Q8R550 (SH3K1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 106.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: SH3 domain-containing kinase-binding protein 1 Alternative name(s): Regulator of ubiquitous kinase Short name=Ruk SH3-containing, expressed in tumorigenic astrocytes | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 709 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Adapter protein involved in regulating diverse signal transduction pathways. Involved in the regulation of endocytosis and lysosomal degradation of ligand-induced receptor tyrosine kinases, including EGFR and MET/hepatocyte growth factor receptor, through a association with CBL and endophilins. The association with CBL, and thus the receptor internalization, may inhibited by an interaction with PDCD6IP and/or SPRY2. Involved in regulation of ligand-dependent endocytosis of the IgE receptor. Attenuates phosphatidylinositol 3-kinase activity by interaction with its regulatory subunit. May be involved in regulation of cell adhesion; promotes the interaction between TTK2B and PDCD6IP. May be involved in the regulation of cellular stress response via the MAPK pathways through its interaction with MAP3K4. Is involved in modulation of tumor necrosis factor mediated apoptosis. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape and migration By similarity. |
| Subunit structure | Can self-associate and form homotetramers. Interacts with CD2, F-actin capping protein, PIK3R3, GRB2, EGFR, MET, BLNK, MAP3K4, PDCD6IP, SPRY2, ARHGAP17, ARHGAP27, CRK, BCAR1, SOS1, ASAP1, ARAP3, HIP1R, SYNJ2, INPP5D and STAP1. Interacts with CBL and CBLB, but does not interact with CBLC. Two molecules of SH3KBP1 seem to bind through their respective SH3 1 domain to one molecule of CBLB. The interaction with CBL or CBLB and EGFR is increased upon EGF stimulation. The interaction with CBL is attenuated by PDCD6IP. Interacts through its proline-rich region with the SH3 domain of endophilins SH3GL1, SH3GL2 and SH3GL3. The SH3KBP1-endophilin complex seems to associate with a complex containing the phosphorylated receptor (EGFR or MET) and phosphorylated CBL. Probably associates with ASAP1 and phosphorylated EGFR. Probably part of a complex consisting of at least SH3KBP1, ASAP1 and ARAP3. Interacts with focal adhesion kinases PTK2/FAK1 AND PTK2B/PYK2, probably as a dimer. Interacts with DAB2 and probably associates with chathrin through its interaction with DAB2. Part of a complex consisting of SH3KBP1, DAB2, and clathrin heavy chain. DAB2 and clathrin dissociate from SH3KBP1 following growth factor treatment, enabling interaction with CBL. Interacts with DDN and probably associates with MAGI2 through its interaction with DDN. Interacts with the SH3 domains of SRC tyrosine-protein kinases SRC, LCK, LYN, FGR, FYN and HCK. Interacts with TRADD, BIRC2, TRAF1, TRAF2 and TNFR1, and the association with a TNFR1-associated complex upon stimulation with TNF-alpha seems to be mediated by SRC. Probably part of a complex consisting of at least SH3KBP1, ASAP1 and ARAP3 By similarity. Interacts with SHKBP1. Interacts with ATX2. Ref.6 Ref.9 |
| Subcellular location | Cytoplasm › cytoskeleton By similarity. Cytoplasmic vesicle membrane; Peripheral membrane protein By similarity. Cell junction › synapse › synaptosome By similarity. Cell junction › focal adhesion By similarity. Note: Localized in endocytic vesicles containing clustered receptors. Colocalizes with ASAP1 in vesicular structures. Colocalized with actin microfilaments and focal adhesions By similarity. Colocalized with MAGI2 in synaptosomes By similarity. |
| Domain | The SH3 domains mediate interaction with SHKBP1. |
| Post-translational modification | Monoubiquitinated by CBL and CBLB after EGF stimulation; probably on its C-terminus By similarity. |
| Sequence similarities | Contains 3 SH3 domains. |
Ontologies
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8R550-1) Also known as: Ruk-xl; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8R550-2) Also known as: Ruk-l; The sequence of this isoform differs from the canonical sequence as follows: 174-217: Missing. | ||||||
| Isoform 3 (identifier: Q8R550-3) Also known as: Ruk-deltaA; The sequence of this isoform differs from the canonical sequence as follows: 1-54: MVEAIVEFDYQAQHDDELTISVGEVITNIRKEDGGWWEGQINGRRGLFPDNFVR → MELSAAKAPSPTDLPES 174-217: Missing. | ||||||
| Isoform 4 (identifier: Q8R550-4) Also known as: Ruk-m1; The sequence of this isoform differs from the canonical sequence as follows: 1-286: MVEAIVEFDY...VENDFLPVEK → MGEEVSLGEK...FGVFLVNEET | ||||||
| Isoform 5 (identifier: Q8R550-5) Also known as: Ruk-m3; The sequence of this isoform differs from the canonical sequence as follows: 1-286: MVEAIVEFDY...VENDFLPVEK → MGEE | ||||||
| Isoform 6 (identifier: Q8R550-6) Also known as: Ruk-t; The sequence of this isoform differs from the canonical sequence as follows: 1-477: MVEAIVEFDY...RPVGPLTHTR → MFPFRKGARPPSMNLFRQTCW | ||||||
| Isoform 7 (identifier: Q8R550-7) Also known as: Ruk-h; The sequence of this isoform differs from the canonical sequence as follows: 1-599: Missing. | ||||||
| Isoform 8 (identifier: Q8R550-8) Also known as: Ruk-deltaCP; The sequence of this isoform differs from the canonical sequence as follows: 174-217: Missing. 320-630: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 709 | 709 | SH3 domain-containing kinase-binding protein 1 | PRO_0000097729 | |||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||
| Domain | 1 – 58 | 58 | SH3 1 | ||||||||||||||||||||||||||
| Domain | 98 – 157 | 60 | SH3 2 | ||||||||||||||||||||||||||
| Domain | 311 – 372 | 62 | SH3 3 | ||||||||||||||||||||||||||
| Coiled coil | 646 – 708 | 63 | Potential | ||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||
| Modified residue | 156 | 1 | Phosphoserine Ref.8 | ||||||||||||||||||||||||||
| Modified residue | 274 | 1 | Phosphoserine Ref.10 Ref.11 | ||||||||||||||||||||||||||
| Modified residue | 298 | 1 | Phosphothreonine By similarity | ||||||||||||||||||||||||||
| Modified residue | 480 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||
| Modified residue | 512 | 1 | Phosphoserine Ref.7 | ||||||||||||||||||||||||||
| Modified residue | 553 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||
| Modified residue | 555 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||
| Modified residue | 565 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||
| Modified residue | 631 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||
| Alternative sequence | 1 – 599 | 599 | Missing in isoform 7. | VSP_007509 | |||||||||||||||||||||||||
| Alternative sequence | 1 – 477 | 477 | MVEAI…LTHTR → MFPFRKGARPPSMNLFRQTC W in isoform 6. | VSP_007508 | |||||||||||||||||||||||||
| Alternative sequence | 1 – 286 | 286 | MVEAI…LPVEK → MGEEVSLGEKNISPEQASCG ALHPRGWGSQTFGVFLVNEE T in isoform 4. | VSP_007507 | |||||||||||||||||||||||||
| Alternative sequence | 1 – 286 | 286 | MVEAI…LPVEK → MGEE in isoform 5. | VSP_007506 | |||||||||||||||||||||||||
| Alternative sequence | 1 – 54 | 54 | MVEAI…DNFVR → MELSAAKAPSPTDLPES in isoform 3. | VSP_007505 | |||||||||||||||||||||||||
| Alternative sequence | 174 – 217 | 44 | Missing in isoform 2, isoform 3 and isoform 8. | VSP_007510 | |||||||||||||||||||||||||
| Alternative sequence | 320 – 630 | 311 | Missing in isoform 8. | VSP_007511 | |||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||
| Sequence conflict | 251 – 259 | 9 | PKKVKGVGF → NDDELTIKE Ref.5 | ||||||||||||||||||||||||||
| Sequence conflict | 478 – 528 | 51 | GDSPK…TTSRP → YCHVLTKAGGHGMIMKIGEG MRTKLCLKIPATFFSSEKVV ARCWGATWCRL in BAC30033. Ref.2 | ||||||||||||||||||||||||||
| Sequence conflict | 529 – 709 | 181 | Missing in BAC30033. Ref.2 | ||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||
| Beta strand | 103 – 107 | 5 | |||||||||||||||||||||||||||
| Beta strand | 129 – 132 | 4 | |||||||||||||||||||||||||||
| Beta strand | 135 – 138 | 4 | |||||||||||||||||||||||||||
| Beta strand | 145 – 148 | 4 | |||||||||||||||||||||||||||
| Beta strand | 151 – 154 | 4 | |||||||||||||||||||||||||||
| Beta strand | 314 – 318 | 5 | |||||||||||||||||||||||||||
| Beta strand | 336 – 342 | 7 | |||||||||||||||||||||||||||
| Beta strand | 350 – 354 | 5 | |||||||||||||||||||||||||||
| Beta strand | 359 – 363 | 5 | |||||||||||||||||||||||||||
| Helix | 364 – 366 | 3 | |||||||||||||||||||||||||||
| Beta strand | 367 – 369 | 3 | |||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Organization of the mouse Ruk locus and expression of isoforms in mouse tissues." Buchman V.L., Luke C., Borthwick E.B., Gout I., Ninkina N. Gene 295:13-17(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 2; 3; 4; 5; 6 AND 7). Strain: 129/Ola. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Strain: C57BL/6J. Tissue: Embryonic stem cell, Hypothalamus, Lung and Thymus. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [4] | "Assignment of SETA to distal mouse X chromosome by radiation hybrid mapping." Hyatt M.A., Sykes V.W., Boyer A.D., Arden K.C., Boegler O. Cytogenet. Cell Genet. 89:278-278(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 247-286. Strain: 129/SvJ. |
| [5] | "The WashU-NCI mouse EST project 1999." Marra M., Hillier L., Kucaba T., Martin J., Beck C., Wylie T., Underwood K., Steptoe M., Theising B., Allen M., Bowers Y., Person B., Swaller T., Gibbons M., Pape D., Harvey N., Schurk R., Ritter E. Wilson R.Submitted (MAR-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 250-709 (ISOFORM 8). Strain: C57BL/6J. Tissue: Thymus. |
| [6] | "SETA is a multifunctional adapter protein with three SH3 domains that binds Grb2, Cbl, and the novel SB1 proteins." Borinstein S.C., Hyatt M.A., Sykes V.W., Straub R.E., Lipkowitz S., Boulter J., Boegler O. Cell. Signal. 12:769-779(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SHKBP1. |
| [7] | "Identification of phosphoproteins and their phosphorylation sites in the WEHI-231 B lymphoma cell line." Shu H., Chen S., Bi Q., Mumby M., Brekken D.L. Mol. Cell. Proteomics 3:279-286(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-512, MASS SPECTROMETRY. Tissue: B-cell lymphoma. |
| [8] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-156, MASS SPECTROMETRY. Tissue: Brain cortex. |
| [9] | "Ataxin-2 associates with the endocytosis complex and affects EGF receptor trafficking." Nonis D., Schmidt M.H., van de Loo S., Eich F., Dikic I., Nowock J., Auburger G. Cell. Signal. 20:1725-1739(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ATX2. |
| [10] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-274, MASS SPECTROMETRY. Tissue: Melanoma. |
| [11] | "The phagosomal proteome in interferon-gamma-activated macrophages." Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P. Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-274, MASS SPECTROMETRY. Tissue: Macrophage. |
| [12] | "Solution structure of the SH3 domains of SH3-domain kinase binding protein 1." RIKEN structural genomics initiative (RSGI) Submitted (JUN-2006) to the PDB data bank Cited for: STRUCTURE BY NMR OF 101-159 AND 314-370. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF472327 AF472326 Genomic DNA. Translation: AAL82456.1.AF472327, AF472325, AF472326 Genomic DNA. Translation: AAL82457.1. AF472327 AF472326 Genomic DNA. Translation: AAL82458.1.AF472327 AF472326 Genomic DNA. Translation: AAL82459.1.AF472327 AF472326 Genomic DNA. Translation: AAL82460.1.AF472327 AF472326 Genomic DNA. Translation: AAL82461.1.AF472327 AF472326 Genomic DNA. Translation: AAL82462.1.AK004636 mRNA. Translation: BAB23427.2. AK020782 mRNA. Translation: BAB32209.2. AK038540 mRNA. Translation: BAC30033.1. AK049182 mRNA. Translation: BAC33592.1. AL929452 Genomic DNA. Translation: CAM21669.1. AL929452 Genomic DNA. Translation: CAM21670.1. AF243508 Genomic DNA. Translation: AAF68439.1. AI428677 mRNA. No translation available. | ||||||||||||||||||
| IPI | IPI00153931. IPI00153932. IPI00312101. IPI00405001. IPI00406812. IPI00466258. IPI00468129. IPI00885364. | ||||||||||||||||||
| RefSeq | NP_001129199.1. NM_001135727.1. NP_001129200.1. NM_001135728.1. NP_067364.2. NM_021389.5. | ||||||||||||||||||
| UniGene | Mm.286495. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q8R550. | ||||||||||||||||||
| SMR | Q8R550. Positions 2-166, 314-389. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q8R550. 4 interactions. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q8R550. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q8R550. | ||||||||||||||||||
| PRIDE | Q8R550. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 58194. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENSMUST00000073094; ENSMUSP00000072840; ENSMUSG00000040990. ENSMUST00000080394; ENSMUSP00000079257; ENSMUSG00000040990. ENSMUST00000112451; ENSMUSP00000108070; ENSMUSG00000040990. ENSMUST00000112453; ENSMUSP00000108072; ENSMUSG00000040990. ENSMUST00000112456; ENSMUSP00000108075; ENSMUSG00000040990. | ||||||||||||||||||
| GeneID | 58194. | ||||||||||||||||||
| KEGG | mmu:58194. | ||||||||||||||||||
| UCSC | uc009usx.2. mouse. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 30011. | ||||||||||||||||||
| MGI | MGI:1889583. Sh3kbp1. | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG319250. | ||||||||||||||||||
| GeneTree | ENSGT00530000063594. | ||||||||||||||||||
| HOVERGEN | HBG057824. | ||||||||||||||||||
| InParanoid | Q8R550. | ||||||||||||||||||
| KO | K12470. | ||||||||||||||||||
| OrthoDB | EOG4FN4HD. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q8R550. | ||||||||||||||||||
| Bgee | Q8R550. | ||||||||||||||||||
| CleanEx | MM_SH3KBP1. | ||||||||||||||||||
| Genevestigator | Q8R550. | ||||||||||||||||||
| GermOnline | ENSMUSG00000040990. Mus musculus. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR000108. p67phox. IPR011511. SH3_2. IPR001452. SH3_domain. [Graphical view] | ||||||||||||||||||
| Pfam | PF00018. SH3_1. 1 hit. PF07653. SH3_2. 2 hits. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00499. P67PHOX. PR00452. SH3DOMAIN. | ||||||||||||||||||
| SMART | SM00326. SH3. 3 hits. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF50044. SH3. 3 hits. | ||||||||||||||||||
| PROSITE | PS50002. SH3. 3 hits. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| ChiTaRS | SH3KBP1. mouse. | ||||||||||||||||||
| EvolutionaryTrace | Q8R550. | ||||||||||||||||||
| NextBio | 314169. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | SH3K1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8R550 Secondary accession number(s): B1AZ86 Q9JKC3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
