Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8R5M4

- OPTN_RAT

UniProt

Q8R5M4 - OPTN_RAT

Protein

Optineurin

Gene

Optn

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 72 (01 Oct 2014)
      Sequence version 3 (29 Mar 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Plays an important role in the maintenance of the Golgi complex, in membrane trafficking, in exocytosis, through its interaction with myosin VI and Rab8. Links myosin VI to the Golgi complex and plays an important role in Golgi ribbon formation. Negatively regulates the induction of IFNB in response to RNA virus infection. Plays a neuroprotective role in the eye and optic nerve. Probably part of the TNF-alpha signaling pathway that can shift the equilibrium toward induction of cell death. May act by regulating membrane trafficking and cellular morphogenesis via a complex that contains Rab8 and hungtingtin (HD). Mediates the interaction of Rab8 with the probable GTPase-activating protein TBC1D17 during Rab8-mediated endocytic trafficking, such as of transferrin receptor (TFRC/TfR); regulates Rab8 recruitnment to tubules emanating from the endocytic recycling compartment. Autophagy receptor that interacts directly with both the cargo to become degraded and an autophagy modifier of the MAP1 LC3 family; targets ubiquitin-coated bacteria (xenophagy) and appears to function in the same pathway as SQSTM1 and CALCOCO2/NDP52 By similarity.By similarity

    GO - Molecular functioni

    1. identical protein binding Source: RGD
    2. TFIIIA-class transcription factor binding Source: RGD
    3. ubiquitin binding Source: RGD

    GO - Biological processi

    1. cytokine secretion Source: RGD
    2. Golgi organization Source: UniProtKB
    3. Golgi ribbon formation Source: UniProtKB
    4. negative regulation of neuron apoptotic process Source: RGD
    5. positive regulation of cell proliferation Source: RGD
    6. protein homooligomerization Source: RGD
    7. wound healing Source: RGD

    Keywords - Biological processi

    Autophagy

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Optineurin
    Alternative name(s):
    FIP-2-like protein
    Gene namesi
    Name:Optn
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Unplaced

    Organism-specific databases

    RGDi628886. Optn.

    Subcellular locationi

    Cytoplasmperinuclear region By similarity. Golgi apparatus By similarity. Golgi apparatustrans-Golgi network By similarity. Cytoplasmic vesicleautophagosome By similarity. Cytoplasmic vesicle By similarity. Recycling endosome By similarity
    Note: Found in the perinuclear region and associates with the Golgi apparatus. Colocalizes with MYO6 and RAB8 at the Golgi complex and in vesicular structures close to the plasma membrane. Localizes to LC3-positive cytoplasmic vesicles upon induction of autophagy By similarity.By similarity

    GO - Cellular componenti

    1. cytoplasm Source: RGD
    2. cytoplasmic membrane-bounded vesicle Source: UniProtKB
    3. cytoplasmic vesicle Source: RGD
    4. Golgi apparatus Source: UniProtKB
    5. perinuclear region of cytoplasm Source: UniProtKB-SubCell
    6. trans-Golgi network Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Cytoplasmic vesicle, Endosome, Golgi apparatus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 585585OptineurinPRO_0000058072Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei188 – 1881Phosphoserine; by TBK1By similarity

    Post-translational modificationi

    Phosphorylated by TBK1, leading to restrict bacterial proliferation in case of infection.By similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiQ8R5M4.
    PRIDEiQ8R5M4.

    PTM databases

    PhosphoSiteiQ8R5M4.

    Expressioni

    Gene expression databases

    GenevestigatoriQ8R5M4.

    Interactioni

    Subunit structurei

    Interacts with HD, Rab8 (RAB8A and/or RAB8B) (active GTP-bound form), GTF3A, TRAF3, TBK1, MYO6 and TFRC. Binds to linear ubiquitin chains. Interacts with LC3 family members MAP1LC3A, MAP1LC3B, GABARAP, GABARAPL1 and GABARAPL2; OPTN phosphorylation increases the asscociation (at least with MAP1LC3B). Self-associates. Interacts with RAB12; the interaction may be indirect By similarity.By similarity

    Protein-protein interaction databases

    BioGridi251574. 1 interaction.
    MINTiMINT-4570430.
    STRINGi10116.ENSRNOP00000045795.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8R5M4.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni58 – 220163Interaction with Rab8By similarityAdd
    BLAST
    Regioni415 – 585171Interaction with HDBy similarityAdd
    BLAST
    Regioni416 – 525110Interaction with MYO6By similarityAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili38 – 181144Sequence AnalysisAdd
    BLAST
    Coiled coili244 – 512269Sequence AnalysisAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi187 – 1926LIR
    Motifi478 – 4836UBAN

    Domaini

    The LIR (LC3-interacting region) motif mediates the interaction with ATG8 family proteins.By similarity
    Ubiquitin-binding motif (UBAN) is essential for its inhibitory function, subcellular localization and interaction with TBK1.By similarity

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG138369.
    HOGENOMiHOG000231899.
    HOVERGENiHBG106481.
    PhylomeDBiQ8R5M4.

    Family and domain databases

    InterProiIPR021063. NEMO_N.
    [Graphical view]
    PfamiPF11577. NEMO. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8R5M4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSHQPLSCLT EKGDSSCETP GNGPSNMVHP NLDTFTPEEL LQQMKELLVE    50
    NHQLKEAMKL NNQAMKGRFE ELSAWTEKQK EERQLFEIQS KEAKERLKAL 100
    SHENERLKEE LGKLKEKSER PFEDITGRCG FPRTDLEQEV EQLKRQVEQE 150
    VEHLKIQVRR LQAEKADLLG IVSELQLKLN SGGSSEDSFV EIRMTEGEAE 200
    GAMKEMRNSA GPTRTDSISM GKCTEDARTC VEFEELTVSQ LLLCLREGNQ 250
    KVERLEIALR EAKERISDFE KKANGHSAIE TQTEGSTQKE EEDKDPESVG 300
    IEVETLNVQV ASLFKELQEA HTKLSEAELM KKRLQEKCQA LERKNSATPS 350
    ELNEKQELVY SNRKLELQVE SMRSEIKMEQ AKTEEEKSRL ATLQATHDKL 400
    LQEHNKALRT IEELTKQQAE KVDKVQLQEL SEKLELAEQA LASKQLQMDE 450
    MKQTIAKQEE DLETMAVLRA QMEVYCSDFH AERAAREKIH EEKEQLALQL 500
    AILLKENNDF EDGGSRQSLM EMQCRHGART SDSDQQAYLF QRGAEDMSWQ 550
    HGQQPRSIPI HSCPKCGEVL PDIDTLQIHV MDCII 585
    Length:585
    Mass (Da):67,014
    Last modified:March 29, 2005 - v3
    Checksum:i05D3390151DADEC7
    GO
    Isoform 2 (identifier: Q8R5M4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         156-195: IQVRRLQAEKADLLGIVSELQLKLNSGGSSEDSFVEIRMT → NQ
         515-515: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:546
    Mass (Da):62,755
    Checksum:iE55E5CC6B017EDEB
    GO

    Sequence cautioni

    The sequence BAB84696.2 differs from that shown. Reason: Frameshift at positions 140, 163, 168, 169 and 192.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti78 – 781K → R in BAB84696. 1 PublicationCurated
    Sequence conflicti172 – 1743VSE → RLR1 PublicationCurated
    Sequence conflicti219 – 2191S → I in BAB84696. 1 PublicationCurated
    Sequence conflicti316 – 3161E → G in BAB84696. 1 PublicationCurated
    Sequence conflicti363 – 3631R → W in BAB84696. 1 PublicationCurated
    Sequence conflicti545 – 5451E → K in BAB84696. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei156 – 19540IQVRR…EIRMT → NQ in isoform 2. 1 PublicationVSP_013263Add
    BLAST
    Alternative sequencei515 – 5151Missing in isoform 2. 1 PublicationVSP_013264

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB069907 mRNA. Translation: BAB84696.2. Frameshift.
    BC086976 mRNA. Translation: AAH86976.1.
    RefSeqiNP_659549.2. NM_145081.3.
    UniGeneiRn.63435.

    Genome annotation databases

    GeneIDi246294.
    KEGGirno:246294.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB069907 mRNA. Translation: BAB84696.2 . Frameshift.
    BC086976 mRNA. Translation: AAH86976.1 .
    RefSeqi NP_659549.2. NM_145081.3.
    UniGenei Rn.63435.

    3D structure databases

    ProteinModelPortali Q8R5M4.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 251574. 1 interaction.
    MINTi MINT-4570430.
    STRINGi 10116.ENSRNOP00000045795.

    PTM databases

    PhosphoSitei Q8R5M4.

    Proteomic databases

    PaxDbi Q8R5M4.
    PRIDEi Q8R5M4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 246294.
    KEGGi rno:246294.

    Organism-specific databases

    CTDi 10133.
    RGDi 628886. Optn.

    Phylogenomic databases

    eggNOGi NOG138369.
    HOGENOMi HOG000231899.
    HOVERGENi HBG106481.
    PhylomeDBi Q8R5M4.

    Miscellaneous databases

    NextBioi 623677.

    Gene expression databases

    Genevestigatori Q8R5M4.

    Family and domain databases

    InterProi IPR021063. NEMO_N.
    [Graphical view ]
    Pfami PF11577. NEMO. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of genes expressed in rat injured dental pulp."
      Myokai F., Oyama M.
      Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Testis.

    Entry informationi

    Entry nameiOPTN_RAT
    AccessioniPrimary (citable) accession number: Q8R5M4
    Secondary accession number(s): Q5PQX8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 29, 2005
    Last sequence update: March 29, 2005
    Last modified: October 1, 2014
    This is version 72 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    External Data

    Dasty 3