708.
    GeneCardsi GC04M054325.
    HGNCi HGNC:6657. LNX1.
    HPAi HPA002235.
    MIMi 609732. gene.
    neXtProti NX_Q8TBB1.
    PharmGKBi PA30419.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG236845.
    HOGENOMi HOG000261605.
    HOVERGENi HBG039539.
    InParanoidi Q8TBB1.
    KOi K10692.
    OMAi VFPRLYH.
    OrthoDBi EOG75F4CJ.
    PhylomeDBi Q8TBB1.
    TreeFami TF330709.

    Enzyme and pathway databases

    UniPathwayi UPA00143 .

    Miscellaneous databases

    EvolutionaryTracei Q8TBB1.
    GeneWikii LNX1.
    GenomeRNAii 84708.
    NextBioi 74806.
    PROi Q8TBB1.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8TBB1.
    Bgeei Q8TBB1.
    CleanExi HS_LNX1.
    Genevestigatori Q8TBB1.

    Family and domain databases

    Gene3Di 2.30.42.10. 4 hits.
    3.30.40.10. 1 hit.
    InterProi IPR001478. PDZ.
    IPR018957. Znf_C3HC4_RING-type.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    IPR017907. Znf_RING_CS.
    [Graphical view ]
    Pfami PF00595. PDZ. 4 hits.
    PF00097. zf-C3HC4. 1 hit.
    [Graphical view ]
    SMARTi SM00228. PDZ. 4 hits.
    SM00184. RING. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50156. SSF50156. 4 hits.
    PROSITEi PS50106. PDZ. 4 hits.
    PS00518. ZF_RING_1. 1 hit.
    PS50089. ZF_RING_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of a human LNX protein containing multiple PDZ domains."
      Xie Y., Zhao W., Wang W., Zhao S., Tang R., Ying K., Zhou Z., Mao Y.
      Biochem. Genet. 39:117-126(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
      Tissue: Fetal brain.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Prostate.
    4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain and Placenta.
    6. "The Coxsackievirus and adenovirus receptor (CAR) forms a complex with the PDZ domain-containing protein ligand-of-numb protein-X (LNX)."
      Sollerbrant K., Raschperger E., Mirza M., Engstroem U., Philipson L., Ljungdahl P.O., Pettersson R.F.
      J. Biol. Chem. 278:7439-7444(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CXADR.
    7. "Np9 protein of human endogenous retrovirus K interacts with ligand of numb protein X."
      Armbruester V., Sauter M., Roemer K., Best B., Hahn S., Nty A., Schmid A., Philipp S., Mueller A., Mueller-Lantzsch N.
      J. Virol. 78:10310-10319(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH NP9.
    8. "MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases."
      Doyle J.M., Gao J., Wang J., Yang M., Potts P.R.
      Mol. Cell 39:963-974(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH MAGEB18 AND MAGEF1.
    9. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiLNX1_HUMAN
    AccessioniPrimary (citable) accession number: Q8TBB1
    Secondary accession number(s): Q4W5K7
    , Q8N4C2, Q96MJ7, Q9BY20
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 28, 2003
    Last sequence update: June 1, 2002
    Last modified: October 1, 2014
    This is version 122 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    4. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3