SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8TBB1

- LNX1_HUMAN

UniProt

Q8TBB1 - LNX1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
E3 ubiquitin-protein ligase LNX
Gene
LNX1, LNX, PDZRN2, UNQ574/PRO1136
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of NUMB. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates ubiquitination of isoform p66 and isoform p72 of NUMB, but not that of isoform p71 or isoform p65 By similarity.
Isoform 2 provides an endocytic scaffold for IGSF5/JAM4 By similarity.

Pathwayi

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri41 – 7939RING-type
Add
BLAST

GO - Molecular functioni

  1. ligase activity Source: UniProtKB-KW
  2. protein binding Source: IntAct
  3. ubiquitin-protein transferase activity Source: Ensembl
  4. zinc ion binding Source: InterPro

GO - Biological processi

  1. protein homooligomerization Source: Ensembl
  2. protein ubiquitination involved in ubiquitin-dependent protein catabolic process Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase LNX (EC:6.3.2.-)
Alternative name(s):
Ligand of Numb-protein X 1
Numb-binding protein 1
PDZ domain-containing RING finger protein 2
Gene namesi
Name:LNX1
Synonyms:LNX, PDZRN2
ORF Names:UNQ574/PRO1136
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:6657. LNX1.

Subcellular locationi

Cytoplasm By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30419.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 728728E3 ubiquitin-protein ligase LNX
PRO_0000055913Add
BLAST

Proteomic databases

PaxDbiQ8TBB1.
PRIDEiQ8TBB1.

PTM databases

PhosphoSiteiQ8TBB1.

Expressioni

Tissue specificityi

Expressed in heart, placenta, kidney, pancreas and brain.1 Publication

Gene expression databases

ArrayExpressiQ8TBB1.
BgeeiQ8TBB1.
CleanExiHS_LNX1.
GenevestigatoriQ8TBB1.

Organism-specific databases

HPAiHPA002235.

Interactioni

Subunit structurei

Interacts with the phosphotyrosine interaction domain of all isoforms of NUMB By similarity. Interacts with MAGEB18 and MAGEF1. Interacts with the Coxsackievirus and adenovirus receptor CXADR. Interacts with endogenous retrovirus K protein Np9. IGSF5/JAM4 interacts with isoform 2 through the second PDZ domain, other isoforms may also interact with IGSF5/JAM4 By similarity.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
COILP384322EBI-739832,EBI-945751
INPP5KQ9BT403EBI-739832,EBI-749162
MAGEB18Q96M616EBI-739832,EBI-741835
NAGKQ9UJ702EBI-739832,EBI-372578
PAFAH1B3Q151022EBI-739832,EBI-711522
SRCP129316EBI-739832,EBI-621482

Protein-protein interaction databases

BioGridi124219. 146 interactions.
IntActiQ8TBB1. 54 interactions.
MINTiMINT-1441889.
STRINGi9606.ENSP00000263925.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi504 – 5118
Beta strandi520 – 5245
Beta strandi535 – 5406
Helixi545 – 5495
Beta strandi557 – 5615
Helixi566 – 5683
Helixi571 – 5799
Beta strandi583 – 59412

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3B76X-ray1.75A/B504-594[»]
ProteinModelPortaliQ8TBB1.
SMRiQ8TBB1. Positions 41-129, 273-722.

Miscellaneous databases

EvolutionaryTraceiQ8TBB1.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini274 – 35986PDZ 1
Add
BLAST
Domaini381 – 46484PDZ 2
Add
BLAST
Domaini507 – 59387PDZ 3
Add
BLAST
Domaini638 – 72487PDZ 4
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni186 – 24459Interaction with MAGEB18
Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi181 – 1844NPXY motif

Domaini

The NPXY motif is required for the interaction with the PID domain of NUMB. It is however not sufficient.
The PDZ 1 domain participates in the interaction with the PID domain of NUMB, and participates in the isoform-specific ubiquitination of NUMB. The PDZ 2 domain of isoform 2 participates in the interaction with IGSF5/JAM4, other isoforms containing this domain may also interact with IGSF5/JAM4 By similarity.

Sequence similaritiesi

Contains 4 PDZ (DHR) domains.

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG236845.
HOGENOMiHOG000261605.
HOVERGENiHBG039539.
InParanoidiQ8TBB1.
KOiK10692.
OMAiVFPRLYH.
OrthoDBiEOG75F4CJ.
PhylomeDBiQ8TBB1.
TreeFamiTF330709.

Family and domain databases

Gene3Di2.30.42.10. 4 hits.
3.30.40.10. 1 hit.
InterProiIPR001478. PDZ.
IPR018957. Znf_C3HC4_RING-type.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamiPF00595. PDZ. 4 hits.
PF00097. zf-C3HC4. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 4 hits.
SM00184. RING. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 4 hits.
PROSITEiPS50106. PDZ. 4 hits.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8TBB1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MNQPESANDP EPLCAVCGQA HSLEENHFYS YPEEVDDDLI CHICLQALLD    50
PLDTPCGHTY CTLCLTNFLV EKDFCPMDRK PLVLQHCKKS SILVNKLLNK 100
LLVTCPFREH CTQVLQRCDL EHHFQTSCKG ASHYGLTKDR KRRSQDGCPD 150
GCASLTATAP SPEVSAAATI SLMTDEPGLD NPAYVSSAED GQPAISPVDS 200
GRSNRTRARP FERSTIRSRS FKKINRALSV LRRTKSGSAV ANHADQGREN 250
SENTTAPEVF PRLYHLIPDG EITSIKINRV DPSESLSIRL VGGSETPLVH 300
IIIQHIYRDG VIARDGRLLP GDIILKVNGM DISNVPHNYA VRLLRQPCQV 350
LWLTVMREQK FRSRNNGQAP DAYRPRDDSF HVILNKSSPE EQLGIKLVRK 400
VDEPGVFIFN VLDGGVAYRH GQLEENDRVL AINGHDLRYG SPESAAHLIQ 450
ASERRVHLVV SRQVRQRSPD IFQEAGWNSN GSWSPGPGER SNTPKPLHPT 500
ITCHEKVVNI QKDPGESLGM TVAGGASHRE WDLPIYVISV EPGGVISRDG 550
RIKTGDILLN VDGVELTEVS RSEAVALLKR TSSSIVLKAL EVKEYEPQED 600
CSSPAALDSN HNMAPPSDWS PSWVMWLELP RCLYNCKDIV LRRNTAGSLG 650
FCIVGGYEEY NGNKPFFIKS IVEGTPAYND GRIRCGDILL AVNGRSTSGM 700
IHACLARLLK ELKGRITLTI VSWPGTFL 728
Length:728
Mass (Da):80,629
Last modified:June 1, 2002 - v1
Checksum:i5590E8D8976AE093
GO
Isoform 2 (identifier: Q8TBB1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-127: MNQPESANDP...CDLEHHFQTS → MKALLLLVLPWLSPANYIDNVGNLHFLYSEL

Show »
Length:632
Mass (Da):69,643
Checksum:i1B343BEF469CB005
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 127127MNQPE…HFQTS → MKALLLLVLPWLSPANYIDN VGNLHFLYSEL in isoform 2.
VSP_005733Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti132 – 1321S → F in AAK15039. 1 Publication
Sequence conflicti321 – 3211G → R in BAB71291. 1 Publication
Sequence conflicti366 – 3661N → T in BAB71291. 1 Publication
Sequence conflicti411 – 4111V → A in BAB71291. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF237782 mRNA. Translation: AAK15039.1.
AY358326 mRNA. Translation: AAQ88692.1.
AK056823 mRNA. Translation: BAB71291.1.
AC058822 Genomic DNA. No translation available.
AC095040 Genomic DNA. Translation: AAY41000.1.
BC022983 mRNA. Translation: AAH22983.1.
BC034737 mRNA. Translation: AAH34737.1.
CCDSiCCDS3492.1. [Q8TBB1-2]
CCDS47057.1. [Q8TBB1-1]
RefSeqiNP_001119800.1. NM_001126328.2. [Q8TBB1-1]
NP_116011.2. NM_032622.2. [Q8TBB1-2]
XP_005265842.1. XM_005265785.2. [Q8TBB1-1]
XP_005265843.1. XM_005265786.2. [Q8TBB1-1]
UniGeneiHs.518760.

Genome annotation databases

EnsembliENST00000263925; ENSP00000263925; ENSG00000072201. [Q8TBB1-1]
ENST00000306888; ENSP00000302879; ENSG00000072201. [Q8TBB1-2]
ENST00000513421; ENSP00000426445; ENSG00000072201.
GeneIDi84708.
KEGGihsa:84708.
UCSCiuc003haf.4. human. [Q8TBB1-2]
uc003hag.5. human. [Q8TBB1-1]

Polymorphism databases

DMDMi29840786.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF237782 mRNA. Translation: AAK15039.1 .
AY358326 mRNA. Translation: AAQ88692.1 .
AK056823 mRNA. Translation: BAB71291.1 .
AC058822 Genomic DNA. No translation available.
AC095040 Genomic DNA. Translation: AAY41000.1 .
BC022983 mRNA. Translation: AAH22983.1 .
BC034737 mRNA. Translation: AAH34737.1 .
CCDSi CCDS3492.1. [Q8TBB1-2 ]
CCDS47057.1. [Q8TBB1-1 ]
RefSeqi NP_001119800.1. NM_001126328.2. [Q8TBB1-1 ]
NP_116011.2. NM_032622.2. [Q8TBB1-2 ]
XP_005265842.1. XM_005265785.2. [Q8TBB1-1 ]
XP_005265843.1. XM_005265786.2. [Q8TBB1-1 ]
UniGenei Hs.518760.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3B76 X-ray 1.75 A/B 504-594 [» ]
ProteinModelPortali Q8TBB1.
SMRi Q8TBB1. Positions 41-129, 273-722.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124219. 146 interactions.
IntActi Q8TBB1. 54 interactions.
MINTi MINT-1441889.
STRINGi 9606.ENSP00000263925.

PTM databases

PhosphoSitei Q8TBB1.

Polymorphism databases

DMDMi 29840786.

Proteomic databases

PaxDbi Q8TBB1.
PRIDEi Q8TBB1.

Protocols and materials databases

DNASUi 84708.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000263925 ; ENSP00000263925 ; ENSG00000072201 . [Q8TBB1-1 ]
ENST00000306888 ; ENSP00000302879 ; ENSG00000072201 . [Q8TBB1-2 ]
ENST00000513421 ; ENSP00000426445 ; ENSG00000072201 .
GeneIDi 84708.
KEGGi hsa:84708.
UCSCi uc003haf.4. human. [Q8TBB1-2 ]
uc003hag.5. human. [Q8TBB1-1 ]

Organism-specific databases

CTDi 84708.
GeneCardsi GC04M054325.
HGNCi HGNC:6657. LNX1.
HPAi HPA002235.
MIMi 609732. gene.
neXtProti NX_Q8TBB1.
PharmGKBi PA30419.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG236845.
HOGENOMi HOG000261605.
HOVERGENi HBG039539.
InParanoidi Q8TBB1.
KOi K10692.
OMAi VFPRLYH.
OrthoDBi EOG75F4CJ.
PhylomeDBi Q8TBB1.
TreeFami TF330709.

Enzyme and pathway databases

UniPathwayi UPA00143 .

Miscellaneous databases

EvolutionaryTracei Q8TBB1.
GeneWikii LNX1.
GenomeRNAii 84708.
NextBioi 74806.
PROi Q8TBB1.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8TBB1.
Bgeei Q8TBB1.
CleanExi HS_LNX1.
Genevestigatori Q8TBB1.

Family and domain databases

Gene3Di 2.30.42.10. 4 hits.
3.30.40.10. 1 hit.
InterProi IPR001478. PDZ.
IPR018957. Znf_C3HC4_RING-type.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view ]
Pfami PF00595. PDZ. 4 hits.
PF00097. zf-C3HC4. 1 hit.
[Graphical view ]
SMARTi SM00228. PDZ. 4 hits.
SM00184. RING. 1 hit.
[Graphical view ]
SUPFAMi SSF50156. SSF50156. 4 hits.
PROSITEi PS50106. PDZ. 4 hits.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a human LNX protein containing multiple PDZ domains."
    Xie Y., Zhao W., Wang W., Zhao S., Tang R., Ying K., Zhou Z., Mao Y.
    Biochem. Genet. 39:117-126(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
    Tissue: Fetal brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Prostate.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain and Placenta.
  6. "The Coxsackievirus and adenovirus receptor (CAR) forms a complex with the PDZ domain-containing protein ligand-of-numb protein-X (LNX)."
    Sollerbrant K., Raschperger E., Mirza M., Engstroem U., Philipson L., Ljungdahl P.O., Pettersson R.F.
    J. Biol. Chem. 278:7439-7444(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CXADR.
  7. "Np9 protein of human endogenous retrovirus K interacts with ligand of numb protein X."
    Armbruester V., Sauter M., Roemer K., Best B., Hahn S., Nty A., Schmid A., Philipp S., Mueller A., Mueller-Lantzsch N.
    J. Virol. 78:10310-10319(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH NP9.
  8. "MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases."
    Doyle J.M., Gao J., Wang J., Yang M., Potts P.R.
    Mol. Cell 39:963-974(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH MAGEB18 AND MAGEF1.
  9. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiLNX1_HUMAN
AccessioniPrimary (citable) accession number: Q8TBB1
Secondary accession number(s): Q4W5K7
, Q8N4C2, Q96MJ7, Q9BY20
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 28, 2003
Last sequence update: June 1, 2002
Last modified: September 3, 2014
This is version 121 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi