Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

V-set and transmembrane domain-containing protein 2A

Gene

VSTM2A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in the regulation of the early stage of white and brown preadipocyte cell differentiation. Promotes adipogenic commitment of preadipocytes by increasing gene expression of the transcription factor PPARG in a BMP4-dependent signaling pathway.1 Publication

GO - Molecular functioni

GO - Biological processi

  • cellular response to BMP stimulus Source: UniProtKB
  • positive regulation of brown fat cell differentiation Source: UniProtKB
  • positive regulation of gene expression Source: UniProtKB
  • positive regulation of lipid storage Source: UniProtKB
  • positive regulation of white fat cell proliferation Source: UniProtKB

Keywordsi

Biological processDifferentiation

Names & Taxonomyi

Protein namesi
Recommended name:
V-set and transmembrane domain-containing protein 2AImported
Gene namesi
Name:VSTM2AImported
Synonyms:VSTM2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:28499. VSTM2A.

Subcellular locationi

  • Secreted By similarity

  • Note: Secreted by adipose precursor cells (By similarity). Not detected in the nucleus (PubMed:28052263).By similarity

GO - Cellular componenti

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000170419.
PharmGKBiPA162408875.

Polymorphism and mutation databases

BioMutaiVSTM2A.
DMDMi308153542.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 24Sequence analysisAdd BLAST24
ChainiPRO_000001477525 – 236V-set and transmembrane domain-containing protein 2AAdd BLAST212

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi35N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi48 ↔ 127PROSITE-ProRule annotation
Glycosylationi175N-linked (GlcNAc...)Sequence analysis1

Post-translational modificationi

N-glycosylated. N-linked glycosylation is critical for secretion but not for preadipocyte cell differentiation activity.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ8TAG5.
PeptideAtlasiQ8TAG5.
PRIDEiQ8TAG5.

PTM databases

iPTMnetiQ8TAG5.
PhosphoSitePlusiQ8TAG5.

Expressioni

Developmental stagei

Expressed early in fetal white adipose tissues from 17 to 21 weeks of gestation (at protein level).

Gene expression databases

BgeeiENSG00000170419.
CleanExiHS_VSTM2A.
ExpressionAtlasiQ8TAG5. baseline and differential.
GenevisibleiQ8TAG5. HS.

Organism-specific databases

HPAiHPA021404.
HPA024134.

Interactioni

Subunit structurei

Homodimer.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi128776. 2 interactors.
IntActiQ8TAG5. 1 interactor.
STRINGi9606.ENSP00000384967.

Structurei

3D structure databases

ProteinModelPortaliQ8TAG5.
SMRiQ8TAG5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini27 – 143Ig-like V-typeAdd BLAST117

Keywords - Domaini

Immunoglobulin domain, Signal

Phylogenomic databases

eggNOGiENOG410IKN2. Eukaryota.
ENOG410YG4F. LUCA.
GeneTreeiENSGT00510000046940.
HOGENOMiHOG000253955.
HOVERGENiHBG052093.
InParanoidiQ8TAG5.
OMAiIHNSANQ.
PhylomeDBiQ8TAG5.
TreeFamiTF331739.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiView protein in InterPro
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
PfamiView protein in Pfam
PF07686. V-set. 1 hit.
SMARTiView protein in SMART
SM00409. IG. 1 hit.
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiView protein in PROSITE
PS50835. IG_LIKE. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TAG5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMGIFLVYVG FVFFSVLYVQ QGLSSQAKFT EFPRNVTATE GQNVEMSCAF
60 70 80 90 100
QSGSASVYLE IQWWFLRGPE DLDPGAEGAG AQVELLPDRD PDSDGTKIST
110 120 130 140 150
VKVQGNDISH KLQISKVRKK DEGLYECRVT DANYGELQEH KAQAYLKVNA
160 170 180 190 200
NSHARRMQAF EASPMWLQDM KPRKNVSAAI PSSIHGSANQ RTHSTSSPQV
210 220 230
VAKIPKQSPQ SGARIATSHG LSVLLLVCGF VKGALL
Length:236
Mass (Da):25,833
Last modified:October 5, 2010 - v3
Checksum:i3A4545C081E1C85A
GO
Isoform 2 (identifier: Q8TAG5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     213-236: ARIATSHGLSVLLLVCGFVKGALL → METHFEPFILPLTNAPQKGQSYRVDRFMNGDF

Show »
Length:244
Mass (Da):27,182
Checksum:i77BBA8C615775563
GO

Sequence cautioni

The sequence AAH28404 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence EAL23809 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04703484E → K1 PublicationCorresponds to variant dbSNP:rs17855529Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_039817213 – 236ARIAT…KGALL → METHFEPFILPLTNAPQKGQ SYRVDRFMNGDF in isoform 2. 1 PublicationAdd BLAST24

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC069313 Genomic DNA. No translation available.
CH236957 Genomic DNA. Translation: EAL23809.1. Different initiation.
CH471201 Genomic DNA. Translation: EAW50952.1.
BC028404 mRNA. Translation: AAH28404.1. Different initiation.
CCDSiCCDS5512.2. [Q8TAG5-1]
CCDS83185.1. [Q8TAG5-2]
RefSeqiNP_001304772.1. NM_001317843.1. [Q8TAG5-2]
NP_872352.2. NM_182546.3. [Q8TAG5-1]
UniGeneiHs.335933.
Hs.731937.

Genome annotation databases

EnsembliENST00000302287; ENSP00000303108; ENSG00000170419. [Q8TAG5-2]
ENST00000407838; ENSP00000384967; ENSG00000170419. [Q8TAG5-1]
GeneIDi222008.
KEGGihsa:222008.
UCSCiuc010kzf.4. human. [Q8TAG5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC069313 Genomic DNA. No translation available.
CH236957 Genomic DNA. Translation: EAL23809.1. Different initiation.
CH471201 Genomic DNA. Translation: EAW50952.1.
BC028404 mRNA. Translation: AAH28404.1. Different initiation.
CCDSiCCDS5512.2. [Q8TAG5-1]
CCDS83185.1. [Q8TAG5-2]
RefSeqiNP_001304772.1. NM_001317843.1. [Q8TAG5-2]
NP_872352.2. NM_182546.3. [Q8TAG5-1]
UniGeneiHs.335933.
Hs.731937.

3D structure databases

ProteinModelPortaliQ8TAG5.
SMRiQ8TAG5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128776. 2 interactors.
IntActiQ8TAG5. 1 interactor.
STRINGi9606.ENSP00000384967.

PTM databases

iPTMnetiQ8TAG5.
PhosphoSitePlusiQ8TAG5.

Polymorphism and mutation databases

BioMutaiVSTM2A.
DMDMi308153542.

Proteomic databases

PaxDbiQ8TAG5.
PeptideAtlasiQ8TAG5.
PRIDEiQ8TAG5.

Protocols and materials databases

DNASUi222008.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000302287; ENSP00000303108; ENSG00000170419. [Q8TAG5-2]
ENST00000407838; ENSP00000384967; ENSG00000170419. [Q8TAG5-1]
GeneIDi222008.
KEGGihsa:222008.
UCSCiuc010kzf.4. human. [Q8TAG5-1]

Organism-specific databases

CTDi222008.
GeneCardsiVSTM2A.
HGNCiHGNC:28499. VSTM2A.
HPAiHPA021404.
HPA024134.
neXtProtiNX_Q8TAG5.
OpenTargetsiENSG00000170419.
PharmGKBiPA162408875.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IKN2. Eukaryota.
ENOG410YG4F. LUCA.
GeneTreeiENSGT00510000046940.
HOGENOMiHOG000253955.
HOVERGENiHBG052093.
InParanoidiQ8TAG5.
OMAiIHNSANQ.
PhylomeDBiQ8TAG5.
TreeFamiTF331739.

Miscellaneous databases

GenomeRNAii222008.
PROiPR:Q8TAG5.

Gene expression databases

BgeeiENSG00000170419.
CleanExiHS_VSTM2A.
ExpressionAtlasiQ8TAG5. baseline and differential.
GenevisibleiQ8TAG5. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiView protein in InterPro
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
PfamiView protein in Pfam
PF07686. V-set. 1 hit.
SMARTiView protein in SMART
SM00409. IG. 1 hit.
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiView protein in PROSITE
PS50835. IG_LIKE. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiVTM2A_HUMAN
AccessioniPrimary (citable) accession number: Q8TAG5
Secondary accession number(s): A4D2E9, B5MC94
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 23, 2004
Last sequence update: October 5, 2010
Last modified: April 12, 2017
This is version 116 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.