Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rieske domain-containing protein

Gene

RFESD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at protein leveli

Functioni

Cofactori

[2Fe-2S] clusterPROSITE-ProRule annotationNote: Binds 1 [2Fe-2S] cluster per subunit.PROSITE-ProRule annotation

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi57 – 571Iron-sulfur (2Fe-2S)PROSITE-ProRule annotation
Metal bindingi59 – 591Iron-sulfur (2Fe-2S); via pros nitrogenPROSITE-ProRule annotation
Metal bindingi80 – 801Iron-sulfur (2Fe-2S)PROSITE-ProRule annotation
Metal bindingi83 – 831Iron-sulfur (2Fe-2S); via pros nitrogenPROSITE-ProRule annotation

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

2Fe-2S, Iron, Iron-sulfur, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Rieske domain-containing protein
Gene namesi
Name:RFESD
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:29587. RFESD.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162401171.

Polymorphism and mutation databases

BioMutaiRFESD.
DMDMi74730342.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 157157Rieske domain-containing proteinPRO_0000313813Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineCombined sources
Modified residuei6 – 61PhosphoserineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ8TAC1.
MaxQBiQ8TAC1.
PaxDbiQ8TAC1.
PeptideAtlasiQ8TAC1.
PRIDEiQ8TAC1.

PTM databases

iPTMnetiQ8TAC1.
PhosphoSiteiQ8TAC1.

Expressioni

Gene expression databases

BgeeiQ8TAC1.
CleanExiHS_RFESD.
ExpressionAtlasiQ8TAC1. baseline and differential.
GenevisibleiQ8TAC1. HS.

Organism-specific databases

HPAiCAB016546.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
HBQ1P091053EBI-10271664,EBI-10193656

Protein-protein interaction databases

BioGridi130435. 1 interaction.
IntActiQ8TAC1. 1 interaction.
STRINGi9606.ENSP00000369341.

Structurei

3D structure databases

ProteinModelPortaliQ8TAC1.
SMRiQ8TAC1. Positions 14-154.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini16 – 9479Rieske 1PROSITE-ProRule annotationAdd
BLAST
Domaini17 – 131115Rieske 2PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 2 Rieske domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IWA6. Eukaryota.
ENOG4111Q5H. LUCA.
GeneTreeiENSGT00390000018225.
HOGENOMiHOG000128541.
HOVERGENiHBG061590.
InParanoidiQ8TAC1.
OMAiWCSKGVK.
PhylomeDBiQ8TAC1.
TreeFamiTF333320.

Family and domain databases

Gene3Di2.102.10.10. 1 hit.
InterProiIPR017941. Rieske_2Fe-2S.
[Graphical view]
PfamiPF00355. Rieske. 1 hit.
[Graphical view]
SUPFAMiSSF50022. SSF50022. 1 hit.
PROSITEiPS51296. RIESKE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TAC1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNLDGSAQDP EKREYSSVCV GREDDIKKSE RMTAVVHDRE VVIFYHKGEY
60 70 80 90 100
HAMDIRCYHS GGPLHLGDIE DFDGRPCIVC PWHKYKITLA TGEGLYQSIN
110 120 130 140 150
PKDPSAKPKW CSKGIKQRIH TVTVDNGNIY VTLSNEPFKC DSDFYATGDF

KVIKSSS
Length:157
Mass (Da):17,762
Last modified:June 1, 2002 - v1
Checksum:iE959948673E776F8
GO
Isoform 2 (identifier: Q8TAC1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLKCFRNCLRPSSLSTLPLQYGILFPKLLACLVHLHFGHFSSAVISVTSFYLSM

Note: No experimental confirmation available.
Show »
Length:210
Mass (Da):23,702
Checksum:iD917F08DC8C08536
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MLKCFRNCLRPSSLSTLPLQ YGILFPKLLACLVHLHFGHF SSAVISVTSFYLSM in isoform 2. 1 PublicationVSP_044452

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC008547 Genomic DNA. No translation available.
CH471084 Genomic DNA. Translation: EAW96043.1.
CH471084 Genomic DNA. Translation: EAW96045.1.
BC024023 mRNA. Translation: AAH24023.1.
BC035110 mRNA. Translation: AAH35110.1.
BC048979 mRNA. Translation: AAH48979.1.
BM263054 mRNA. No translation available.
CCDSiCCDS4075.1. [Q8TAC1-1]
CCDS47248.1. [Q8TAC1-2]
RefSeqiNP_001124537.1. NM_001131065.1. [Q8TAC1-2]
NP_001124538.1. NM_001131066.1. [Q8TAC1-2]
NP_775498.1. NM_173362.3. [Q8TAC1-1]
XP_011541662.1. XM_011543360.1. [Q8TAC1-2]
XP_011541663.1. XM_011543361.1. [Q8TAC1-1]
UniGeneiHs.399758.

Genome annotation databases

EnsembliENST00000311364; ENSP00000309229; ENSG00000175449. [Q8TAC1-1]
ENST00000380005; ENSP00000369341; ENSG00000175449. [Q8TAC1-2]
ENST00000458310; ENSP00000413592; ENSG00000175449. [Q8TAC1-2]
GeneIDi317671.
KEGGihsa:317671.
UCSCiuc003klf.4. human. [Q8TAC1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC008547 Genomic DNA. No translation available.
CH471084 Genomic DNA. Translation: EAW96043.1.
CH471084 Genomic DNA. Translation: EAW96045.1.
BC024023 mRNA. Translation: AAH24023.1.
BC035110 mRNA. Translation: AAH35110.1.
BC048979 mRNA. Translation: AAH48979.1.
BM263054 mRNA. No translation available.
CCDSiCCDS4075.1. [Q8TAC1-1]
CCDS47248.1. [Q8TAC1-2]
RefSeqiNP_001124537.1. NM_001131065.1. [Q8TAC1-2]
NP_001124538.1. NM_001131066.1. [Q8TAC1-2]
NP_775498.1. NM_173362.3. [Q8TAC1-1]
XP_011541662.1. XM_011543360.1. [Q8TAC1-2]
XP_011541663.1. XM_011543361.1. [Q8TAC1-1]
UniGeneiHs.399758.

3D structure databases

ProteinModelPortaliQ8TAC1.
SMRiQ8TAC1. Positions 14-154.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi130435. 1 interaction.
IntActiQ8TAC1. 1 interaction.
STRINGi9606.ENSP00000369341.

PTM databases

iPTMnetiQ8TAC1.
PhosphoSiteiQ8TAC1.

Polymorphism and mutation databases

BioMutaiRFESD.
DMDMi74730342.

Proteomic databases

EPDiQ8TAC1.
MaxQBiQ8TAC1.
PaxDbiQ8TAC1.
PeptideAtlasiQ8TAC1.
PRIDEiQ8TAC1.

Protocols and materials databases

DNASUi317671.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000311364; ENSP00000309229; ENSG00000175449. [Q8TAC1-1]
ENST00000380005; ENSP00000369341; ENSG00000175449. [Q8TAC1-2]
ENST00000458310; ENSP00000413592; ENSG00000175449. [Q8TAC1-2]
GeneIDi317671.
KEGGihsa:317671.
UCSCiuc003klf.4. human. [Q8TAC1-1]

Organism-specific databases

CTDi317671.
GeneCardsiRFESD.
HGNCiHGNC:29587. RFESD.
HPAiCAB016546.
neXtProtiNX_Q8TAC1.
PharmGKBiPA162401171.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IWA6. Eukaryota.
ENOG4111Q5H. LUCA.
GeneTreeiENSGT00390000018225.
HOGENOMiHOG000128541.
HOVERGENiHBG061590.
InParanoidiQ8TAC1.
OMAiWCSKGVK.
PhylomeDBiQ8TAC1.
TreeFamiTF333320.

Miscellaneous databases

GenomeRNAii317671.
PROiQ8TAC1.

Gene expression databases

BgeeiQ8TAC1.
CleanExiHS_RFESD.
ExpressionAtlasiQ8TAC1. baseline and differential.
GenevisibleiQ8TAC1. HS.

Family and domain databases

Gene3Di2.102.10.10. 1 hit.
InterProiIPR017941. Rieske_2Fe-2S.
[Graphical view]
PfamiPF00355. Rieske. 1 hit.
[Graphical view]
SUPFAMiSSF50022. SSF50022. 1 hit.
PROSITEiPS51296. RIESKE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain, Lung and Testis.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-153 (ISOFORM 2).
    Tissue: Fetal pancreas.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  6. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "Toward a comprehensive characterization of a human cancer cell phosphoproteome."
    Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J., Mohammed S.
    J. Proteome Res. 12:260-271(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-6, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Erythroleukemia.

Entry informationi

Entry nameiRFESD_HUMAN
AccessioniPrimary (citable) accession number: Q8TAC1
Secondary accession number(s): J3KPH1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: June 1, 2002
Last modified: July 6, 2016
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.