SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8R5M4

- OPTN_RAT

UniProt

Q8R5M4 - OPTN_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Optineurin
Gene
Optn
Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Plays an important role in the maintenance of the Golgi complex, in membrane trafficking, in exocytosis, through its interaction with myosin VI and Rab8. Links myosin VI to the Golgi complex and plays an important role in Golgi ribbon formation. Plays a neuroprotective role in the eye and optic nerve. Probably part of the TNF-alpha signaling pathway that can shift the equilibrium toward induction of cell death. May act by regulating membrane trafficking and cellular morphogenesis via a complex that contains Rab8 and hungtingtin (HD) By similarity.

GO - Molecular functioni

  1. TFIIIA-class transcription factor binding Source: RGD
  2. identical protein binding Source: RGD
  3. ubiquitin binding Source: RGD

GO - Biological processi

  1. Golgi organization Source: UniProtKB
  2. Golgi ribbon formation Source: UniProtKB
  3. cytokine secretion Source: RGD
  4. negative regulation of neuron apoptotic process Source: RGD
  5. positive regulation of cell proliferation Source: RGD
  6. protein homooligomerization Source: RGD
  7. wound healing Source: RGD
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Optineurin
Alternative name(s):
FIP-2-like protein
Gene namesi
Name:Optn
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi628886. Optn.

Subcellular locationi

Cytoplasmperinuclear region By similarity. Golgi apparatus By similarity. Golgi apparatustrans-Golgi network By similarity
Note: Found in the perinuclear region and associates with the Golgi apparatus. Colocalizes with MYO6 and RAB8 at the Golgi complex and in vesicular structures close to the plasma membrane By similarity.

GO - Cellular componenti

  1. Golgi apparatus Source: UniProtKB
  2. cytoplasm Source: RGD
  3. cytoplasmic membrane-bounded vesicle Source: UniProtKB
  4. cytoplasmic vesicle Source: RGD
  5. perinuclear region of cytoplasm Source: UniProtKB-SubCell
  6. trans-Golgi network Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Golgi apparatus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 585585Optineurin
PRO_0000058072Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei188 – 1881Phosphoserine; by TBK1 By similarity

Post-translational modificationi

Phosphorylated by TBK1, leading to restrict bacterial proliferation in case of infection By similarity.

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8R5M4.
PRIDEiQ8R5M4.

PTM databases

PhosphoSiteiQ8R5M4.

Expressioni

Gene expression databases

GenevestigatoriQ8R5M4.

Interactioni

Subunit structurei

Interacts with HD. Interacts with Rab8 (RAB8A and/or RAB8B). Interacts with transcription factor IIIA (GTF3A). Interacts with TRAF3, TBK1 and MYO6. Binds to ubiquitin By similarity.

Protein-protein interaction databases

BioGridi251574. 1 interaction.
MINTiMINT-4570430.
STRINGi10116.ENSRNOP00000045795.

Structurei

3D structure databases

ProteinModelPortaliQ8R5M4.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni416 – 525110Interaction with MYO6 By similarity
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili38 – 181144 Reviewed prediction
Add
BLAST
Coiled coili244 – 512269 Reviewed prediction
Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi478 – 4836UBAN

Domaini

Ubiquitin-binding motif (UBAN) is essential for its inhibitory function, subcellular localization and interaction with TBK1 By similarity.

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG138369.
HOGENOMiHOG000231899.
HOVERGENiHBG106481.
PhylomeDBiQ8R5M4.

Family and domain databases

InterProiIPR021063. NEMO_N.
[Graphical view]
PfamiPF11577. NEMO. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8R5M4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSHQPLSCLT EKGDSSCETP GNGPSNMVHP NLDTFTPEEL LQQMKELLVE    50
NHQLKEAMKL NNQAMKGRFE ELSAWTEKQK EERQLFEIQS KEAKERLKAL 100
SHENERLKEE LGKLKEKSER PFEDITGRCG FPRTDLEQEV EQLKRQVEQE 150
VEHLKIQVRR LQAEKADLLG IVSELQLKLN SGGSSEDSFV EIRMTEGEAE 200
GAMKEMRNSA GPTRTDSISM GKCTEDARTC VEFEELTVSQ LLLCLREGNQ 250
KVERLEIALR EAKERISDFE KKANGHSAIE TQTEGSTQKE EEDKDPESVG 300
IEVETLNVQV ASLFKELQEA HTKLSEAELM KKRLQEKCQA LERKNSATPS 350
ELNEKQELVY SNRKLELQVE SMRSEIKMEQ AKTEEEKSRL ATLQATHDKL 400
LQEHNKALRT IEELTKQQAE KVDKVQLQEL SEKLELAEQA LASKQLQMDE 450
MKQTIAKQEE DLETMAVLRA QMEVYCSDFH AERAAREKIH EEKEQLALQL 500
AILLKENNDF EDGGSRQSLM EMQCRHGART SDSDQQAYLF QRGAEDMSWQ 550
HGQQPRSIPI HSCPKCGEVL PDIDTLQIHV MDCII 585
Length:585
Mass (Da):67,014
Last modified:March 29, 2005 - v3
Checksum:i05D3390151DADEC7
GO
Isoform 2 (identifier: Q8R5M4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     156-195: IQVRRLQAEKADLLGIVSELQLKLNSGGSSEDSFVEIRMT → NQ
     515-515: Missing.

Note: No experimental confirmation available.

Show »
Length:546
Mass (Da):62,755
Checksum:iE55E5CC6B017EDEB
GO

Sequence cautioni

The sequence BAB84696.2 differs from that shown. Reason: Frameshift at positions 140, 163, 168, 169 and 192.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei156 – 19540IQVRR…EIRMT → NQ in isoform 2.
VSP_013263Add
BLAST
Alternative sequencei515 – 5151Missing in isoform 2.
VSP_013264

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti78 – 781K → R in BAB84696. 1 Publication
Sequence conflicti172 – 1743VSE → RLR1 Publication
Sequence conflicti219 – 2191S → I in BAB84696. 1 Publication
Sequence conflicti316 – 3161E → G in BAB84696. 1 Publication
Sequence conflicti363 – 3631R → W in BAB84696. 1 Publication
Sequence conflicti545 – 5451E → K in BAB84696. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB069907 mRNA. Translation: BAB84696.2. Frameshift.
BC086976 mRNA. Translation: AAH86976.1.
RefSeqiNP_659549.2. NM_145081.3.
UniGeneiRn.63435.

Genome annotation databases

GeneIDi246294.
KEGGirno:246294.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB069907 mRNA. Translation: BAB84696.2 . Frameshift.
BC086976 mRNA. Translation: AAH86976.1 .
RefSeqi NP_659549.2. NM_145081.3.
UniGenei Rn.63435.

3D structure databases

ProteinModelPortali Q8R5M4.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 251574. 1 interaction.
MINTi MINT-4570430.
STRINGi 10116.ENSRNOP00000045795.

PTM databases

PhosphoSitei Q8R5M4.

Proteomic databases

PaxDbi Q8R5M4.
PRIDEi Q8R5M4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 246294.
KEGGi rno:246294.

Organism-specific databases

CTDi 10133.
RGDi 628886. Optn.

Phylogenomic databases

eggNOGi NOG138369.
HOGENOMi HOG000231899.
HOVERGENi HBG106481.
PhylomeDBi Q8R5M4.

Miscellaneous databases

NextBioi 623677.

Gene expression databases

Genevestigatori Q8R5M4.

Family and domain databases

InterProi IPR021063. NEMO_N.
[Graphical view ]
Pfami PF11577. NEMO. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of genes expressed in rat injured dental pulp."
    Myokai F., Oyama M.
    Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.

Entry informationi

Entry nameiOPTN_RAT
AccessioniPrimary (citable) accession number: Q8R5M4
Secondary accession number(s): Q5PQX8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2005
Last sequence update: March 29, 2005
Last modified: April 16, 2014
This is version 71 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

External Data

Dasty 3

Similar proteinsi