Q8TA83 (DNJ10_CAEEL) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 84.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: DnaJ homolog dnj-10 Alternative name(s): DnaJ domain protein 10 | ||||
| Gene names |
| ||||
| Organism | Caenorhabditis elegans [Reference proteome] | ||||
| Taxonomic identifier | 6239 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Nematoda › Chromadorea › Rhabditida › Rhabditoidea › Rhabditidae › Peloderinae › Caenorhabditis![]() |
Protein attributes
| Sequence length | 456 AA. |
| Sequence status | Complete. |
| Protein existence | Predicted |
General annotation (Comments)
| Sequence similarities | Contains 1 CR-type zinc finger. Contains 1 J domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform a Ref.1 (identifier: Q8TA83-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform b Ref.1 (identifier: Q8TA83-2) The sequence of this isoform differs from the canonical sequence as follows: 418-456: GASESQKRRSEPVAENAETIDENQENEGFFEKIKRKIFG → DKSEEKSESKEEPKNEESSETPEKKAAES | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 456 | 456 | DnaJ homolog dnj-10 | PRO_0000071136 | |||||
Regions | |||||||||
| Domain | 44 – 108 | 65 | J | ||||||
| Repeat | 208 – 215 | 8 | CXXCXGXG motif | ||||||
| Repeat | 231 – 238 | 8 | CXXCXGXG motif | ||||||
| Repeat | 245 – 252 | 8 | CXXCXGXG motif | ||||||
| Zinc finger | 178 – 257 | 80 | CR-type | ||||||
| Compositional bias | 108 – 147 | 40 | Gly-rich | ||||||
Natural variations | |||||||||
| Alternative sequence | 418 – 456 | 39 | GASES…RKIFG → DKSEEKSESKEEPKNEESSE TPEKKAAES in isoform b. Ref.1 | VSP_051736 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Genome sequence of the nematode C. elegans: a platform for investigating biology." The C. elegans sequencing consortium Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING. Strain: Bristol N2. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | FO080222 Genomic DNA. Translation: CCD62135.1. FO080222 Genomic DNA. Translation: CCD62136.1. |
| RefSeq | NP_498901.1. NM_066500.4. NP_498902.1. NM_066501.3. |
3D structure databases | |
| ProteinModelPortal | Q8TA83. |
| SMR | Q8TA83. Positions 41-357. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-24664N. |
| IntAct | Q8TA83. 8 interactions. |
| MINT | MINT-1038768. |
| STRING | 6239.F22B7.5a.1. |
Proteomic databases | |
| PaxDb | Q8TA83. |
| PRIDE | Q8TA83. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblMetazoa | F22B7.5a.1; F22B7.5a.1; F22B7.5. F22B7.5a.2; F22B7.5a.2; F22B7.5. |
| GeneID | 176211. |
| KEGG | cel:CELE_F22B7.5. |
| UCSC | F22B7.5a.1. c. elegans. |
Organism-specific databases | |
| CTD | 176211. |
| WormBase | F22B7.5a; CE24911; WBGene00001028; dnj-10. F22B7.5b; CE27991; WBGene00001028; dnj-10. |
Phylogenomic databases | |
| eggNOG | COG0484. |
| GeneTree | ENSGT00700000104316. |
| HOGENOM | HOG000226717. |
| InParanoid | Q8TA83. |
| KO | K09504. |
| OMA | PAGTGSH. |
Family and domain databases | |
| Gene3D | 1.10.287.110. 1 hit. 2.10.230.10. 1 hit. |
| InterPro | IPR012724. DnaJ. IPR002939. DnaJ_C. IPR001623. DnaJ_domain. IPR018253. DnaJ_domain_CS. IPR008971. HSP40/DnaJ_pept-bd. IPR001305. HSP_DnaJ_Cys-rich_dom. IPR001878. Znf_CCHC. [Graphical view] |
| Pfam | PF00226. DnaJ. 1 hit. PF01556. DnaJ_C. 1 hit. PF00684. DnaJ_CXXCXGXG. 1 hit. [Graphical view] |
| PRINTS | PR00625. JDOMAIN. |
| SMART | SM00271. DnaJ. 1 hit. SM00343. ZnF_C2HC. 2 hits. [Graphical view] |
| SUPFAM | SSF46565. DnaJ_N. 1 hit. SSF49493. HSP40_DnaJ_pep. 1 hit. SSF57938. HSP_DnaJ_cys-rich. 1 hit. |
| PROSITE | PS00636. DNAJ_1. 1 hit. PS50076. DNAJ_2. 1 hit. PS51188. ZF_CR. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 891598. |
Entry information
| Entry name | DNJ10_CAEEL | ||||||||
| Accession | Primary (citable) accession number: Q8TA83 Secondary accession number(s): P34408, Q95QJ6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Caenorhabditis annotation project | ||||||||
Relevant documents
| Caenorhabditis elegans Caenorhabditis elegans: entries, gene names and cross-references to WormBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with
