Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8TBB1 (LNX1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 117. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
E3 ubiquitin-protein ligase LNX

EC=6.3.2.-
Alternative name(s):
Ligand of Numb-protein X 1
Numb-binding protein 1
PDZ domain-containing RING finger protein 2
Gene names
Name:LNX1
Synonyms:LNX, PDZRN2
ORF Names:UNQ574/PRO1136
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length728 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of NUMB. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates ubiquitination of isoform p66and isoform p72of NUMB, but not that of isoform p71or isoform p65 By similarity.

Isoform 2 provides an endocytic scaffold for IGSF5/JAM4 By similarity.

Pathway

Protein modification; protein ubiquitination.

Subunit structure

Interacts with the phosphotyrosine interaction domain of all isoforms of NUMB By similarity. Interacts with MAGEB18 and MAGEF1. Interacts with the Coxsackievirus and adenovirus receptor CXADR. Interacts with endogenous retrovirus K protein Np9. IGSF5/JAM4 interacts with isoform 2 through the second PDZ domain, other isoforms may also interact with IGSF5/JAM4 By similarity. Ref.6 Ref.7 Ref.8

Subcellular location

Cytoplasm By similarity.

Tissue specificity

Expressed in heart, placenta, kidney, pancreas and brain. Ref.1

Domain

The NPXY motif is required for the interaction with the PID domain of NUMB. It is however not sufficient.

The PDZ 1 domain participates in the interaction with the PID domain of NUMB, and participates in the isoform-specific ubiquitination of NUMB. The PDZ 2 domain of isoform 2 participates in the interaction with IGSF5/JAM4, other isoforms containing this domain may also interact with IGSF5/JAM4 By similarity.

Sequence similarities

Contains 4 PDZ (DHR) domains.

Contains 1 RING-type zinc finger.

Ontologies

Keywords
   Biological processUbl conjugation pathway
   Cellular componentCytoplasm
   Coding sequence diversityAlternative splicing
   DomainRepeat
Zinc-finger
   LigandMetal-binding
Zinc
   Molecular functionLigase
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processprotein homooligomerization

Inferred from electronic annotation. Source: Ensembl

protein ubiquitination involved in ubiquitin-dependent protein catabolic process

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionubiquitin-protein ligase activity

Inferred from electronic annotation. Source: Ensembl

zinc ion binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8TBB1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8TBB1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-127: MNQPESANDP...CDLEHHFQTS → MKALLLLVLPWLSPANYIDNVGNLHFLYSEL

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 728728E3 ubiquitin-protein ligase LNX
PRO_0000055913

Regions

Domain274 – 35986PDZ 1
Domain381 – 46484PDZ 2
Domain507 – 59387PDZ 3
Domain638 – 72487PDZ 4
Zinc finger41 – 7939RING-type
Region186 – 24459Interaction with MAGEB18
Motif181 – 1844NPXY motif

Natural variations

Alternative sequence1 – 127127MNQPE…HFQTS → MKALLLLVLPWLSPANYIDN VGNLHFLYSEL in isoform 2.
VSP_005733

Experimental info

Sequence conflict1321S → F in AAK15039. Ref.1
Sequence conflict3211G → R in BAB71291. Ref.3
Sequence conflict3661N → T in BAB71291. Ref.3
Sequence conflict4111V → A in BAB71291. Ref.3

Secondary structure

................. 728
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2002. Version 1.
Checksum: 5590E8D8976AE093

FASTA72880,629
        10         20         30         40         50         60 
MNQPESANDP EPLCAVCGQA HSLEENHFYS YPEEVDDDLI CHICLQALLD PLDTPCGHTY 

        70         80         90        100        110        120 
CTLCLTNFLV EKDFCPMDRK PLVLQHCKKS SILVNKLLNK LLVTCPFREH CTQVLQRCDL 

       130        140        150        160        170        180 
EHHFQTSCKG ASHYGLTKDR KRRSQDGCPD GCASLTATAP SPEVSAAATI SLMTDEPGLD 

       190        200        210        220        230        240 
NPAYVSSAED GQPAISPVDS GRSNRTRARP FERSTIRSRS FKKINRALSV LRRTKSGSAV 

       250        260        270        280        290        300 
ANHADQGREN SENTTAPEVF PRLYHLIPDG EITSIKINRV DPSESLSIRL VGGSETPLVH 

       310        320        330        340        350        360 
IIIQHIYRDG VIARDGRLLP GDIILKVNGM DISNVPHNYA VRLLRQPCQV LWLTVMREQK 

       370        380        390        400        410        420 
FRSRNNGQAP DAYRPRDDSF HVILNKSSPE EQLGIKLVRK VDEPGVFIFN VLDGGVAYRH 

       430        440        450        460        470        480 
GQLEENDRVL AINGHDLRYG SPESAAHLIQ ASERRVHLVV SRQVRQRSPD IFQEAGWNSN 

       490        500        510        520        530        540 
GSWSPGPGER SNTPKPLHPT ITCHEKVVNI QKDPGESLGM TVAGGASHRE WDLPIYVISV 

       550        560        570        580        590        600 
EPGGVISRDG RIKTGDILLN VDGVELTEVS RSEAVALLKR TSSSIVLKAL EVKEYEPQED 

       610        620        630        640        650        660 
CSSPAALDSN HNMAPPSDWS PSWVMWLELP RCLYNCKDIV LRRNTAGSLG FCIVGGYEEY 

       670        680        690        700        710        720 
NGNKPFFIKS IVEGTPAYND GRIRCGDILL AVNGRSTSGM IHACLARLLK ELKGRITLTI 


VSWPGTFL 

« Hide

Isoform 2 [UniParc].

Checksum: 1B343BEF469CB005
Show »

FASTA63269,643

References

« Hide 'large scale' references
[1]"Identification of a human LNX protein containing multiple PDZ domains."
Xie Y., Zhao W., Wang W., Zhao S., Tang R., Ying K., Zhou Z., Mao Y.
Biochem. Genet. 39:117-126(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
Tissue: Fetal brain.
[2]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Prostate.
[4]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Brain and Placenta.
[6]"The Coxsackievirus and adenovirus receptor (CAR) forms a complex with the PDZ domain-containing protein ligand-of-numb protein-X (LNX)."
Sollerbrant K., Raschperger E., Mirza M., Engstroem U., Philipson L., Ljungdahl P.O., Pettersson R.F.
J. Biol. Chem. 278:7439-7444(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH CXADR.
[7]"Np9 protein of human endogenous retrovirus K interacts with ligand of numb protein X."
Armbruester V., Sauter M., Roemer K., Best B., Hahn S., Nty A., Schmid A., Philipp S., Mueller A., Mueller-Lantzsch N.
J. Virol. 78:10310-10319(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH NP9.
[8]"MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases."
Doyle J.M., Gao J., Wang J., Yang M., Potts P.R.
Mol. Cell 39:963-974(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH MAGEB18 AND MAGEF1.
[9]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF237782 mRNA. Translation: AAK15039.1.
AY358326 mRNA. Translation: AAQ88692.1.
AK056823 mRNA. Translation: BAB71291.1.
AC058822 Genomic DNA. No translation available.
AC095040 Genomic DNA. Translation: AAY41000.1.
BC022983 mRNA. Translation: AAH22983.1.
BC034737 mRNA. Translation: AAH34737.1.
RefSeqNP_001119800.1. NM_001126328.2.
NP_116011.2. NM_032622.2.
XP_005265842.1. XM_005265785.2.
XP_005265843.1. XM_005265786.2.
UniGeneHs.518760.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
3B76X-ray1.75A/B504-594[»]
ProteinModelPortalQ8TBB1.
SMRQ8TBB1. Positions 41-129, 273-722.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid124219. 147 interactions.
IntActQ8TBB1. 54 interactions.
MINTMINT-1441889.
STRING9606.ENSP00000263925.

PTM databases

PhosphoSiteQ8TBB1.

Polymorphism databases

DMDM29840786.

Proteomic databases

PaxDbQ8TBB1.
PRIDEQ8TBB1.

Protocols and materials databases

DNASU84708.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000263925; ENSP00000263925; ENSG00000072201. [Q8TBB1-1]
ENST00000306888; ENSP00000302879; ENSG00000072201. [Q8TBB1-2]
ENST00000513421; ENSP00000426445; ENSG00000072201.
GeneID84708.
KEGGhsa:84708.
UCSCuc003haf.4. human. [Q8TBB1-2]
uc003hag.5. human. [Q8TBB1-1]

Organism-specific databases

CTD84708.
GeneCardsGC04M054325.
HGNCHGNC:6657. LNX1.
HPAHPA002235.
MIM609732. gene.
neXtProtNX_Q8TBB1.
PharmGKBPA30419.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG236845.
HOGENOMHOG000261605.
HOVERGENHBG039539.
InParanoidQ8TBB1.
KOK10692.
OMAVFPRLYH.
OrthoDBEOG75F4CJ.
PhylomeDBQ8TBB1.
TreeFamTF330709.

Enzyme and pathway databases

UniPathwayUPA00143.

Gene expression databases

ArrayExpressQ8TBB1.
BgeeQ8TBB1.
CleanExHS_LNX1.
GenevestigatorQ8TBB1.

Family and domain databases

Gene3D2.30.42.10. 4 hits.
3.30.40.10. 1 hit.
InterProIPR001478. PDZ.
IPR018957. Znf_C3HC4_RING-type.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamPF00595. PDZ. 4 hits.
PF00097. zf-C3HC4. 1 hit.
[Graphical view]
SMARTSM00228. PDZ. 4 hits.
SM00184. RING. 1 hit.
[Graphical view]
SUPFAMSSF50156. SSF50156. 4 hits.
PROSITEPS50106. PDZ. 4 hits.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ8TBB1.
GeneWikiLNX1.
GenomeRNAi84708.
NextBio74806.
PROQ8TBB1.
SOURCESearch...

Entry information

Entry nameLNX1_HUMAN
AccessionPrimary (citable) accession number: Q8TBB1
Secondary accession number(s): Q4W5K7 expand/collapse secondary AC list , Q8N4C2, Q96MJ7, Q9BY20
Entry history
Integrated into UniProtKB/Swiss-Prot: February 28, 2003
Last sequence update: June 1, 2002
Last modified: April 16, 2014
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

PATHWAY comments

Index of metabolic and biosynthesis pathways

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 4

Human chromosome 4: entries, gene names and cross-references to MIM