Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 563

Gene

ZNF563

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri101 – 12525C2H2-type 1; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri169 – 19123C2H2-type 2; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri197 – 21923C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri225 – 24723C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri253 – 27523C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri281 – 30323C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri309 – 33123C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri337 – 35923C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri365 – 38723C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri393 – 41523C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri421 – 44323C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri449 – 47123C2H2-type 12PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 563
Gene namesi
Name:ZNF563
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:30498. ZNF563.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134949077.

Polymorphism and mutation databases

BioMutaiZNF563.
DMDMi74762598.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 476476Zinc finger protein 563PRO_0000047653Add
BLAST

Proteomic databases

EPDiQ8TA94.
PaxDbiQ8TA94.
PRIDEiQ8TA94.

PTM databases

PhosphoSiteiQ8TA94.

Expressioni

Gene expression databases

BgeeiQ8TA94.
CleanExiHS_ZNF563.
ExpressionAtlasiQ8TA94. baseline and differential.
GenevisibleiQ8TA94. HS.

Organism-specific databases

HPAiHPA042136.

Interactioni

Protein-protein interaction databases

BioGridi127092. 8 interactions.
STRINGi9606.ENSP00000293725.

Structurei

3D structure databases

ProteinModelPortaliQ8TA94.
SMRiQ8TA94. Positions 3-54, 69-473.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini4 – 9693KRABPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 12 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 KRAB domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri101 – 12525C2H2-type 1; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri169 – 19123C2H2-type 2; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri197 – 21923C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri225 – 24723C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri253 – 27523C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri281 – 30323C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri309 – 33123C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri337 – 35923C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri365 – 38723C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri393 – 41523C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri421 – 44323C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri449 – 47123C2H2-type 12PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00760000119089.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ8TA94.
KOiK09228.
OMAiFVYPSVC.
OrthoDBiEOG7KSX7Q.
PhylomeDBiQ8TA94.
TreeFamiTF338854.

Family and domain databases

Gene3Di3.30.160.60. 12 hits.
InterProiIPR001909. KRAB.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 11 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 10 hits.
PS50157. ZINC_FINGER_C2H2_2. 12 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TA94-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDAVAFEDVA VNFTQEEWAL LGPSQKNLYR YVMQETIRNL DCIRMIWEEQ
60 70 80 90 100
NTEDQYKNPR RNLRCHMVER FSESKDSSQC GETFSLIRDS IVNNSICPGE
110 120 130 140 150
DPCQSAECEE VIMGHLSLNS HIRVDSGHKP HEYQEYGEKP HTHKQRGKAF
160 170 180 190 200
SYHHSFQSRG RPHTGKKRYE CKECGKTFSS RRNLRRHMVV QGGNRPYKCK
210 220 230 240 250
LCGKAFFWPS LLRMHERTHT GEKPYECKQC SKAFPFYSSY RRHERMHTGE
260 270 280 290 300
KPYECKQCSK ALPDSSSYIR HERTHTGEKP YTCKQCGKAF SVSSSLRRHE
310 320 330 340 350
TTHSAEKPYE CKQCGKTFHH LGSFQIHMKR HTGDRPHKCK ICGKGFDRPS
360 370 380 390 400
LVRYHERIHT GEKPYECKQC GKTLSHSSSF RRHMIMHTGG GPHKCKICGK
410 420 430 440 450
AFVYPSVCQR HEKSHSGEKP YECKQCGKAL SHSSSFRRHM VMHTGDGPNK
460 470
CKVCGKAFVY PSVCQRHEKT HWRETI
Length:476
Mass (Da):55,434
Last modified:June 1, 2002 - v1
Checksum:i02F71928C37166B2
GO
Isoform 2 (identifier: Q8TA94-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     199-229: CKLCGKAFFWPSLLRMHERTHTGEKPYECKQ → FPIEDMRECTLGRNRMNVSSVLKPCLIPVP
     230-476: Missing.

Note: No experimental confirmation available.
Show »
Length:228
Mass (Da):26,624
Checksum:iD9D770346841D117
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei199 – 22931CKLCG…YECKQ → FPIEDMRECTLGRNRMNVSS VLKPCLIPVP in isoform 2. 1 PublicationVSP_016381Add
BLAST
Alternative sequencei230 – 476247Missing in isoform 2. 1 PublicationVSP_016382Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK092116 mRNA. Translation: BAC03810.1.
AK313755 mRNA. Translation: BAG36494.1.
CH471106 Genomic DNA. Translation: EAW84268.1.
BC022523 mRNA. Translation: AAH22523.1.
CCDSiCCDS12270.1. [Q8TA94-1]
RefSeqiNP_660319.1. NM_145276.2. [Q8TA94-1]
XP_005259808.1. XM_005259751.2.
UniGeneiHs.663510.

Genome annotation databases

EnsembliENST00000293725; ENSP00000293725; ENSG00000188868. [Q8TA94-1]
GeneIDi147837.
KEGGihsa:147837.
UCSCiuc002mtp.4. human. [Q8TA94-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK092116 mRNA. Translation: BAC03810.1.
AK313755 mRNA. Translation: BAG36494.1.
CH471106 Genomic DNA. Translation: EAW84268.1.
BC022523 mRNA. Translation: AAH22523.1.
CCDSiCCDS12270.1. [Q8TA94-1]
RefSeqiNP_660319.1. NM_145276.2. [Q8TA94-1]
XP_005259808.1. XM_005259751.2.
UniGeneiHs.663510.

3D structure databases

ProteinModelPortaliQ8TA94.
SMRiQ8TA94. Positions 3-54, 69-473.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127092. 8 interactions.
STRINGi9606.ENSP00000293725.

PTM databases

PhosphoSiteiQ8TA94.

Polymorphism and mutation databases

BioMutaiZNF563.
DMDMi74762598.

Proteomic databases

EPDiQ8TA94.
PaxDbiQ8TA94.
PRIDEiQ8TA94.

Protocols and materials databases

DNASUi147837.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000293725; ENSP00000293725; ENSG00000188868. [Q8TA94-1]
GeneIDi147837.
KEGGihsa:147837.
UCSCiuc002mtp.4. human. [Q8TA94-1]

Organism-specific databases

CTDi147837.
GeneCardsiZNF563.
HGNCiHGNC:30498. ZNF563.
HPAiHPA042136.
neXtProtiNX_Q8TA94.
PharmGKBiPA134949077.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00760000119089.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ8TA94.
KOiK09228.
OMAiFVYPSVC.
OrthoDBiEOG7KSX7Q.
PhylomeDBiQ8TA94.
TreeFamiTF338854.

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Miscellaneous databases

ChiTaRSiZNF563. human.
GenomeRNAii147837.
NextBioi85743.
PROiQ8TA94.

Gene expression databases

BgeeiQ8TA94.
CleanExiHS_ZNF563.
ExpressionAtlasiQ8TA94. baseline and differential.
GenevisibleiQ8TA94. HS.

Family and domain databases

Gene3Di3.30.160.60. 12 hits.
InterProiIPR001909. KRAB.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 11 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 10 hits.
PS50157. ZINC_FINGER_C2H2_2. 12 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Spleen.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.

Entry informationi

Entry nameiZN563_HUMAN
AccessioniPrimary (citable) accession number: Q8TA94
Secondary accession number(s): B2R9E7, Q8NAT7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: June 1, 2002
Last modified: March 16, 2016
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.