Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 563

Gene

ZNF563

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri101 – 125C2H2-type 1; degeneratePROSITE-ProRule annotationAdd BLAST25
Zinc fingeri169 – 191C2H2-type 2; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri197 – 219C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri225 – 247C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri253 – 275C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri281 – 303C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri309 – 331C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri337 – 359C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri365 – 387C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri393 – 415C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri421 – 443C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri449 – 471C2H2-type 12PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 563
Gene namesi
Name:ZNF563
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi

Organism-specific databases

EuPathDBiHostDB:ENSG00000188868.13
HGNCiHGNC:30498 ZNF563
neXtProtiNX_Q8TA94

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000188868
PharmGKBiPA134949077

Polymorphism and mutation databases

BioMutaiZNF563
DMDMi74762598

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000476531 – 476Zinc finger protein 563Add BLAST476

Proteomic databases

MaxQBiQ8TA94
PaxDbiQ8TA94
PeptideAtlasiQ8TA94
PRIDEiQ8TA94

PTM databases

iPTMnetiQ8TA94
PhosphoSitePlusiQ8TA94

Expressioni

Gene expression databases

BgeeiENSG00000188868
CleanExiHS_ZNF563
ExpressionAtlasiQ8TA94 baseline and differential
GenevisibleiQ8TA94 HS

Organism-specific databases

HPAiHPA042136

Interactioni

Protein-protein interaction databases

BioGridi127092, 9 interactors
IntActiQ8TA94, 2 interactors
MINTiQ8TA94
STRINGi9606.ENSP00000293725

Structurei

3D structure databases

ProteinModelPortaliQ8TA94
SMRiQ8TA94
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini4 – 96KRABPROSITE-ProRule annotationAdd BLAST93

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri101 – 125C2H2-type 1; degeneratePROSITE-ProRule annotationAdd BLAST25
Zinc fingeri169 – 191C2H2-type 2; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri197 – 219C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri225 – 247C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri253 – 275C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri281 – 303C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri309 – 331C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri337 – 359C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri365 – 387C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri393 – 415C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri421 – 443C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri449 – 471C2H2-type 12PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00760000119089
HOGENOMiHOG000234617
HOVERGENiHBG018163
InParanoidiQ8TA94
KOiK09228
OMAiFVYPSVC
OrthoDBiEOG091G02KC
PhylomeDBiQ8TA94
TreeFamiTF338854

Family and domain databases

CDDicd07765 KRAB_A-box, 1 hit
InterProiView protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF01352 KRAB, 1 hit
SMARTiView protein in SMART
SM00349 KRAB, 1 hit
SM00355 ZnF_C2H2, 11 hits
SUPFAMiSSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 7 hits
PROSITEiView protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 10 hits
PS50157 ZINC_FINGER_C2H2_2, 12 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8TA94-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDAVAFEDVA VNFTQEEWAL LGPSQKNLYR YVMQETIRNL DCIRMIWEEQ
60 70 80 90 100
NTEDQYKNPR RNLRCHMVER FSESKDSSQC GETFSLIRDS IVNNSICPGE
110 120 130 140 150
DPCQSAECEE VIMGHLSLNS HIRVDSGHKP HEYQEYGEKP HTHKQRGKAF
160 170 180 190 200
SYHHSFQSRG RPHTGKKRYE CKECGKTFSS RRNLRRHMVV QGGNRPYKCK
210 220 230 240 250
LCGKAFFWPS LLRMHERTHT GEKPYECKQC SKAFPFYSSY RRHERMHTGE
260 270 280 290 300
KPYECKQCSK ALPDSSSYIR HERTHTGEKP YTCKQCGKAF SVSSSLRRHE
310 320 330 340 350
TTHSAEKPYE CKQCGKTFHH LGSFQIHMKR HTGDRPHKCK ICGKGFDRPS
360 370 380 390 400
LVRYHERIHT GEKPYECKQC GKTLSHSSSF RRHMIMHTGG GPHKCKICGK
410 420 430 440 450
AFVYPSVCQR HEKSHSGEKP YECKQCGKAL SHSSSFRRHM VMHTGDGPNK
460 470
CKVCGKAFVY PSVCQRHEKT HWRETI
Length:476
Mass (Da):55,434
Last modified:June 1, 2002 - v1
Checksum:i02F71928C37166B2
GO
Isoform 2 (identifier: Q8TA94-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     199-229: CKLCGKAFFWPSLLRMHERTHTGEKPYECKQ → FPIEDMRECTLGRNRMNVSSVLKPCLIPVP
     230-476: Missing.

Note: No experimental confirmation available.
Show »
Length:228
Mass (Da):26,624
Checksum:iD9D770346841D117
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_016381199 – 229CKLCG…YECKQ → FPIEDMRECTLGRNRMNVSS VLKPCLIPVP in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_016382230 – 476Missing in isoform 2. 1 PublicationAdd BLAST247

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK092116 mRNA Translation: BAC03810.1
AK313755 mRNA Translation: BAG36494.1
CH471106 Genomic DNA Translation: EAW84268.1
BC022523 mRNA Translation: AAH22523.1
CCDSiCCDS12270.1 [Q8TA94-1]
RefSeqiNP_660319.1, NM_145276.2 [Q8TA94-1]
XP_005259808.1, XM_005259751.3
UniGeneiHs.663510

Genome annotation databases

EnsembliENST00000293725; ENSP00000293725; ENSG00000188868 [Q8TA94-1]
GeneIDi147837
KEGGihsa:147837
UCSCiuc002mtp.4 human [Q8TA94-1]

Keywords - Coding sequence diversityi

Alternative splicing

Entry informationi

Entry nameiZN563_HUMAN
AccessioniPrimary (citable) accession number: Q8TA94
Secondary accession number(s): B2R9E7, Q8NAT7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: June 1, 2002
Last modified: May 23, 2018
This is version 131 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health