Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Optineurin

Gene

Optn

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays an important role in the maintenance of the Golgi complex, in membrane trafficking, in exocytosis, through its interaction with myosin VI and Rab8. Links myosin VI to the Golgi complex and plays an important role in Golgi ribbon formation. Negatively regulates the induction of IFNB in response to RNA virus infection. Plays a neuroprotective role in the eye and optic nerve. Probably part of the TNF-alpha signaling pathway that can shift the equilibrium toward induction of cell death. May act by regulating membrane trafficking and cellular morphogenesis via a complex that contains Rab8 and hungtingtin (HD). Mediates the interaction of Rab8 with the probable GTPase-activating protein TBC1D17 during Rab8-mediated endocytic trafficking, such as of transferrin receptor (TFRC/TfR); regulates Rab8 recruitnment to tubules emanating from the endocytic recycling compartment. Autophagy receptor that interacts directly with both the cargo to become degraded and an autophagy modifier of the MAP1 LC3 family; targets ubiquitin-coated bacteria (xenophagy) and appears to function in the same pathway as SQSTM1 and CALCOCO2/NDP52 (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri555 – 585CCHC NOA-typePROSITE-ProRule annotationAdd BLAST31

GO - Molecular functioni

  • identical protein binding Source: RGD
  • K63-linked polyubiquitin binding Source: GO_Central
  • metal ion binding Source: UniProtKB-KW
  • TFIIIA-class transcription factor binding Source: RGD
  • ubiquitin binding Source: RGD

GO - Biological processi

  • autophagy Source: UniProtKB-KW
  • cytokine secretion Source: RGD
  • Golgi organization Source: UniProtKB
  • Golgi ribbon formation Source: UniProtKB
  • negative regulation of neuron apoptotic process Source: RGD
  • positive regulation of cell proliferation Source: RGD
  • protein homooligomerization Source: RGD
  • protein targeting to Golgi Source: GO_Central
  • regulation of I-kappaB kinase/NF-kappaB signaling Source: GO_Central
  • wound healing Source: RGD
Complete GO annotation...

Keywords - Biological processi

Autophagy

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Optineurin
Alternative name(s):
FIP-2-like protein
Gene namesi
Name:Optn
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi628886. Optn.

Subcellular locationi

GO - Cellular componenti

  • autophagosome Source: UniProtKB-SubCell
  • cytoplasm Source: RGD
  • cytoplasmic, membrane-bounded vesicle Source: UniProtKB
  • cytoplasmic vesicle Source: RGD
  • Golgi apparatus Source: UniProtKB
  • nucleus Source: GO_Central
  • perinuclear region of cytoplasm Source: UniProtKB-SubCell
  • recycling endosome Source: UniProtKB-SubCell
  • trans-Golgi network Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Endosome, Golgi apparatus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000580721 – 585OptineurinAdd BLAST585

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei188PhosphoserineCombined sources1
Modified residuei209PhosphoserineBy similarity1
Modified residuei346PhosphoserineCombined sources1
Modified residuei531PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated by TBK1, leading to restrict bacterial proliferation in case of infection.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8R5M4.
PRIDEiQ8R5M4.

PTM databases

iPTMnetiQ8R5M4.
PhosphoSitePlusiQ8R5M4.

Interactioni

Subunit structurei

Interacts with HD, Rab8 (RAB8A and/or RAB8B) (active GTP-bound form), GTF3A, TRAF3, TBK1, MYO6 and TFRC. Binds to linear ubiquitin chains. Interacts with LC3 family members MAP1LC3A, MAP1LC3B, GABARAP, GABARAPL1 and GABARAPL2; OPTN phosphorylation increases the association (at least with MAP1LC3B). Self-associates. Interacts with RAB12; the interaction may be indirect (By similarity).By similarity

GO - Molecular functioni

  • identical protein binding Source: RGD
  • K63-linked polyubiquitin binding Source: GO_Central
  • TFIIIA-class transcription factor binding Source: RGD
  • ubiquitin binding Source: RGD

Protein-protein interaction databases

BioGridi251574. 1 interactor.
MINTiMINT-4570430.
STRINGi10116.ENSRNOP00000045795.

Structurei

3D structure databases

ProteinModelPortaliQ8R5M4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni58 – 220Interaction with Rab8By similarityAdd BLAST163
Regioni415 – 585Interaction with HDBy similarityAdd BLAST171
Regioni416 – 525Interaction with MYO6By similarityAdd BLAST110

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili38 – 181Sequence analysisAdd BLAST144
Coiled coili244 – 512Sequence analysisAdd BLAST269

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi187 – 192LIR6
Motifi478 – 483UBAN6

Domaini

The LIR (LC3-interacting region) motif mediates the interaction with ATG8 family proteins.By similarity
Ubiquitin-binding motif (UBAN) is essential for its inhibitory function, subcellular localization and interaction with TBK1.By similarity

Sequence similaritiesi

Contains 1 CCHC NOA-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri555 – 585CCHC NOA-typePROSITE-ProRule annotationAdd BLAST31

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiENOG410IE97. Eukaryota.
ENOG410Z0DF. LUCA.
HOGENOMiHOG000231899.
HOVERGENiHBG106481.
InParanoidiQ8R5M4.
KOiK19946.
PhylomeDBiQ8R5M4.

Family and domain databases

InterProiIPR032419. CC2-LZ_dom.
IPR021063. NEMO_N.
IPR032939. Optineurin.
[Graphical view]
PANTHERiPTHR31553:SF2. PTHR31553:SF2. 1 hit.
PfamiPF16516. CC2-LZ. 1 hit.
PF11577. NEMO. 1 hit.
[Graphical view]
PROSITEiPS51801. ZF_CCHC_NOA. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8R5M4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSHQPLSCLT EKGDSSCETP GNGPSNMVHP NLDTFTPEEL LQQMKELLVE
60 70 80 90 100
NHQLKEAMKL NNQAMKGRFE ELSAWTEKQK EERQLFEIQS KEAKERLKAL
110 120 130 140 150
SHENERLKEE LGKLKEKSER PFEDITGRCG FPRTDLEQEV EQLKRQVEQE
160 170 180 190 200
VEHLKIQVRR LQAEKADLLG IVSELQLKLN SGGSSEDSFV EIRMTEGEAE
210 220 230 240 250
GAMKEMRNSA GPTRTDSISM GKCTEDARTC VEFEELTVSQ LLLCLREGNQ
260 270 280 290 300
KVERLEIALR EAKERISDFE KKANGHSAIE TQTEGSTQKE EEDKDPESVG
310 320 330 340 350
IEVETLNVQV ASLFKELQEA HTKLSEAELM KKRLQEKCQA LERKNSATPS
360 370 380 390 400
ELNEKQELVY SNRKLELQVE SMRSEIKMEQ AKTEEEKSRL ATLQATHDKL
410 420 430 440 450
LQEHNKALRT IEELTKQQAE KVDKVQLQEL SEKLELAEQA LASKQLQMDE
460 470 480 490 500
MKQTIAKQEE DLETMAVLRA QMEVYCSDFH AERAAREKIH EEKEQLALQL
510 520 530 540 550
AILLKENNDF EDGGSRQSLM EMQCRHGART SDSDQQAYLF QRGAEDMSWQ
560 570 580
HGQQPRSIPI HSCPKCGEVL PDIDTLQIHV MDCII
Length:585
Mass (Da):67,014
Last modified:March 29, 2005 - v3
Checksum:i05D3390151DADEC7
GO
Isoform 2 (identifier: Q8R5M4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     156-195: IQVRRLQAEKADLLGIVSELQLKLNSGGSSEDSFVEIRMT → NQ
     515-515: Missing.

Note: No experimental confirmation available.
Show »
Length:546
Mass (Da):62,755
Checksum:iE55E5CC6B017EDEB
GO

Sequence cautioni

The sequence BAB84696 differs from that shown. Reason: Frameshift at positions 140, 163, 168, 169 and 192.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti78K → R in BAB84696 (Ref. 1) Curated1
Sequence conflicti172 – 174VSE → RLR (Ref. 1) Curated3
Sequence conflicti219S → I in BAB84696 (Ref. 1) Curated1
Sequence conflicti316E → G in BAB84696 (Ref. 1) Curated1
Sequence conflicti363R → W in BAB84696 (Ref. 1) Curated1
Sequence conflicti545E → K in BAB84696 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_013263156 – 195IQVRR…EIRMT → NQ in isoform 2. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_013264515Missing in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB069907 mRNA. Translation: BAB84696.2. Frameshift.
BC086976 mRNA. Translation: AAH86976.1.
RefSeqiNP_659549.2. NM_145081.3.
UniGeneiRn.63435.

Genome annotation databases

GeneIDi246294.
KEGGirno:246294.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB069907 mRNA. Translation: BAB84696.2. Frameshift.
BC086976 mRNA. Translation: AAH86976.1.
RefSeqiNP_659549.2. NM_145081.3.
UniGeneiRn.63435.

3D structure databases

ProteinModelPortaliQ8R5M4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi251574. 1 interactor.
MINTiMINT-4570430.
STRINGi10116.ENSRNOP00000045795.

PTM databases

iPTMnetiQ8R5M4.
PhosphoSitePlusiQ8R5M4.

Proteomic databases

PaxDbiQ8R5M4.
PRIDEiQ8R5M4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi246294.
KEGGirno:246294.

Organism-specific databases

CTDi10133.
RGDi628886. Optn.

Phylogenomic databases

eggNOGiENOG410IE97. Eukaryota.
ENOG410Z0DF. LUCA.
HOGENOMiHOG000231899.
HOVERGENiHBG106481.
InParanoidiQ8R5M4.
KOiK19946.
PhylomeDBiQ8R5M4.

Miscellaneous databases

PROiQ8R5M4.

Family and domain databases

InterProiIPR032419. CC2-LZ_dom.
IPR021063. NEMO_N.
IPR032939. Optineurin.
[Graphical view]
PANTHERiPTHR31553:SF2. PTHR31553:SF2. 1 hit.
PfamiPF16516. CC2-LZ. 1 hit.
PF11577. NEMO. 1 hit.
[Graphical view]
PROSITEiPS51801. ZF_CCHC_NOA. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiOPTN_RAT
AccessioniPrimary (citable) accession number: Q8R5M4
Secondary accession number(s): Q5PQX8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2005
Last sequence update: March 29, 2005
Last modified: November 30, 2016
This is version 90 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.