Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase WNK2

Gene

WNK2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regulates flowering time by modulating the photoperiod pathway. Possesses kinase activity in vitro.1 Publication

Caution

Was named WNK/'with no lysine(K)' because key residues for catalysis, including the lysine involved in ATP binding, are either not conserved or differ compared to the residues described in other kinase family proteins.By similarity

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei154ATPBy similarity1
Active sitei171Proton acceptorBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi104 – 107ATPBy similarity4

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • protein kinase activity Source: TAIR
  • protein serine/threonine kinase activity Source: GO_Central

GO - Biological processi

  • intracellular signal transduction Source: GO_Central
  • photoperiodism, flowering Source: TAIR
  • protein phosphorylation Source: TAIR

Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase WNK2 (EC:2.7.11.1)
Short name:
AtWNK2
Alternative name(s):
Protein kinase with no lysine 2
Gene namesi
Name:WNK2
Ordered Locus Names:At3g22420
ORF Names:MCB17.15
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 3

Organism-specific databases

AraportiAT3G22420
TAIRilocus:2087857 AT3G22420

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Disruption phenotypei

Plants display early flowering and altered expression of genes involved in the photoperiod flowering pathway, such as ELF4, TOC1, CO and FT.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003516601 – 568Serine/threonine-protein kinase WNK2Add BLAST568

Post-translational modificationi

Autophosphorylated.

Proteomic databases

PRIDEiQ8S8Y9

PTM databases

iPTMnetiQ8S8Y9

Expressioni

Inductioni

Expressed with a circadian rhythm showing a peak before dawn.1 Publication

Gene expression databases

ExpressionAtlasiQ8S8Y9 baseline and differential
GenevisibleiQ8S8Y9 AT

Interactioni

Protein-protein interaction databases

BioGridi7142, 7 interactors
IntActiQ8S8Y9, 1 interactor

Structurei

3D structure databases

ProteinModelPortaliQ8S8Y9
SMRiQ8S8Y9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini24 – 281Protein kinasePROSITE-ProRule annotationAdd BLAST258

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi426 – 434Poly-Asn9

Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. WNK subfamily.PROSITE-ProRule annotation

Phylogenomic databases

HOGENOMiHOG000239343
InParanoidiQ8S8Y9
KOiK08867
OMAiYFPFETE
PhylomeDBiQ8S8Y9

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8S8Y9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNGEESFVED CSVFVEIDPS GRYGRYDEIL GKGASKTVYR AFDEYEGIEV
60 70 80 90 100
AWNQVKLRNF TRNPEELEKF FREIHLLKTL NHQNIMKFYT SWVDTNNLSI
110 120 130 140 150
NFVTELFTSG TLRQYRLRHR RVNIRAVKQW CKQILKGLLY LHSRSPPIIH
160 170 180 190 200
RDLKCDNIFI NGNQGEVKIG DLGLAAILRK SHAVRCVGTP EFMAPEVYDE
210 220 230 240 250
EYNELVDVYA FGMCVLEMVT FDYPYSECTH PAQIYKKVTS GKKPEAFYLV
260 270 280 290 300
KDPEVREFVE KCLANVTCRL TALELLQDPF LQDDNMDGFV MRPIDYYNGY
310 320 330 340 350
DETGVFLRHP LIDDPLYHDQ FESSQICEID LFANDDEDHV DISIKGKRNG
360 370 380 390 400
DDGIFLRLRI SDAEGRIRNI YFPFETAIDT AWSVAVEMVS ELDITNQDVA
410 420 430 440 450
KIAEMIDAEI AALVPDWKND TESSQNVNNN KNNNTAGFCG ECASNGYIQE
460 470 480 490 500
TVSSGEKSHH NHHEFDSSED KSCSSVHGRF ADMWGLRESY SDDGEKQSSR
510 520 530 540 550
KVRSGRWSEN EMRRELRWLK ARHKIQLMKM RGQTICETPI EISLTPGTSV
560
SLPLLYRAIS LPVDAVDM
Length:568
Mass (Da):65,327
Last modified:June 1, 2002 - v1
Checksum:iE17CA971FAF9F5A3
GO
Isoform 2 (identifier: Q8S8Y9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     189-189: T → TSKPSHHWNFIALIMFFTTLDLPLLCLCVVKGT
     365-365: G → GIVSIFFDSFKIIGLKNVTRFRVLGNVG

Show »
Length:627
Mass (Da):71,978
Checksum:iA0C58C91E81CB749
GO

Sequence cautioni

The sequence BAB01779 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_035528189T → TSKPSHHWNFIALIMFFTTL DLPLLCLCVVKGT in isoform 2. 4 Publications1
Alternative sequenceiVSP_035529365G → GIVSIFFDSFKIIGLKNVTR FRVLGNVG in isoform 2. 4 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB084267 mRNA Translation: BAB91126.1
AB022215 Genomic DNA Translation: BAB01779.1 Sequence problems.
CP002686 Genomic DNA Translation: AEE76633.1
CP002686 Genomic DNA Translation: AEE76634.1
BT030355 mRNA Translation: ABO38768.1
AK227215 mRNA Translation: BAE99253.1
AY086628 mRNA Translation: AAM63686.1
RefSeqiNP_188881.1, NM_113139.3 [Q8S8Y9-1]
NP_974354.1, NM_202625.2 [Q8S8Y9-2]
UniGeneiAt.37884

Genome annotation databases

EnsemblPlantsiAT3G22420.1; AT3G22420.1; AT3G22420 [Q8S8Y9-1]
AT3G22420.2; AT3G22420.2; AT3G22420 [Q8S8Y9-2]
AT3G22420.4; AT3G22420.4; AT3G22420
GeneIDi821810
GrameneiAT3G22420.1; AT3G22420.1; AT3G22420 [Q8S8Y9-1]
AT3G22420.2; AT3G22420.2; AT3G22420 [Q8S8Y9-2]
AT3G22420.4; AT3G22420.4; AT3G22420
KEGGiath:AT3G22420

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiWNK2_ARATH
AccessioniPrimary (citable) accession number: Q8S8Y9
Secondary accession number(s): Q9LUV8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 14, 2008
Last sequence update: June 1, 2002
Last modified: April 25, 2018
This is version 112 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health