Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8R5M4

- OPTN_RAT

UniProt

Q8R5M4 - OPTN_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Optineurin

Gene

Optn

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Plays an important role in the maintenance of the Golgi complex, in membrane trafficking, in exocytosis, through its interaction with myosin VI and Rab8. Links myosin VI to the Golgi complex and plays an important role in Golgi ribbon formation. Negatively regulates the induction of IFNB in response to RNA virus infection. Plays a neuroprotective role in the eye and optic nerve. Probably part of the TNF-alpha signaling pathway that can shift the equilibrium toward induction of cell death. May act by regulating membrane trafficking and cellular morphogenesis via a complex that contains Rab8 and hungtingtin (HD). Mediates the interaction of Rab8 with the probable GTPase-activating protein TBC1D17 during Rab8-mediated endocytic trafficking, such as of transferrin receptor (TFRC/TfR); regulates Rab8 recruitnment to tubules emanating from the endocytic recycling compartment. Autophagy receptor that interacts directly with both the cargo to become degraded and an autophagy modifier of the MAP1 LC3 family; targets ubiquitin-coated bacteria (xenophagy) and appears to function in the same pathway as SQSTM1 and CALCOCO2/NDP52 (By similarity).By similarity

GO - Molecular functioni

  1. identical protein binding Source: RGD
  2. TFIIIA-class transcription factor binding Source: RGD
  3. ubiquitin binding Source: RGD

GO - Biological processi

  1. autophagy Source: UniProtKB-KW
  2. cytokine secretion Source: RGD
  3. Golgi organization Source: UniProtKB
  4. Golgi ribbon formation Source: UniProtKB
  5. negative regulation of neuron apoptotic process Source: RGD
  6. positive regulation of cell proliferation Source: RGD
  7. protein homooligomerization Source: RGD
  8. wound healing Source: RGD
Complete GO annotation...

Keywords - Biological processi

Autophagy

Names & Taxonomyi

Protein namesi
Recommended name:
Optineurin
Alternative name(s):
FIP-2-like protein
Gene namesi
Name:Optn
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi628886. Optn.

Subcellular locationi

Cytoplasmperinuclear region By similarity. Golgi apparatus By similarity. Golgi apparatustrans-Golgi network By similarity. Cytoplasmic vesicleautophagosome By similarity. Cytoplasmic vesicle By similarity. Recycling endosome By similarity
Note: Found in the perinuclear region and associates with the Golgi apparatus. Colocalizes with MYO6 and RAB8 at the Golgi complex and in vesicular structures close to the plasma membrane. Localizes to LC3-positive cytoplasmic vesicles upon induction of autophagy (By similarity).By similarity

GO - Cellular componenti

  1. cytoplasm Source: RGD
  2. cytoplasmic membrane-bounded vesicle Source: UniProtKB
  3. cytoplasmic vesicle Source: RGD
  4. endosome Source: UniProtKB-KW
  5. Golgi apparatus Source: UniProtKB
  6. trans-Golgi network Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Endosome, Golgi apparatus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 585585OptineurinPRO_0000058072Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei188 – 1881Phosphoserine; by TBK1By similarity

Post-translational modificationi

Phosphorylated by TBK1, leading to restrict bacterial proliferation in case of infection.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8R5M4.
PRIDEiQ8R5M4.

PTM databases

PhosphoSiteiQ8R5M4.

Expressioni

Gene expression databases

GenevestigatoriQ8R5M4.

Interactioni

Subunit structurei

Interacts with HD, Rab8 (RAB8A and/or RAB8B) (active GTP-bound form), GTF3A, TRAF3, TBK1, MYO6 and TFRC. Binds to linear ubiquitin chains. Interacts with LC3 family members MAP1LC3A, MAP1LC3B, GABARAP, GABARAPL1 and GABARAPL2; OPTN phosphorylation increases the asscociation (at least with MAP1LC3B). Self-associates. Interacts with RAB12; the interaction may be indirect (By similarity).By similarity

Protein-protein interaction databases

BioGridi251574. 1 interaction.
MINTiMINT-4570430.
STRINGi10116.ENSRNOP00000045795.

Structurei

3D structure databases

ProteinModelPortaliQ8R5M4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni58 – 220163Interaction with Rab8By similarityAdd
BLAST
Regioni415 – 585171Interaction with HDBy similarityAdd
BLAST
Regioni416 – 525110Interaction with MYO6By similarityAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili38 – 181144Sequence AnalysisAdd
BLAST
Coiled coili244 – 512269Sequence AnalysisAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi187 – 1926LIR
Motifi478 – 4836UBAN

Domaini

The LIR (LC3-interacting region) motif mediates the interaction with ATG8 family proteins.By similarity
Ubiquitin-binding motif (UBAN) is essential for its inhibitory function, subcellular localization and interaction with TBK1.By similarity

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG138369.
HOGENOMiHOG000231899.
HOVERGENiHBG106481.
InParanoidiQ8R5M4.
PhylomeDBiQ8R5M4.

Family and domain databases

InterProiIPR021063. NEMO_N.
[Graphical view]
PfamiPF11577. NEMO. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8R5M4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSHQPLSCLT EKGDSSCETP GNGPSNMVHP NLDTFTPEEL LQQMKELLVE
60 70 80 90 100
NHQLKEAMKL NNQAMKGRFE ELSAWTEKQK EERQLFEIQS KEAKERLKAL
110 120 130 140 150
SHENERLKEE LGKLKEKSER PFEDITGRCG FPRTDLEQEV EQLKRQVEQE
160 170 180 190 200
VEHLKIQVRR LQAEKADLLG IVSELQLKLN SGGSSEDSFV EIRMTEGEAE
210 220 230 240 250
GAMKEMRNSA GPTRTDSISM GKCTEDARTC VEFEELTVSQ LLLCLREGNQ
260 270 280 290 300
KVERLEIALR EAKERISDFE KKANGHSAIE TQTEGSTQKE EEDKDPESVG
310 320 330 340 350
IEVETLNVQV ASLFKELQEA HTKLSEAELM KKRLQEKCQA LERKNSATPS
360 370 380 390 400
ELNEKQELVY SNRKLELQVE SMRSEIKMEQ AKTEEEKSRL ATLQATHDKL
410 420 430 440 450
LQEHNKALRT IEELTKQQAE KVDKVQLQEL SEKLELAEQA LASKQLQMDE
460 470 480 490 500
MKQTIAKQEE DLETMAVLRA QMEVYCSDFH AERAAREKIH EEKEQLALQL
510 520 530 540 550
AILLKENNDF EDGGSRQSLM EMQCRHGART SDSDQQAYLF QRGAEDMSWQ
560 570 580
HGQQPRSIPI HSCPKCGEVL PDIDTLQIHV MDCII
Length:585
Mass (Da):67,014
Last modified:March 29, 2005 - v3
Checksum:i05D3390151DADEC7
GO
Isoform 2 (identifier: Q8R5M4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     156-195: IQVRRLQAEKADLLGIVSELQLKLNSGGSSEDSFVEIRMT → NQ
     515-515: Missing.

Note: No experimental confirmation available.

Show »
Length:546
Mass (Da):62,755
Checksum:iE55E5CC6B017EDEB
GO

Sequence cautioni

The sequence BAB84696.2 differs from that shown. Reason: Frameshift at positions 140, 163, 168, 169 and 192.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti78 – 781K → R in BAB84696. 1 PublicationCurated
Sequence conflicti172 – 1743VSE → RLR1 PublicationCurated
Sequence conflicti219 – 2191S → I in BAB84696. 1 PublicationCurated
Sequence conflicti316 – 3161E → G in BAB84696. 1 PublicationCurated
Sequence conflicti363 – 3631R → W in BAB84696. 1 PublicationCurated
Sequence conflicti545 – 5451E → K in BAB84696. 1 PublicationCurated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei156 – 19540IQVRR…EIRMT → NQ in isoform 2. 1 PublicationVSP_013263Add
BLAST
Alternative sequencei515 – 5151Missing in isoform 2. 1 PublicationVSP_013264

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB069907 mRNA. Translation: BAB84696.2. Frameshift.
BC086976 mRNA. Translation: AAH86976.1.
RefSeqiNP_659549.2. NM_145081.3.
UniGeneiRn.63435.

Genome annotation databases

GeneIDi246294.
KEGGirno:246294.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB069907 mRNA. Translation: BAB84696.2 . Frameshift.
BC086976 mRNA. Translation: AAH86976.1 .
RefSeqi NP_659549.2. NM_145081.3.
UniGenei Rn.63435.

3D structure databases

ProteinModelPortali Q8R5M4.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 251574. 1 interaction.
MINTi MINT-4570430.
STRINGi 10116.ENSRNOP00000045795.

PTM databases

PhosphoSitei Q8R5M4.

Proteomic databases

PaxDbi Q8R5M4.
PRIDEi Q8R5M4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 246294.
KEGGi rno:246294.

Organism-specific databases

CTDi 10133.
RGDi 628886. Optn.

Phylogenomic databases

eggNOGi NOG138369.
HOGENOMi HOG000231899.
HOVERGENi HBG106481.
InParanoidi Q8R5M4.
PhylomeDBi Q8R5M4.

Miscellaneous databases

NextBioi 623677.

Gene expression databases

Genevestigatori Q8R5M4.

Family and domain databases

InterProi IPR021063. NEMO_N.
[Graphical view ]
Pfami PF11577. NEMO. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of genes expressed in rat injured dental pulp."
    Myokai F., Oyama M.
    Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.

Entry informationi

Entry nameiOPTN_RAT
AccessioniPrimary (citable) accession number: Q8R5M4
Secondary accession number(s): Q5PQX8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2005
Last sequence update: March 29, 2005
Last modified: October 29, 2014
This is version 73 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

External Data

Dasty 3