Q8TBB1 (LNX1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: E3 ubiquitin-protein ligase LNX EC=6.3.2.- Alternative name(s): Ligand of Numb-protein X 1 Numb-binding protein 1 PDZ domain-containing RING finger protein 2 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 728 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of NUMB. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates ubiquitination of isoform p66 and isoform p72 of NUMB, but not that of isoform p71 or isoform p65 By similarity. Isoform 2 provides an endocytic scaffold for IGSF5/JAM4 By similarity. |
| Pathway | |
| Subunit structure | Interacts with the phosphotyrosine interaction domain of all isoforms of NUMB By similarity. Interacts with MAGEB18 and MAGEF1. Interacts with the Coxsackievirus and adenovirus receptor CXADR. Interacts with endogenous retrovirus K protein Np9. IGSF5/JAM4 interacts with isoform 2 through the second PDZ domain, other isoforms may also interact with IGSF5/JAM4 By similarity. Ref.6 Ref.7 Ref.8 |
| Subcellular location | Cytoplasm By similarity. |
| Tissue specificity | Expressed in heart, placenta, kidney, pancreas and brain. Ref.1 |
| Domain | The NPXY motif is required for the interaction with the PID domain of NUMB. It is however not sufficient. The PDZ 1 domain participates in the interaction with the PID domain of NUMB, and participates in the isoform-specific ubiquitination of NUMB. The PDZ 2 domain of isoform 2 participates in the interaction with IGSF5/JAM4, other isoforms containing this domain may also interact with IGSF5/JAM4 By similarity. |
| Sequence similarities | Contains 4 PDZ (DHR) domains. Contains 1 RING-type zinc finger. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Zinc-finger |
| Ligand | Metal-binding Zinc |
| Molecular function | Ligase |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein homooligomerization Inferred from electronic annotation. Source: Compara protein ubiquitination involved in ubiquitin-dependent protein catabolic processInferred from electronic annotation. Source: Compara |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | ubiquitin-protein ligase activity Inferred from electronic annotation. Source: Compara zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| COIL | P38432 | 2 | EBI-739832,EBI-945751 | |
| INPP5K | Q9BT40 | 3 | EBI-739832,EBI-749162 | |
| MAGEB18 | Q96M61 | 6 | EBI-739832,EBI-741835 | |
| NAGK | Q9UJ70 | 2 | EBI-739832,EBI-372578 | |
| PAFAH1B3 | Q15102 | 2 | EBI-739832,EBI-711522 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8TBB1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8TBB1-2) The sequence of this isoform differs from the canonical sequence as follows: 1-127: MNQPESANDP...CDLEHHFQTS → MKALLLLVLPWLSPANYIDNVGNLHFLYSEL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 728 | 728 | E3 ubiquitin-protein ligase LNX | PRO_0000055913 | |||||||||||||||||||||
Regions | |||||||||||||||||||||||||
| Domain | 274 – 359 | 86 | PDZ 1 | ||||||||||||||||||||||
| Domain | 381 – 464 | 84 | PDZ 2 | ||||||||||||||||||||||
| Domain | 507 – 593 | 87 | PDZ 3 | ||||||||||||||||||||||
| Domain | 638 – 724 | 87 | PDZ 4 | ||||||||||||||||||||||
| Zinc finger | 41 – 79 | 39 | RING-type | ||||||||||||||||||||||
| Region | 186 – 244 | 59 | Interaction with MAGEB18 | ||||||||||||||||||||||
| Motif | 181 – 184 | 4 | NPXY motif | ||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||
| Alternative sequence | 1 – 127 | 127 | MNQPE…HFQTS → MKALLLLVLPWLSPANYIDN VGNLHFLYSEL in isoform 2. | VSP_005733 | |||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||
| Sequence conflict | 132 | 1 | S → F in AAK15039. Ref.1 | ||||||||||||||||||||||
| Sequence conflict | 321 | 1 | G → R in BAB71291. Ref.3 | ||||||||||||||||||||||
| Sequence conflict | 366 | 1 | N → T in BAB71291. Ref.3 | ||||||||||||||||||||||
| Sequence conflict | 411 | 1 | V → A in BAB71291. Ref.3 | ||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||
| Beta strand | 504 – 511 | 8 | |||||||||||||||||||||||
| Beta strand | 520 – 524 | 5 | |||||||||||||||||||||||
| Beta strand | 535 – 540 | 6 | |||||||||||||||||||||||
| Helix | 545 – 549 | 5 | |||||||||||||||||||||||
| Beta strand | 557 – 561 | 5 | |||||||||||||||||||||||
| Helix | 566 – 568 | 3 | |||||||||||||||||||||||
| Helix | 571 – 579 | 9 | |||||||||||||||||||||||
| Beta strand | 583 – 594 | 12 | |||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a human LNX protein containing multiple PDZ domains." Xie Y., Zhao W., Wang W., Zhao S., Tang R., Ying K., Zhou Z., Mao Y. Biochem. Genet. 39:117-126(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY. Tissue: Fetal brain. |
| [2] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Prostate. |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain and Placenta. |
| [6] | "The Coxsackievirus and adenovirus receptor (CAR) forms a complex with the PDZ domain-containing protein ligand-of-numb protein-X (LNX)." Sollerbrant K., Raschperger E., Mirza M., Engstroem U., Philipson L., Ljungdahl P.O., Pettersson R.F. J. Biol. Chem. 278:7439-7444(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CXADR. |
| [7] | "Np9 protein of human endogenous retrovirus K interacts with ligand of numb protein X." Armbruester V., Sauter M., Roemer K., Best B., Hahn S., Nty A., Schmid A., Philipp S., Mueller A., Mueller-Lantzsch N. J. Virol. 78:10310-10319(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NP9. |
| [8] | "MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases." Doyle J.M., Gao J., Wang J., Yang M., Potts P.R. Mol. Cell 39:963-974(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MAGEB18 AND MAGEF1. |
| [9] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF237782 mRNA. Translation: AAK15039.1. AY358326 mRNA. Translation: AAQ88692.1. AK056823 mRNA. Translation: BAB71291.1. AC058822 Genomic DNA. No translation available. AC095040 Genomic DNA. Translation: AAY41000.1. BC022983 mRNA. Translation: AAH22983.1. BC034737 mRNA. Translation: AAH34737.1. | ||||||||||||
| IPI | IPI00152181. IPI00305598. | ||||||||||||
| RefSeq | NP_001119800.1. NM_001126328.2. NP_116011.2. NM_032622.2. | ||||||||||||
| UniGene | Hs.518760. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q8TBB1. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q8TBB1. 48 interactions. | ||||||||||||
| MINT | MINT-1441889. | ||||||||||||
| STRING | 9606.ENSP00000263925. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q8TBB1. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 29840786. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q8TBB1. | ||||||||||||
| PRIDE | Q8TBB1. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 84708. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000263925; ENSP00000263925; ENSG00000072201. ENST00000306888; ENSP00000302879; ENSG00000072201. ENST00000513421; ENSP00000426445; ENSG00000072201. | ||||||||||||
| GeneID | 84708. | ||||||||||||
| KEGG | hsa:84708. | ||||||||||||
| UCSC | uc003haf.4. human. uc003hag.4. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 84708. | ||||||||||||
| GeneCards | GC04M054325. | ||||||||||||
| HGNC | HGNC:6657. LNX1. | ||||||||||||
| HPA | HPA002235. | ||||||||||||
| MIM | 609732. gene. | ||||||||||||
| neXtProt | NX_Q8TBB1. | ||||||||||||
| PharmGKB | PA30419. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG236845. | ||||||||||||
| HOGENOM | HOG000261605. | ||||||||||||
| HOVERGEN | HBG039539. | ||||||||||||
| InParanoid | Q8TBB1. | ||||||||||||
| KO | K10692. | ||||||||||||
| OMA | LQHCKKS. | ||||||||||||
| PhylomeDB | Q8TBB1. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| UniPathway | UPA00143. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q8TBB1. | ||||||||||||
| Bgee | Q8TBB1. | ||||||||||||
| CleanEx | HS_LNX1. | ||||||||||||
| Genevestigator | Q8TBB1. | ||||||||||||
| GermOnline | ENSG00000072201. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 3.30.40.10. 1 hit. | ||||||||||||
| InterPro | IPR001478. PDZ. IPR001841. Znf_RING. IPR013083. Znf_RING/FYVE/PHD. IPR017907. Znf_RING_CS. [Graphical view] | ||||||||||||
| Pfam | PF00595. PDZ. 4 hits. [Graphical view] | ||||||||||||
| SMART | SM00228. PDZ. 4 hits. SM00184. RING. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF50156. PDZ. 4 hits. | ||||||||||||
| PROSITE | PS50106. PDZ. 4 hits. PS00518. ZF_RING_1. 1 hit. PS50089. ZF_RING_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q8TBB1. | ||||||||||||
| GenomeRNAi | 84708. | ||||||||||||
| NextBio | 74806. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | LNX1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8TBB1 Secondary accession number(s): Q4W5K7 Q9BY20 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
