Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

LIM domain only protein 3

Gene

LMO3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

GO - Biological processi

  • negative regulation of ERK1 and ERK2 cascade Source: UniProtKB
  • positive regulation of fat cell differentiation Source: UniProtKB
  • positive regulation of glucocorticoid receptor signaling pathway Source: UniProtKB
  • positive regulation of peroxisome proliferator activated receptor signaling pathway Source: UniProtKB
  • regulation of transcription, DNA-templated Source: UniProtKB-KW
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
LIM domain only protein 3
Short name:
LMO-3
Alternative name(s):
Neuronal-specific transcription factor DAT1
Rhombotin-3
Gene namesi
Name:LMO3
Synonyms:RBTN3, RBTNL2, RHOM3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:6643. LMO3.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30409.

Polymorphism and mutation databases

BioMutaiLMO3.
DMDMi34098603.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 145145LIM domain only protein 3PRO_0000075817Add
BLAST

Proteomic databases

EPDiQ8TAP4.
PaxDbiQ8TAP4.
PeptideAtlasiQ8TAP4.
PRIDEiQ8TAP4.

PTM databases

iPTMnetiQ8TAP4.
PhosphoSiteiQ8TAP4.

Expressioni

Gene expression databases

BgeeiQ8TAP4.
CleanExiHS_LMO3.
ExpressionAtlasiQ8TAP4. baseline and differential.
GenevisibleiQ8TAP4. HS.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
BANPQ8N9N53EBI-742259,EBI-744695
CEP57L1Q8IYX8-23EBI-742259,EBI-10181988
FAM131CQ96AQ93EBI-742259,EBI-741921
FBLIM1Q8WUP23EBI-742259,EBI-3864120
FOSQ6FG413EBI-742259,EBI-10198738
IKZF1Q134223EBI-742259,EBI-745305
KCTD1Q719H93EBI-742259,EBI-9027502
NUTM1Q86Y263EBI-742259,EBI-10178410
SAMD3Q8N6K73EBI-742259,EBI-748741
SP4Q024463EBI-742259,EBI-10198587
SPERTQ8NA613EBI-742259,EBI-741724
TAX1BP1Q86VP13EBI-742259,EBI-529518

Protein-protein interaction databases

BioGridi120977. 32 interactions.
IntActiQ8TAP4. 29 interactions.
MINTiMINT-2874669.
STRINGi9606.ENSP00000312856.

Structurei

3D structure databases

ProteinModelPortaliQ8TAP4.
SMRiQ8TAP4. Positions 13-133.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini11 – 7363LIM zinc-binding 1PROSITE-ProRule annotationAdd
BLAST
Domaini75 – 13763LIM zinc-binding 2PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 2 LIM zinc-binding domains.PROSITE-ProRule annotation

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiKOG0490. Eukaryota.
ENOG410YIJ3. LUCA.
GeneTreeiENSGT00720000108603.
HOGENOMiHOG000232175.
HOVERGENiHBG054231.
InParanoidiQ8TAP4.
OMAiGENNISC.
OrthoDBiEOG75J0PF.
PhylomeDBiQ8TAP4.
TreeFamiTF351071.

Family and domain databases

Gene3Di2.10.110.10. 2 hits.
InterProiIPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 2 hits.
[Graphical view]
SMARTiSM00132. LIM. 2 hits.
[Graphical view]
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TAP4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLSVQPDTKP KGCAGCNRKI KDRYLLKALD KYWHEDCLKC ACCDCRLGEV
60 70 80 90 100
GSTLYTKANL ILCRRDYLRL FGVTGNCAAC SKLIPAFEMV MRAKDNVYHL
110 120 130 140
DCFACQLCNQ RFCVGDKFFL KNNMILCQTD YEEGLMKEGY APQVR
Length:145
Mass (Da):16,594
Last modified:June 1, 2002 - v1
Checksum:i05284546BA5EC226
GO
Isoform 2 (identifier: Q8TAP4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-69: VGSTLYTKANLILCRRDYLR → HLKRCGSIYIHAAHTEIGICVTLEWPLPFVIIDFSQQITIAW

Show »
Length:167
Mass (Da):19,059
Checksum:i15DF48CDCE2DB95F
GO
Isoform 3 (identifier: Q8TAP4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQKKEKSFGIQM

Show »
Length:156
Mass (Da):17,899
Checksum:i57C8202A34AF191D
GO
Isoform 4 (identifier: Q8TAP4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLMEGGRAAAARNVSSIQM

Show »
Length:163
Mass (Da):18,438
Checksum:i63D462FD89CCBE05
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti29 – 291L → P in BAC04582 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MQKKEKSFGIQM in isoform 3. 1 PublicationVSP_045312
Alternative sequencei1 – 11M → MLMEGGRAAAARNVSSIQM in isoform 4. 1 PublicationVSP_047379
Alternative sequencei50 – 6920VGSTL…RDYLR → HLKRCGSIYIHAAHTEIGIC VTLEWPLPFVIIDFSQQITI AW in isoform 2. 1 PublicationVSP_045313Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB044745 mRNA. Translation: BAD93349.1.
AB044746 mRNA. Translation: BAD93350.1.
AK095595 mRNA. Translation: BAC04582.1.
AK294474 mRNA. Translation: BAG57701.1.
AK294909 mRNA. Translation: BAG57996.1.
AK316021 mRNA. Translation: BAH14392.1.
AC007529 Genomic DNA. No translation available.
AC007552 Genomic DNA. No translation available.
CH471094 Genomic DNA. Translation: EAW96371.1.
BC026311 mRNA. Translation: AAH26311.1.
BC050085 mRNA. Translation: AAH50085.1.
CCDSiCCDS58210.1. [Q8TAP4-2]
CCDS58211.1. [Q8TAP4-3]
CCDS58212.1. [Q8TAP4-4]
CCDS8678.1. [Q8TAP4-1]
RefSeqiNP_001001395.1. NM_001001395.2. [Q8TAP4-1]
NP_001230538.1. NM_001243609.1. [Q8TAP4-1]
NP_001230539.1. NM_001243610.1. [Q8TAP4-1]
NP_001230540.1. NM_001243611.1. [Q8TAP4-3]
NP_001230541.1. NM_001243612.1. [Q8TAP4-4]
NP_001230542.1. NM_001243613.1. [Q8TAP4-2]
NP_061110.2. NM_018640.4. [Q8TAP4-1]
XP_006719173.1. XM_006719110.2. [Q8TAP4-1]
XP_006719174.1. XM_006719111.2. [Q8TAP4-1]
XP_011519064.1. XM_011520762.1. [Q8TAP4-1]
XP_011519065.1. XM_011520763.1. [Q8TAP4-1]
XP_011519066.1. XM_011520764.1. [Q8TAP4-1]
UniGeneiHs.504908.

Genome annotation databases

EnsembliENST00000261169; ENSP00000261169; ENSG00000048540. [Q8TAP4-3]
ENST00000320122; ENSP00000312856; ENSG00000048540. [Q8TAP4-1]
ENST00000354662; ENSP00000346689; ENSG00000048540. [Q8TAP4-1]
ENST00000441439; ENSP00000412479; ENSG00000048540. [Q8TAP4-1]
ENST00000447609; ENSP00000413703; ENSG00000048540. [Q8TAP4-1]
ENST00000534946; ENSP00000439275; ENSG00000048540. [Q8TAP4-1]
ENST00000535535; ENSP00000446115; ENSG00000048540. [Q8TAP4-1]
ENST00000537304; ENSP00000440099; ENSG00000048540. [Q8TAP4-1]
ENST00000540445; ENSP00000442786; ENSG00000048540. [Q8TAP4-2]
ENST00000540848; ENSP00000445751; ENSG00000048540. [Q8TAP4-1]
ENST00000541295; ENSP00000446463; ENSG00000048540. [Q8TAP4-4]
ENST00000541846; ENSP00000444393; ENSG00000048540. [Q8TAP4-1]
GeneIDi55885.
KEGGihsa:55885.
UCSCiuc001rdj.3. human. [Q8TAP4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB044745 mRNA. Translation: BAD93349.1.
AB044746 mRNA. Translation: BAD93350.1.
AK095595 mRNA. Translation: BAC04582.1.
AK294474 mRNA. Translation: BAG57701.1.
AK294909 mRNA. Translation: BAG57996.1.
AK316021 mRNA. Translation: BAH14392.1.
AC007529 Genomic DNA. No translation available.
AC007552 Genomic DNA. No translation available.
CH471094 Genomic DNA. Translation: EAW96371.1.
BC026311 mRNA. Translation: AAH26311.1.
BC050085 mRNA. Translation: AAH50085.1.
CCDSiCCDS58210.1. [Q8TAP4-2]
CCDS58211.1. [Q8TAP4-3]
CCDS58212.1. [Q8TAP4-4]
CCDS8678.1. [Q8TAP4-1]
RefSeqiNP_001001395.1. NM_001001395.2. [Q8TAP4-1]
NP_001230538.1. NM_001243609.1. [Q8TAP4-1]
NP_001230539.1. NM_001243610.1. [Q8TAP4-1]
NP_001230540.1. NM_001243611.1. [Q8TAP4-3]
NP_001230541.1. NM_001243612.1. [Q8TAP4-4]
NP_001230542.1. NM_001243613.1. [Q8TAP4-2]
NP_061110.2. NM_018640.4. [Q8TAP4-1]
XP_006719173.1. XM_006719110.2. [Q8TAP4-1]
XP_006719174.1. XM_006719111.2. [Q8TAP4-1]
XP_011519064.1. XM_011520762.1. [Q8TAP4-1]
XP_011519065.1. XM_011520763.1. [Q8TAP4-1]
XP_011519066.1. XM_011520764.1. [Q8TAP4-1]
UniGeneiHs.504908.

3D structure databases

ProteinModelPortaliQ8TAP4.
SMRiQ8TAP4. Positions 13-133.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120977. 32 interactions.
IntActiQ8TAP4. 29 interactions.
MINTiMINT-2874669.
STRINGi9606.ENSP00000312856.

PTM databases

iPTMnetiQ8TAP4.
PhosphoSiteiQ8TAP4.

Polymorphism and mutation databases

BioMutaiLMO3.
DMDMi34098603.

Proteomic databases

EPDiQ8TAP4.
PaxDbiQ8TAP4.
PeptideAtlasiQ8TAP4.
PRIDEiQ8TAP4.

Protocols and materials databases

DNASUi55885.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261169; ENSP00000261169; ENSG00000048540. [Q8TAP4-3]
ENST00000320122; ENSP00000312856; ENSG00000048540. [Q8TAP4-1]
ENST00000354662; ENSP00000346689; ENSG00000048540. [Q8TAP4-1]
ENST00000441439; ENSP00000412479; ENSG00000048540. [Q8TAP4-1]
ENST00000447609; ENSP00000413703; ENSG00000048540. [Q8TAP4-1]
ENST00000534946; ENSP00000439275; ENSG00000048540. [Q8TAP4-1]
ENST00000535535; ENSP00000446115; ENSG00000048540. [Q8TAP4-1]
ENST00000537304; ENSP00000440099; ENSG00000048540. [Q8TAP4-1]
ENST00000540445; ENSP00000442786; ENSG00000048540. [Q8TAP4-2]
ENST00000540848; ENSP00000445751; ENSG00000048540. [Q8TAP4-1]
ENST00000541295; ENSP00000446463; ENSG00000048540. [Q8TAP4-4]
ENST00000541846; ENSP00000444393; ENSG00000048540. [Q8TAP4-1]
GeneIDi55885.
KEGGihsa:55885.
UCSCiuc001rdj.3. human. [Q8TAP4-1]

Organism-specific databases

CTDi55885.
GeneCardsiLMO3.
HGNCiHGNC:6643. LMO3.
MIMi180386. gene.
neXtProtiNX_Q8TAP4.
PharmGKBiPA30409.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0490. Eukaryota.
ENOG410YIJ3. LUCA.
GeneTreeiENSGT00720000108603.
HOGENOMiHOG000232175.
HOVERGENiHBG054231.
InParanoidiQ8TAP4.
OMAiGENNISC.
OrthoDBiEOG75J0PF.
PhylomeDBiQ8TAP4.
TreeFamiTF351071.

Miscellaneous databases

ChiTaRSiLMO3. human.
GeneWikiiLMO3.
GenomeRNAii55885.
PROiQ8TAP4.
SOURCEiSearch...

Gene expression databases

BgeeiQ8TAP4.
CleanExiHS_LMO3.
ExpressionAtlasiQ8TAP4. baseline and differential.
GenevisibleiQ8TAP4. HS.

Family and domain databases

Gene3Di2.10.110.10. 2 hits.
InterProiIPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 2 hits.
[Graphical view]
SMARTiSM00132. LIM. 2 hits.
[Graphical view]
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The gene expressed in primary neuroblastoma."
    Nakagawara A., Inuzuka H., Ohira M., Shishikura T., Morohashi A., Kuma H., Nozawa I.
    Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4).
    Tissue: Amygdala and Brain.
  3. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  6. "The rhombotin gene family encode related LIM-domain proteins whose differing expression suggests multiple roles in mouse development."
    Foroni L., Boehm T., White L., Forster A., Sherrington P., Liao X.B., Brannan C.I., Jenkins N.A., Copeland N.G., Rabbitts T.H.
    J. Mol. Biol. 226:747-761(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-69.
    Tissue: Brain.

Entry informationi

Entry nameiLMO3_HUMAN
AccessioniPrimary (citable) accession number: Q8TAP4
Secondary accession number(s): B4DG90
, B4DH35, Q58A66, Q58A67, Q8N974, Q9UDD5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: June 1, 2002
Last modified: July 6, 2016
This is version 115 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.