Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8TBB1

- LNX1_HUMAN

UniProt

Q8TBB1 - LNX1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

E3 ubiquitin-protein ligase LNX

Gene

LNX1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of NUMB. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates ubiquitination of isoform p66 and isoform p72 of NUMB, but not that of isoform p71 or isoform p65 (By similarity).By similarity
Isoform 2 provides an endocytic scaffold for IGSF5/JAM4.By similarity

Pathwayi

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri41 – 7939RING-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. ligase activity Source: UniProtKB-KW
  2. ubiquitin-protein transferase activity Source: Ensembl
  3. zinc ion binding Source: InterPro

GO - Biological processi

  1. protein homooligomerization Source: Ensembl
  2. protein ubiquitination involved in ubiquitin-dependent protein catabolic process Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase LNX (EC:6.3.2.-)
Alternative name(s):
Ligand of Numb-protein X 1
Numb-binding protein 1
PDZ domain-containing RING finger protein 2
Gene namesi
Name:LNX1
Synonyms:LNX, PDZRN2
ORF Names:UNQ574/PRO1136
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:6657. LNX1.

Subcellular locationi

Cytoplasm By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30419.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 728728E3 ubiquitin-protein ligase LNXPRO_0000055913Add
BLAST

Proteomic databases

PaxDbiQ8TBB1.
PRIDEiQ8TBB1.

PTM databases

PhosphoSiteiQ8TBB1.

Expressioni

Tissue specificityi

Expressed in heart, placenta, kidney, pancreas and brain.1 Publication

Gene expression databases

BgeeiQ8TBB1.
CleanExiHS_LNX1.
ExpressionAtlasiQ8TBB1. baseline and differential.
GenevestigatoriQ8TBB1.

Organism-specific databases

HPAiHPA002235.

Interactioni

Subunit structurei

Interacts with the phosphotyrosine interaction domain of all isoforms of NUMB (By similarity). Interacts with MAGEB18 and MAGEF1. Interacts with the Coxsackievirus and adenovirus receptor CXADR. Interacts with endogenous retrovirus K protein Np9. IGSF5/JAM4 interacts with isoform 2 through the second PDZ domain, other isoforms may also interact with IGSF5/JAM4 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
COILP384322EBI-739832,EBI-945751
INPP5KQ9BT403EBI-739832,EBI-749162
MAGEB18Q96M616EBI-739832,EBI-741835
NAGKQ9UJ702EBI-739832,EBI-372578
PAFAH1B3Q151022EBI-739832,EBI-711522
SRCP129316EBI-739832,EBI-621482

Protein-protein interaction databases

BioGridi124219. 148 interactions.
IntActiQ8TBB1. 54 interactions.
MINTiMINT-1441889.
STRINGi9606.ENSP00000263925.

Structurei

Secondary structure

1
728
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi504 – 5118Combined sources
Beta strandi520 – 5245Combined sources
Beta strandi535 – 5406Combined sources
Helixi545 – 5495Combined sources
Beta strandi557 – 5615Combined sources
Helixi566 – 5683Combined sources
Helixi571 – 5799Combined sources
Beta strandi583 – 59412Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3B76X-ray1.75A/B504-594[»]
ProteinModelPortaliQ8TBB1.
SMRiQ8TBB1. Positions 41-129, 273-722.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8TBB1.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini274 – 35986PDZ 1PROSITE-ProRule annotationAdd
BLAST
Domaini381 – 46484PDZ 2PROSITE-ProRule annotationAdd
BLAST
Domaini507 – 59387PDZ 3PROSITE-ProRule annotationAdd
BLAST
Domaini638 – 72487PDZ 4PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni186 – 24459Interaction with MAGEB18Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi181 – 1844NPXY motif

Domaini

The NPXY motif is required for the interaction with the PID domain of NUMB. It is however not sufficient.
The PDZ 1 domain participates in the interaction with the PID domain of NUMB, and participates in the isoform-specific ubiquitination of NUMB. The PDZ 2 domain of isoform 2 participates in the interaction with IGSF5/JAM4, other isoforms containing this domain may also interact with IGSF5/JAM4 (By similarity).By similarity

Sequence similaritiesi

Contains 4 PDZ (DHR) domains.PROSITE-ProRule annotation
Contains 1 RING-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri41 – 7939RING-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG236845.
GeneTreeiENSGT00760000119017.
HOGENOMiHOG000261605.
HOVERGENiHBG039539.
InParanoidiQ8TBB1.
KOiK10692.
OMAiVFPRLYH.
OrthoDBiEOG75F4CJ.
PhylomeDBiQ8TBB1.
TreeFamiTF330709.

Family and domain databases

Gene3Di2.30.42.10. 4 hits.
3.30.40.10. 1 hit.
InterProiIPR001478. PDZ.
IPR018957. Znf_C3HC4_RING-type.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamiPF00595. PDZ. 4 hits.
PF00097. zf-C3HC4. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 4 hits.
SM00184. RING. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 4 hits.
PROSITEiPS50106. PDZ. 4 hits.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8TBB1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNQPESANDP EPLCAVCGQA HSLEENHFYS YPEEVDDDLI CHICLQALLD
60 70 80 90 100
PLDTPCGHTY CTLCLTNFLV EKDFCPMDRK PLVLQHCKKS SILVNKLLNK
110 120 130 140 150
LLVTCPFREH CTQVLQRCDL EHHFQTSCKG ASHYGLTKDR KRRSQDGCPD
160 170 180 190 200
GCASLTATAP SPEVSAAATI SLMTDEPGLD NPAYVSSAED GQPAISPVDS
210 220 230 240 250
GRSNRTRARP FERSTIRSRS FKKINRALSV LRRTKSGSAV ANHADQGREN
260 270 280 290 300
SENTTAPEVF PRLYHLIPDG EITSIKINRV DPSESLSIRL VGGSETPLVH
310 320 330 340 350
IIIQHIYRDG VIARDGRLLP GDIILKVNGM DISNVPHNYA VRLLRQPCQV
360 370 380 390 400
LWLTVMREQK FRSRNNGQAP DAYRPRDDSF HVILNKSSPE EQLGIKLVRK
410 420 430 440 450
VDEPGVFIFN VLDGGVAYRH GQLEENDRVL AINGHDLRYG SPESAAHLIQ
460 470 480 490 500
ASERRVHLVV SRQVRQRSPD IFQEAGWNSN GSWSPGPGER SNTPKPLHPT
510 520 530 540 550
ITCHEKVVNI QKDPGESLGM TVAGGASHRE WDLPIYVISV EPGGVISRDG
560 570 580 590 600
RIKTGDILLN VDGVELTEVS RSEAVALLKR TSSSIVLKAL EVKEYEPQED
610 620 630 640 650
CSSPAALDSN HNMAPPSDWS PSWVMWLELP RCLYNCKDIV LRRNTAGSLG
660 670 680 690 700
FCIVGGYEEY NGNKPFFIKS IVEGTPAYND GRIRCGDILL AVNGRSTSGM
710 720
IHACLARLLK ELKGRITLTI VSWPGTFL
Length:728
Mass (Da):80,629
Last modified:June 1, 2002 - v1
Checksum:i5590E8D8976AE093
GO
Isoform 2 (identifier: Q8TBB1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-127: MNQPESANDP...CDLEHHFQTS → MKALLLLVLPWLSPANYIDNVGNLHFLYSEL

Show »
Length:632
Mass (Da):69,643
Checksum:i1B343BEF469CB005
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti132 – 1321S → F in AAK15039. (PubMed:11521506)Curated
Sequence conflicti321 – 3211G → R in BAB71291. (PubMed:14702039)Curated
Sequence conflicti366 – 3661N → T in BAB71291. (PubMed:14702039)Curated
Sequence conflicti411 – 4111V → A in BAB71291. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 127127MNQPE…HFQTS → MKALLLLVLPWLSPANYIDN VGNLHFLYSEL in isoform 2. 3 PublicationsVSP_005733Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF237782 mRNA. Translation: AAK15039.1.
AY358326 mRNA. Translation: AAQ88692.1.
AK056823 mRNA. Translation: BAB71291.1.
AC058822 Genomic DNA. No translation available.
AC095040 Genomic DNA. Translation: AAY41000.1.
BC022983 mRNA. Translation: AAH22983.1.
BC034737 mRNA. Translation: AAH34737.1.
CCDSiCCDS3492.1. [Q8TBB1-2]
CCDS47057.1. [Q8TBB1-1]
RefSeqiNP_001119800.1. NM_001126328.2. [Q8TBB1-1]
NP_116011.2. NM_032622.2. [Q8TBB1-2]
XP_005265842.1. XM_005265785.2. [Q8TBB1-1]
XP_005265843.1. XM_005265786.2. [Q8TBB1-1]
UniGeneiHs.518760.

Genome annotation databases

EnsembliENST00000263925; ENSP00000263925; ENSG00000072201. [Q8TBB1-1]
ENST00000306888; ENSP00000302879; ENSG00000072201. [Q8TBB1-2]
ENST00000513421; ENSP00000426445; ENSG00000072201.
GeneIDi84708.
KEGGihsa:84708.
UCSCiuc003haf.4. human. [Q8TBB1-2]
uc003hag.5. human. [Q8TBB1-1]

Polymorphism databases

DMDMi29840786.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF237782 mRNA. Translation: AAK15039.1 .
AY358326 mRNA. Translation: AAQ88692.1 .
AK056823 mRNA. Translation: BAB71291.1 .
AC058822 Genomic DNA. No translation available.
AC095040 Genomic DNA. Translation: AAY41000.1 .
BC022983 mRNA. Translation: AAH22983.1 .
BC034737 mRNA. Translation: AAH34737.1 .
CCDSi CCDS3492.1. [Q8TBB1-2 ]
CCDS47057.1. [Q8TBB1-1 ]
RefSeqi NP_001119800.1. NM_001126328.2. [Q8TBB1-1 ]
NP_116011.2. NM_032622.2. [Q8TBB1-2 ]
XP_005265842.1. XM_005265785.2. [Q8TBB1-1 ]
XP_005265843.1. XM_005265786.2. [Q8TBB1-1 ]
UniGenei Hs.518760.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3B76 X-ray 1.75 A/B 504-594 [» ]
ProteinModelPortali Q8TBB1.
SMRi Q8TBB1. Positions 41-129, 273-722.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124219. 148 interactions.
IntActi Q8TBB1. 54 interactions.
MINTi MINT-1441889.
STRINGi 9606.ENSP00000263925.

PTM databases

PhosphoSitei Q8TBB1.

Polymorphism databases

DMDMi 29840786.

Proteomic databases

PaxDbi Q8TBB1.
PRIDEi Q8TBB1.

Protocols and materials databases

DNASUi 84708.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000263925 ; ENSP00000263925 ; ENSG00000072201 . [Q8TBB1-1 ]
ENST00000306888 ; ENSP00000302879 ; ENSG00000072201 . [Q8TBB1-2 ]
ENST00000513421 ; ENSP00000426445 ; ENSG00000072201 .
GeneIDi 84708.
KEGGi hsa:84708.
UCSCi uc003haf.4. human. [Q8TBB1-2 ]
uc003hag.5. human. [Q8TBB1-1 ]

Organism-specific databases

CTDi 84708.
GeneCardsi GC04M054325.
HGNCi HGNC:6657. LNX1.
HPAi HPA002235.
MIMi 609732. gene.
neXtProti NX_Q8TBB1.
PharmGKBi PA30419.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG236845.
GeneTreei ENSGT00760000119017.
HOGENOMi HOG000261605.
HOVERGENi HBG039539.
InParanoidi Q8TBB1.
KOi K10692.
OMAi VFPRLYH.
OrthoDBi EOG75F4CJ.
PhylomeDBi Q8TBB1.
TreeFami TF330709.

Enzyme and pathway databases

UniPathwayi UPA00143 .

Miscellaneous databases

EvolutionaryTracei Q8TBB1.
GeneWikii LNX1.
GenomeRNAii 84708.
NextBioi 74806.
PROi Q8TBB1.
SOURCEi Search...

Gene expression databases

Bgeei Q8TBB1.
CleanExi HS_LNX1.
ExpressionAtlasi Q8TBB1. baseline and differential.
Genevestigatori Q8TBB1.

Family and domain databases

Gene3Di 2.30.42.10. 4 hits.
3.30.40.10. 1 hit.
InterProi IPR001478. PDZ.
IPR018957. Znf_C3HC4_RING-type.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view ]
Pfami PF00595. PDZ. 4 hits.
PF00097. zf-C3HC4. 1 hit.
[Graphical view ]
SMARTi SM00228. PDZ. 4 hits.
SM00184. RING. 1 hit.
[Graphical view ]
SUPFAMi SSF50156. SSF50156. 4 hits.
PROSITEi PS50106. PDZ. 4 hits.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a human LNX protein containing multiple PDZ domains."
    Xie Y., Zhao W., Wang W., Zhao S., Tang R., Ying K., Zhou Z., Mao Y.
    Biochem. Genet. 39:117-126(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
    Tissue: Fetal brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Prostate.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain and Placenta.
  6. "The Coxsackievirus and adenovirus receptor (CAR) forms a complex with the PDZ domain-containing protein ligand-of-numb protein-X (LNX)."
    Sollerbrant K., Raschperger E., Mirza M., Engstroem U., Philipson L., Ljungdahl P.O., Pettersson R.F.
    J. Biol. Chem. 278:7439-7444(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CXADR.
  7. "Np9 protein of human endogenous retrovirus K interacts with ligand of numb protein X."
    Armbruester V., Sauter M., Roemer K., Best B., Hahn S., Nty A., Schmid A., Philipp S., Mueller A., Mueller-Lantzsch N.
    J. Virol. 78:10310-10319(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH NP9.
  8. "MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases."
    Doyle J.M., Gao J., Wang J., Yang M., Potts P.R.
    Mol. Cell 39:963-974(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH MAGEB18 AND MAGEF1.
  9. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiLNX1_HUMAN
AccessioniPrimary (citable) accession number: Q8TBB1
Secondary accession number(s): Q4W5K7
, Q8N4C2, Q96MJ7, Q9BY20
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 28, 2003
Last sequence update: June 1, 2002
Last modified: November 26, 2014
This is version 124 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3