Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

E3 ubiquitin-protein ligase LNX

Gene

LNX1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of NUMB. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates ubiquitination of isoform p66 and isoform p72 of NUMB, but not that of isoform p71 or isoform p65 (By similarity).By similarity
Isoform 2 provides an endocytic scaffold for IGSF5/JAM4.By similarity

Pathway: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri41 – 7939RING-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase LNX (EC:6.3.2.-)
Alternative name(s):
Ligand of Numb-protein X 1
Numb-binding protein 1
PDZ domain-containing RING finger protein 2
Gene namesi
Name:LNX1
Synonyms:LNX, PDZRN2
ORF Names:UNQ574/PRO1136
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:6657. LNX1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30419.

Polymorphism and mutation databases

BioMutaiLNX1.
DMDMi29840786.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 728728E3 ubiquitin-protein ligase LNXPRO_0000055913Add
BLAST

Proteomic databases

PaxDbiQ8TBB1.
PRIDEiQ8TBB1.

PTM databases

PhosphoSiteiQ8TBB1.

Expressioni

Tissue specificityi

Expressed in heart, placenta, kidney, pancreas and brain.1 Publication

Gene expression databases

BgeeiQ8TBB1.
CleanExiHS_LNX1.
ExpressionAtlasiQ8TBB1. baseline and differential.
GenevisibleiQ8TBB1. HS.

Organism-specific databases

HPAiHPA002235.

Interactioni

Subunit structurei

Interacts with the phosphotyrosine interaction domain of all isoforms of NUMB (By similarity). Interacts with MAGEB18 and MAGEF1. Interacts with the Coxsackievirus and adenovirus receptor CXADR. Interacts with endogenous retrovirus K protein Np9. IGSF5/JAM4 interacts with isoform 2 through the second PDZ domain, other isoforms may also interact with IGSF5/JAM4 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
ACAT2Q9BWD13EBI-739832,EBI-1047273
ACY3Q96HD93EBI-739832,EBI-3916242
AGTRAPQ6RW133EBI-739832,EBI-741181
AIDAQ96BJ33EBI-739832,EBI-4401674
AIMP2Q131554EBI-739832,EBI-745226
ALDOCP099723EBI-739832,EBI-2952751
ALKBH3Q96Q833EBI-739832,EBI-6658697
APIPQ96GX94EBI-739832,EBI-359248
APOL4Q9BRG63EBI-739832,EBI-10296818
ATPAF2Q8N5M13EBI-739832,EBI-1166928
ATRIPQ8WXE13EBI-739832,EBI-747353
BLVRAP530043EBI-739832,EBI-7410441
C1QTNF1Q9BXJ13EBI-739832,EBI-750200
CA8P352193EBI-739832,EBI-718700
CATSPERDQ86XM03EBI-739832,EBI-10260328
CCDC101Q96ES73EBI-739832,EBI-743117
CCDC102BA1A4H13EBI-739832,EBI-10171570
CCDC114Q96M633EBI-739832,EBI-10173858
CDAP323203EBI-739832,EBI-9250559
CIB3Q96Q773EBI-739832,EBI-10292696
CIRBPQ140113EBI-739832,EBI-538850
CLK2P497603EBI-739832,EBI-750020
COILP384322EBI-739832,EBI-945751
CPNE2Q96FN43EBI-739832,EBI-7097057
DAB1O755533EBI-739832,EBI-7875264
DCUN1D5Q9BTE73EBI-739832,EBI-3924013
DNPEPQ9ULA03EBI-739832,EBI-748356
DPF2Q927853EBI-739832,EBI-359932
EIF4HQ150563EBI-739832,EBI-748492
FAM118AQ9NWS63EBI-739832,EBI-8638992
FAM124AQ86V423EBI-739832,EBI-744506
FAM9BQ8IZU03EBI-739832,EBI-10175124
FBXL12Q9NXK83EBI-739832,EBI-719790
GDI1P311503EBI-739832,EBI-946999
GOLPH3LQ9H4A53EBI-739832,EBI-4403434
GRB2P629933EBI-739832,EBI-401755
HEL-S-108V9HW563EBI-739832,EBI-10330141
HEL-S-30V9HWB83EBI-739832,EBI-10215395
HEL-S-69pV9HWF53EBI-739832,EBI-10330249
HEL-S-70V9HW803EBI-739832,EBI-10175326
HMBOX1Q6NT763EBI-739832,EBI-2549423
HOMEZQ8IX15-33EBI-739832,EBI-10172004
HSBP1O755063EBI-739832,EBI-748664
INPP5KQ9BT403EBI-739832,EBI-749162
ISCUQ9H1K13EBI-739832,EBI-1047335
KCTD1Q719H93EBI-739832,EBI-9027502
KCTD6Q8NC693EBI-739832,EBI-2511344
KRTAP4-2Q9BYR53EBI-739832,EBI-10172511
KRTAP9-2Q9BYQ43EBI-739832,EBI-1044640
LCLAT1Q6UWP73EBI-739832,EBI-10254507
LGALS14Q8TCE93EBI-739832,EBI-10274069
LSM2Q9Y3333EBI-739832,EBI-347416
MAGEB18Q96M619EBI-739832,EBI-741835
MAPK9P459843EBI-739832,EBI-713568
MEMO1Q9Y3163EBI-739832,EBI-1104564
METTL21AQ8WXB13EBI-739832,EBI-8652459
MRFAP1L1Q96HT83EBI-739832,EBI-748896
MTMR9Q96QG73EBI-739832,EBI-744593
MTUS2Q5JR593EBI-739832,EBI-742948
MVB12BQ9H7P63EBI-739832,EBI-6149062
NAGKQ9UJ702EBI-739832,EBI-372578
NCK2O436393EBI-739832,EBI-713635
NECAB2H3BTW23EBI-739832,EBI-10172876
NEK6Q9HC983EBI-739832,EBI-740364
NME7Q9Y5B83EBI-739832,EBI-744782
NOTCH2NLQ7Z3S93EBI-739832,EBI-945833
NUDT14O958485EBI-739832,EBI-536866
NXT2Q9NPJ83EBI-739832,EBI-752122
OSBP2Q969R23EBI-739832,EBI-7405817
OSGIN1Q9UJX03EBI-739832,EBI-9057006
PAFAH1B3Q151022EBI-739832,EBI-711522
PBLDP300393EBI-739832,EBI-750589
PCBD1P614574EBI-739832,EBI-740475
POMGNT1Q8WZA13EBI-739832,EBI-3912424
PPIAP629373EBI-739832,EBI-437708
PRR13Q9NZ814EBI-739832,EBI-740924
PTSQ033933EBI-739832,EBI-712344
RAD51DO757713EBI-739832,EBI-1055693
RBMY1A1P0DJD33EBI-739832,EBI-8638511
RFPL3O756793EBI-739832,EBI-10188956
ROBO3Q96HH03EBI-739832,EBI-10288358
ROPN1Q9HAT03EBI-739832,EBI-1378139
RUFY4Q6ZNE93EBI-739832,EBI-10181525
RUVBL2Q9Y2303EBI-739832,EBI-352939
SATQ6ICU93EBI-739832,EBI-10178867
SNRNP25Q9BV903EBI-739832,EBI-9675976
SNRPFP623063EBI-739832,EBI-356900
SRCP129316EBI-739832,EBI-621482
SSNA1O438053EBI-739832,EBI-2515299
STAC2Q6ZMT13EBI-739832,EBI-948802
TBCELQ5QJ743EBI-739832,EBI-10244795
THAP7Q9BT493EBI-739832,EBI-741350
TRIM39Q9HCM93EBI-739832,EBI-739510
TRIM54Q9BYV23EBI-739832,EBI-2130429
TRIP13Q156454EBI-739832,EBI-358993
TRMT12Q53H543EBI-739832,EBI-10242598
TSSK3Q96PN83EBI-739832,EBI-3918381
ZCCHC10Q8TBK63EBI-739832,EBI-597063
ZFP64Q9NTW73EBI-739832,EBI-745730
ZNF581Q9P0T43EBI-739832,EBI-745520
ZNF593O004883EBI-739832,EBI-726769

Protein-protein interaction databases

BioGridi124219. 240 interactions.
IntActiQ8TBB1. 148 interactions.
MINTiMINT-1441889.
STRINGi9606.ENSP00000263925.

Structurei

Secondary structure

1
728
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi504 – 5118Combined sources
Beta strandi520 – 5245Combined sources
Beta strandi535 – 5406Combined sources
Helixi545 – 5495Combined sources
Beta strandi557 – 5615Combined sources
Helixi566 – 5683Combined sources
Helixi571 – 5799Combined sources
Beta strandi583 – 59412Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3B76X-ray1.75A/B504-594[»]
ProteinModelPortaliQ8TBB1.
SMRiQ8TBB1. Positions 41-129, 273-722.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8TBB1.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini274 – 35986PDZ 1PROSITE-ProRule annotationAdd
BLAST
Domaini381 – 46484PDZ 2PROSITE-ProRule annotationAdd
BLAST
Domaini507 – 59387PDZ 3PROSITE-ProRule annotationAdd
BLAST
Domaini638 – 72487PDZ 4PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni186 – 24459Interaction with MAGEB18Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi181 – 1844NPXY motif

Domaini

The NPXY motif is required for the interaction with the PID domain of NUMB. It is however not sufficient.
The PDZ 1 domain participates in the interaction with the PID domain of NUMB, and participates in the isoform-specific ubiquitination of NUMB. The PDZ 2 domain of isoform 2 participates in the interaction with IGSF5/JAM4, other isoforms containing this domain may also interact with IGSF5/JAM4 (By similarity).By similarity

Sequence similaritiesi

Contains 4 PDZ (DHR) domains.PROSITE-ProRule annotation
Contains 1 RING-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri41 – 7939RING-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG236845.
GeneTreeiENSGT00760000119017.
HOGENOMiHOG000261605.
HOVERGENiHBG039539.
InParanoidiQ8TBB1.
KOiK10692.
OMAiPDIFQEA.
OrthoDBiEOG75F4CJ.
PhylomeDBiQ8TBB1.
TreeFamiTF330709.

Family and domain databases

Gene3Di2.30.42.10. 4 hits.
3.30.40.10. 1 hit.
InterProiIPR001478. PDZ.
IPR018957. Znf_C3HC4_RING-type.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamiPF00595. PDZ. 4 hits.
PF00097. zf-C3HC4. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 4 hits.
SM00184. RING. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 4 hits.
PROSITEiPS50106. PDZ. 4 hits.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TBB1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNQPESANDP EPLCAVCGQA HSLEENHFYS YPEEVDDDLI CHICLQALLD
60 70 80 90 100
PLDTPCGHTY CTLCLTNFLV EKDFCPMDRK PLVLQHCKKS SILVNKLLNK
110 120 130 140 150
LLVTCPFREH CTQVLQRCDL EHHFQTSCKG ASHYGLTKDR KRRSQDGCPD
160 170 180 190 200
GCASLTATAP SPEVSAAATI SLMTDEPGLD NPAYVSSAED GQPAISPVDS
210 220 230 240 250
GRSNRTRARP FERSTIRSRS FKKINRALSV LRRTKSGSAV ANHADQGREN
260 270 280 290 300
SENTTAPEVF PRLYHLIPDG EITSIKINRV DPSESLSIRL VGGSETPLVH
310 320 330 340 350
IIIQHIYRDG VIARDGRLLP GDIILKVNGM DISNVPHNYA VRLLRQPCQV
360 370 380 390 400
LWLTVMREQK FRSRNNGQAP DAYRPRDDSF HVILNKSSPE EQLGIKLVRK
410 420 430 440 450
VDEPGVFIFN VLDGGVAYRH GQLEENDRVL AINGHDLRYG SPESAAHLIQ
460 470 480 490 500
ASERRVHLVV SRQVRQRSPD IFQEAGWNSN GSWSPGPGER SNTPKPLHPT
510 520 530 540 550
ITCHEKVVNI QKDPGESLGM TVAGGASHRE WDLPIYVISV EPGGVISRDG
560 570 580 590 600
RIKTGDILLN VDGVELTEVS RSEAVALLKR TSSSIVLKAL EVKEYEPQED
610 620 630 640 650
CSSPAALDSN HNMAPPSDWS PSWVMWLELP RCLYNCKDIV LRRNTAGSLG
660 670 680 690 700
FCIVGGYEEY NGNKPFFIKS IVEGTPAYND GRIRCGDILL AVNGRSTSGM
710 720
IHACLARLLK ELKGRITLTI VSWPGTFL
Length:728
Mass (Da):80,629
Last modified:June 1, 2002 - v1
Checksum:i5590E8D8976AE093
GO
Isoform 2 (identifier: Q8TBB1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-127: MNQPESANDP...CDLEHHFQTS → MKALLLLVLPWLSPANYIDNVGNLHFLYSEL

Show »
Length:632
Mass (Da):69,643
Checksum:i1B343BEF469CB005
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti132 – 1321S → F in AAK15039 (PubMed:11521506).Curated
Sequence conflicti321 – 3211G → R in BAB71291 (PubMed:14702039).Curated
Sequence conflicti366 – 3661N → T in BAB71291 (PubMed:14702039).Curated
Sequence conflicti411 – 4111V → A in BAB71291 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 127127MNQPE…HFQTS → MKALLLLVLPWLSPANYIDN VGNLHFLYSEL in isoform 2. 3 PublicationsVSP_005733Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF237782 mRNA. Translation: AAK15039.1.
AY358326 mRNA. Translation: AAQ88692.1.
AK056823 mRNA. Translation: BAB71291.1.
AC058822 Genomic DNA. No translation available.
AC095040 Genomic DNA. Translation: AAY41000.1.
BC022983 mRNA. Translation: AAH22983.1.
BC034737 mRNA. Translation: AAH34737.1.
CCDSiCCDS3492.1. [Q8TBB1-2]
CCDS47057.1. [Q8TBB1-1]
RefSeqiNP_001119800.1. NM_001126328.2. [Q8TBB1-1]
NP_116011.2. NM_032622.2. [Q8TBB1-2]
XP_005265842.1. XM_005265785.3. [Q8TBB1-1]
XP_005265843.1. XM_005265786.3. [Q8TBB1-1]
UniGeneiHs.518760.

Genome annotation databases

EnsembliENST00000263925; ENSP00000263925; ENSG00000072201. [Q8TBB1-1]
ENST00000306888; ENSP00000302879; ENSG00000072201. [Q8TBB1-2]
GeneIDi84708.
KEGGihsa:84708.
UCSCiuc003haf.4. human. [Q8TBB1-2]
uc003hag.5. human. [Q8TBB1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF237782 mRNA. Translation: AAK15039.1.
AY358326 mRNA. Translation: AAQ88692.1.
AK056823 mRNA. Translation: BAB71291.1.
AC058822 Genomic DNA. No translation available.
AC095040 Genomic DNA. Translation: AAY41000.1.
BC022983 mRNA. Translation: AAH22983.1.
BC034737 mRNA. Translation: AAH34737.1.
CCDSiCCDS3492.1. [Q8TBB1-2]
CCDS47057.1. [Q8TBB1-1]
RefSeqiNP_001119800.1. NM_001126328.2. [Q8TBB1-1]
NP_116011.2. NM_032622.2. [Q8TBB1-2]
XP_005265842.1. XM_005265785.3. [Q8TBB1-1]
XP_005265843.1. XM_005265786.3. [Q8TBB1-1]
UniGeneiHs.518760.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3B76X-ray1.75A/B504-594[»]
ProteinModelPortaliQ8TBB1.
SMRiQ8TBB1. Positions 41-129, 273-722.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124219. 240 interactions.
IntActiQ8TBB1. 148 interactions.
MINTiMINT-1441889.
STRINGi9606.ENSP00000263925.

PTM databases

PhosphoSiteiQ8TBB1.

Polymorphism and mutation databases

BioMutaiLNX1.
DMDMi29840786.

Proteomic databases

PaxDbiQ8TBB1.
PRIDEiQ8TBB1.

Protocols and materials databases

DNASUi84708.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263925; ENSP00000263925; ENSG00000072201. [Q8TBB1-1]
ENST00000306888; ENSP00000302879; ENSG00000072201. [Q8TBB1-2]
GeneIDi84708.
KEGGihsa:84708.
UCSCiuc003haf.4. human. [Q8TBB1-2]
uc003hag.5. human. [Q8TBB1-1]

Organism-specific databases

CTDi84708.
GeneCardsiGC04M054325.
HGNCiHGNC:6657. LNX1.
HPAiHPA002235.
MIMi609732. gene.
neXtProtiNX_Q8TBB1.
PharmGKBiPA30419.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG236845.
GeneTreeiENSGT00760000119017.
HOGENOMiHOG000261605.
HOVERGENiHBG039539.
InParanoidiQ8TBB1.
KOiK10692.
OMAiPDIFQEA.
OrthoDBiEOG75F4CJ.
PhylomeDBiQ8TBB1.
TreeFamiTF330709.

Enzyme and pathway databases

UniPathwayiUPA00143.

Miscellaneous databases

EvolutionaryTraceiQ8TBB1.
GeneWikiiLNX1.
GenomeRNAii84708.
NextBioi74806.
PROiQ8TBB1.
SOURCEiSearch...

Gene expression databases

BgeeiQ8TBB1.
CleanExiHS_LNX1.
ExpressionAtlasiQ8TBB1. baseline and differential.
GenevisibleiQ8TBB1. HS.

Family and domain databases

Gene3Di2.30.42.10. 4 hits.
3.30.40.10. 1 hit.
InterProiIPR001478. PDZ.
IPR018957. Znf_C3HC4_RING-type.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamiPF00595. PDZ. 4 hits.
PF00097. zf-C3HC4. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 4 hits.
SM00184. RING. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 4 hits.
PROSITEiPS50106. PDZ. 4 hits.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a human LNX protein containing multiple PDZ domains."
    Xie Y., Zhao W., Wang W., Zhao S., Tang R., Ying K., Zhou Z., Mao Y.
    Biochem. Genet. 39:117-126(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
    Tissue: Fetal brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Prostate.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain and Placenta.
  6. "The Coxsackievirus and adenovirus receptor (CAR) forms a complex with the PDZ domain-containing protein ligand-of-numb protein-X (LNX)."
    Sollerbrant K., Raschperger E., Mirza M., Engstroem U., Philipson L., Ljungdahl P.O., Pettersson R.F.
    J. Biol. Chem. 278:7439-7444(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CXADR.
  7. "Np9 protein of human endogenous retrovirus K interacts with ligand of numb protein X."
    Armbruester V., Sauter M., Roemer K., Best B., Hahn S., Nty A., Schmid A., Philipp S., Mueller A., Mueller-Lantzsch N.
    J. Virol. 78:10310-10319(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH NP9.
  8. "MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases."
    Doyle J.M., Gao J., Wang J., Yang M., Potts P.R.
    Mol. Cell 39:963-974(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH MAGEB18 AND MAGEF1.
  9. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiLNX1_HUMAN
AccessioniPrimary (citable) accession number: Q8TBB1
Secondary accession number(s): Q4W5K7
, Q8N4C2, Q96MJ7, Q9BY20
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 28, 2003
Last sequence update: June 1, 2002
Last modified: June 24, 2015
This is version 129 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.