Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

V-set and transmembrane domain-containing protein 2A

Gene

VSTM2A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
V-set and transmembrane domain-containing protein 2A
Gene namesi
Name:VSTM2A
Synonyms:VSTM2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:28499. VSTM2A.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162408875.

Polymorphism and mutation databases

BioMutaiVSTM2A.
DMDMi308153542.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2424Sequence analysisAdd
BLAST
Chaini25 – 236212V-set and transmembrane domain-containing protein 2APRO_0000014775Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi35 – 351N-linked (GlcNAc...)Sequence analysis
Disulfide bondi48 ↔ 127PROSITE-ProRule annotation
Glycosylationi175 – 1751N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ8TAG5.
PeptideAtlasiQ8TAG5.
PRIDEiQ8TAG5.

PTM databases

iPTMnetiQ8TAG5.
PhosphoSiteiQ8TAG5.

Expressioni

Gene expression databases

BgeeiENSG00000170419.
CleanExiHS_VSTM2A.
ExpressionAtlasiQ8TAG5. baseline and differential.
GenevisibleiQ8TAG5. HS.

Organism-specific databases

HPAiHPA021404.
HPA024134.

Interactioni

Protein-protein interaction databases

BioGridi128776. 2 interactions.
IntActiQ8TAG5. 1 interaction.
STRINGi9606.ENSP00000384967.

Structurei

3D structure databases

ProteinModelPortaliQ8TAG5.
SMRiQ8TAG5. Positions 39-132.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini27 – 143117Ig-like V-typeAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal

Phylogenomic databases

eggNOGiENOG410IKN2. Eukaryota.
ENOG410YG4F. LUCA.
GeneTreeiENSGT00510000046940.
HOGENOMiHOG000253955.
HOVERGENiHBG052093.
InParanoidiQ8TAG5.
OMAiIHNSANQ.
PhylomeDBiQ8TAG5.
TreeFamiTF331739.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TAG5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMGIFLVYVG FVFFSVLYVQ QGLSSQAKFT EFPRNVTATE GQNVEMSCAF
60 70 80 90 100
QSGSASVYLE IQWWFLRGPE DLDPGAEGAG AQVELLPDRD PDSDGTKIST
110 120 130 140 150
VKVQGNDISH KLQISKVRKK DEGLYECRVT DANYGELQEH KAQAYLKVNA
160 170 180 190 200
NSHARRMQAF EASPMWLQDM KPRKNVSAAI PSSIHGSANQ RTHSTSSPQV
210 220 230
VAKIPKQSPQ SGARIATSHG LSVLLLVCGF VKGALL
Length:236
Mass (Da):25,833
Last modified:October 5, 2010 - v3
Checksum:i3A4545C081E1C85A
GO
Isoform 2 (identifier: Q8TAG5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     213-236: ARIATSHGLSVLLLVCGFVKGALL → METHFEPFILPLTNAPQKGQSYRVDRFMNGDF

Show »
Length:244
Mass (Da):27,182
Checksum:i77BBA8C615775563
GO

Sequence cautioni

The sequence AAH28404 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence EAL23809 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti84 – 841E → K.1 Publication
Corresponds to variant rs17855529 [ dbSNP | Ensembl ].
VAR_047034

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei213 – 23624ARIAT…KGALL → METHFEPFILPLTNAPQKGQ SYRVDRFMNGDF in isoform 2. 1 PublicationVSP_039817Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC069313 Genomic DNA. No translation available.
CH236957 Genomic DNA. Translation: EAL23809.1. Different initiation.
CH471201 Genomic DNA. Translation: EAW50952.1.
BC028404 mRNA. Translation: AAH28404.1. Different initiation.
CCDSiCCDS5512.2. [Q8TAG5-1]
RefSeqiNP_001304772.1. NM_001317843.1. [Q8TAG5-2]
NP_872352.2. NM_182546.3. [Q8TAG5-1]
UniGeneiHs.335933.
Hs.731937.

Genome annotation databases

EnsembliENST00000302287; ENSP00000303108; ENSG00000170419. [Q8TAG5-2]
ENST00000407838; ENSP00000384967; ENSG00000170419. [Q8TAG5-1]
GeneIDi222008.
KEGGihsa:222008.
UCSCiuc010kzf.4. human. [Q8TAG5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC069313 Genomic DNA. No translation available.
CH236957 Genomic DNA. Translation: EAL23809.1. Different initiation.
CH471201 Genomic DNA. Translation: EAW50952.1.
BC028404 mRNA. Translation: AAH28404.1. Different initiation.
CCDSiCCDS5512.2. [Q8TAG5-1]
RefSeqiNP_001304772.1. NM_001317843.1. [Q8TAG5-2]
NP_872352.2. NM_182546.3. [Q8TAG5-1]
UniGeneiHs.335933.
Hs.731937.

3D structure databases

ProteinModelPortaliQ8TAG5.
SMRiQ8TAG5. Positions 39-132.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128776. 2 interactions.
IntActiQ8TAG5. 1 interaction.
STRINGi9606.ENSP00000384967.

PTM databases

iPTMnetiQ8TAG5.
PhosphoSiteiQ8TAG5.

Polymorphism and mutation databases

BioMutaiVSTM2A.
DMDMi308153542.

Proteomic databases

PaxDbiQ8TAG5.
PeptideAtlasiQ8TAG5.
PRIDEiQ8TAG5.

Protocols and materials databases

DNASUi222008.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000302287; ENSP00000303108; ENSG00000170419. [Q8TAG5-2]
ENST00000407838; ENSP00000384967; ENSG00000170419. [Q8TAG5-1]
GeneIDi222008.
KEGGihsa:222008.
UCSCiuc010kzf.4. human. [Q8TAG5-1]

Organism-specific databases

CTDi222008.
GeneCardsiVSTM2A.
HGNCiHGNC:28499. VSTM2A.
HPAiHPA021404.
HPA024134.
neXtProtiNX_Q8TAG5.
PharmGKBiPA162408875.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IKN2. Eukaryota.
ENOG410YG4F. LUCA.
GeneTreeiENSGT00510000046940.
HOGENOMiHOG000253955.
HOVERGENiHBG052093.
InParanoidiQ8TAG5.
OMAiIHNSANQ.
PhylomeDBiQ8TAG5.
TreeFamiTF331739.

Miscellaneous databases

GenomeRNAii222008.
PROiQ8TAG5.

Gene expression databases

BgeeiENSG00000170419.
CleanExiHS_VSTM2A.
ExpressionAtlasiQ8TAG5. baseline and differential.
GenevisibleiQ8TAG5. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiVTM2A_HUMAN
AccessioniPrimary (citable) accession number: Q8TAG5
Secondary accession number(s): A4D2E9, B5MC94
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 23, 2004
Last sequence update: October 5, 2010
Last modified: September 7, 2016
This is version 112 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.