Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

LIM domain only protein 3

Gene

LMO3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

GO - Biological processi

  • negative regulation of ERK1 and ERK2 cascade Source: UniProtKB
  • positive regulation of fat cell differentiation Source: UniProtKB
  • positive regulation of glucocorticoid receptor signaling pathway Source: UniProtKB
  • positive regulation of peroxisome proliferator activated receptor signaling pathway Source: UniProtKB
  • regulation of transcription, DNA-templated Source: UniProtKB-KW
  • transcription, DNA-templated Source: UniProtKB-KW

Keywordsi

Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

SIGNORiQ8TAP4

Names & Taxonomyi

Protein namesi
Recommended name:
LIM domain only protein 3
Short name:
LMO-3
Alternative name(s):
Neuronal-specific transcription factor DAT1
Rhombotin-3
Gene namesi
Name:LMO3
Synonyms:RBTN3, RBTNL2, RHOM3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000048540.14
HGNCiHGNC:6643 LMO3
MIMi180386 gene
neXtProtiNX_Q8TAP4

Subcellular locationi

Pathology & Biotechi

Organism-specific databases

DisGeNETi55885
OpenTargetsiENSG00000048540
PharmGKBiPA30409

Polymorphism and mutation databases

BioMutaiLMO3
DMDMi34098603

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000758171 – 145LIM domain only protein 3Add BLAST145

Proteomic databases

MaxQBiQ8TAP4
PaxDbiQ8TAP4
PeptideAtlasiQ8TAP4
PRIDEiQ8TAP4

PTM databases

iPTMnetiQ8TAP4
PhosphoSitePlusiQ8TAP4

Expressioni

Gene expression databases

BgeeiENSG00000048540
CleanExiHS_LMO3
ExpressionAtlasiQ8TAP4 baseline and differential
GenevisibleiQ8TAP4 HS

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi12097733 interactors.
DIPiDIP-50129N
IntActiQ8TAP4 86 interactors.
MINTiQ8TAP4
STRINGi9606.ENSP00000312856

Structurei

3D structure databases

ProteinModelPortaliQ8TAP4
SMRiQ8TAP4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini11 – 73LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST63
Domaini75 – 137LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST63

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiKOG0490 Eukaryota
ENOG410YIJ3 LUCA
GeneTreeiENSGT00760000118921
HOGENOMiHOG000232175
HOVERGENiHBG054231
InParanoidiQ8TAP4
OMAiXLFGVTG
OrthoDBiEOG091G0LKW
PhylomeDBiQ8TAP4
TreeFamiTF351071

Family and domain databases

InterProiView protein in InterPro
IPR001781 Znf_LIM
PfamiView protein in Pfam
PF00412 LIM, 2 hits
SMARTiView protein in SMART
SM00132 LIM, 2 hits
PROSITEiView protein in PROSITE
PS00478 LIM_DOMAIN_1, 2 hits
PS50023 LIM_DOMAIN_2, 2 hits

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TAP4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLSVQPDTKP KGCAGCNRKI KDRYLLKALD KYWHEDCLKC ACCDCRLGEV
60 70 80 90 100
GSTLYTKANL ILCRRDYLRL FGVTGNCAAC SKLIPAFEMV MRAKDNVYHL
110 120 130 140
DCFACQLCNQ RFCVGDKFFL KNNMILCQTD YEEGLMKEGY APQVR
Length:145
Mass (Da):16,594
Last modified:June 1, 2002 - v1
Checksum:i05284546BA5EC226
GO
Isoform 2 (identifier: Q8TAP4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-69: VGSTLYTKANLILCRRDYLR → HLKRCGSIYIHAAHTEIGICVTLEWPLPFVIIDFSQQITIAW

Show »
Length:167
Mass (Da):19,059
Checksum:i15DF48CDCE2DB95F
GO
Isoform 3 (identifier: Q8TAP4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQKKEKSFGIQM

Show »
Length:156
Mass (Da):17,899
Checksum:i57C8202A34AF191D
GO
Isoform 4 (identifier: Q8TAP4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLMEGGRAAAARNVSSIQM

Show »
Length:163
Mass (Da):18,438
Checksum:i63D462FD89CCBE05
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti29L → P in BAC04582 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0453121M → MQKKEKSFGIQM in isoform 3. 1 Publication1
Alternative sequenceiVSP_0473791M → MLMEGGRAAAARNVSSIQM in isoform 4. 1 Publication1
Alternative sequenceiVSP_04531350 – 69VGSTL…RDYLR → HLKRCGSIYIHAAHTEIGIC VTLEWPLPFVIIDFSQQITI AW in isoform 2. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB044745 mRNA Translation: BAD93349.1
AB044746 mRNA Translation: BAD93350.1
AK095595 mRNA Translation: BAC04582.1
AK294474 mRNA Translation: BAG57701.1
AK294909 mRNA Translation: BAG57996.1
AK316021 mRNA Translation: BAH14392.1
AC007529 Genomic DNA No translation available.
AC007552 Genomic DNA No translation available.
CH471094 Genomic DNA Translation: EAW96371.1
BC026311 mRNA Translation: AAH26311.1
BC050085 mRNA Translation: AAH50085.1
CCDSiCCDS58210.1 [Q8TAP4-2]
CCDS58211.1 [Q8TAP4-3]
CCDS58212.1 [Q8TAP4-4]
CCDS8678.1 [Q8TAP4-1]
RefSeqiNP_001001395.1, NM_001001395.2 [Q8TAP4-1]
NP_001230538.1, NM_001243609.1 [Q8TAP4-1]
NP_001230539.1, NM_001243610.1 [Q8TAP4-1]
NP_001230540.1, NM_001243611.1 [Q8TAP4-3]
NP_001230541.1, NM_001243612.1 [Q8TAP4-4]
NP_001230542.1, NM_001243613.1 [Q8TAP4-2]
NP_061110.2, NM_018640.4 [Q8TAP4-1]
XP_006719173.1, XM_006719110.3 [Q8TAP4-1]
XP_006719174.1, XM_006719111.2 [Q8TAP4-1]
XP_011519064.1, XM_011520762.1 [Q8TAP4-1]
XP_011519065.1, XM_011520763.1 [Q8TAP4-1]
UniGeneiHs.504908

Genome annotation databases

EnsembliENST00000261169; ENSP00000261169; ENSG00000048540 [Q8TAP4-3]
ENST00000320122; ENSP00000312856; ENSG00000048540 [Q8TAP4-1]
ENST00000354662; ENSP00000346689; ENSG00000048540 [Q8TAP4-1]
ENST00000441439; ENSP00000412479; ENSG00000048540 [Q8TAP4-1]
ENST00000447609; ENSP00000413703; ENSG00000048540 [Q8TAP4-1]
ENST00000534946; ENSP00000439275; ENSG00000048540 [Q8TAP4-1]
ENST00000535535; ENSP00000446115; ENSG00000048540 [Q8TAP4-1]
ENST00000537304; ENSP00000440099; ENSG00000048540 [Q8TAP4-1]
ENST00000540445; ENSP00000442786; ENSG00000048540 [Q8TAP4-2]
ENST00000540848; ENSP00000445751; ENSG00000048540 [Q8TAP4-1]
ENST00000541295; ENSP00000446463; ENSG00000048540 [Q8TAP4-4]
ENST00000541846; ENSP00000444393; ENSG00000048540 [Q8TAP4-1]
GeneIDi55885
KEGGihsa:55885
UCSCiuc001rdj.3 human [Q8TAP4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiLMO3_HUMAN
AccessioniPrimary (citable) accession number: Q8TAP4
Secondary accession number(s): B4DG90
, B4DH35, Q58A66, Q58A67, Q8N974, Q9UDD5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: June 1, 2002
Last modified: February 28, 2018
This is version 127 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome