Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8R4K8

- PAPP1_MOUSE

UniProt

Q8R4K8 - PAPP1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Pappalysin-1

Gene

Pappa

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Metalloproteinase which specifically cleaves IGFBP-4 and IGFBP-5, resulting in release of bound IGF. Cleavage of IGFBP-4 is dramatically enhanced by the presence of IGF, whereas cleavage of IGFBP-5 is slightly inhibited by the presence of IGF. Isoform 2 cleaves IGFBP-4 very slowly compared to PAPP-A, but its ability to cleave IGFBP-5 is unaffected.1 Publication

Catalytic activityi

Cleavage of the 135-Met-|-Lys-136 bond in insulin-like growth factor binding protein (IGFBP)-4, and the 143-Ser-|-Lys-144 bond in IGFBP-5.

Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi559 – 5591Zinc; catalyticPROSITE-ProRule annotation
Active sitei560 – 5601PROSITE-ProRule annotation
Metal bindingi563 – 5631Zinc; catalyticPROSITE-ProRule annotation
Metal bindingi569 – 5691Zinc; catalyticPROSITE-ProRule annotation

GO - Molecular functioni

  1. endopeptidase activity Source: MGI
  2. metal ion binding Source: UniProtKB-KW
  3. metallopeptidase activity Source: UniProtKB-KW

GO - Biological processi

  1. cell differentiation Source: InterPro
  2. response to follicle-stimulating hormone Source: Ensembl
  3. response to glucocorticoid Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Metalloprotease, Protease

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_235886. Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs).

Protein family/group databases

MEROPSiM43.004.

Names & Taxonomyi

Protein namesi
Recommended name:
Pappalysin-1 (EC:3.4.24.79)
Alternative name(s):
Insulin-like growth factor-dependent IGF-binding protein 4 protease
Short name:
IGF-dependent IGFBP-4 protease
Short name:
IGFBP-4ase
Pregnancy-associated plasma protein A
Short name:
PAPP-A
Gene namesi
Name:Pappa
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 4

Organism-specific databases

MGIiMGI:97479. Pappa.

Subcellular locationi

GO - Cellular componenti

  1. extracellular space Source: Ensembl
  2. membrane Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2222Sequence AnalysisAdd
BLAST
Propeptidei23 – 8058By similarityPRO_0000029247Add
BLAST
Chaini81 – 16241544Pappalysin-1PRO_0000029248Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi141 ↔ 232PROSITE-ProRule annotation
Disulfide bondi324 ↔ 619PROSITE-ProRule annotation
Disulfide bondi329 ↔ 654PROSITE-ProRule annotation
Glycosylationi387 – 3871N-linked (GlcNAc...)Sequence Analysis
Glycosylationi398 – 3981N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi411 ↔ 425PROSITE-ProRule annotation
Disulfide bondi421 ↔ 437PROSITE-ProRule annotation
Glycosylationi426 – 4261N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi454 ↔ 470PROSITE-ProRule annotation
Disulfide bondi458 – 458Interchain (with C-49 in PRG2 proform)PROSITE-ProRule annotation
Disulfide bondi471 ↔ 482PROSITE-ProRule annotation
Glycosylationi516 – 5161N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi580 ↔ 597Or C-580 with C-609PROSITE-ProRule annotation
Disulfide bondi584 ↔ 609Or C-584 with C-597PROSITE-ProRule annotation
Glycosylationi598 – 5981N-linked (GlcNAc...)Sequence Analysis
Glycosylationi616 – 6161N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi707 ↔ 875PROSITE-ProRule annotation
Disulfide bondi710 ↔ 878PROSITE-ProRule annotation
Glycosylationi722 – 7221N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi729 – 729Interchain (with C-170 in PRG2 proform)PROSITE-ProRule annotation
Disulfide bondi750 ↔ 832PROSITE-ProRule annotation
Disulfide bondi772 ↔ 778PROSITE-ProRule annotation
Glycosylationi822 – 8221N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi944 ↔ 972PROSITE-ProRule annotation
Disulfide bondi957 ↔ 968PROSITE-ProRule annotation
Disulfide bondi980 ↔ 987PROSITE-ProRule annotation
Disulfide bondi996 ↔ 1008PROSITE-ProRule annotation
Glycosylationi1023 – 10231N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi1033 ↔ 1067PROSITE-ProRule annotation
Disulfide bondi1048 ↔ 1136PROSITE-ProRule annotation
Disulfide bondi1189 ↔ 1202PROSITE-ProRule annotation
Disulfide bondi1207 – 1207InterchainPROSITE-ProRule annotation
Disulfide bondi1212 ↔ 1266PROSITE-ProRule annotation
Glycosylationi1219 – 12191N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1223 – 12231N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi1224 ↔ 1235PROSITE-ProRule annotation
Disulfide bondi1239 ↔ 1277PROSITE-ProRule annotation
Disulfide bondi1282 ↔ 1326PROSITE-ProRule annotation
Disulfide bondi1297 ↔ 1307PROSITE-ProRule annotation
Disulfide bondi1311 ↔ 1339PROSITE-ProRule annotation
Glycosylationi1320 – 13201N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi1343 ↔ 1396PROSITE-ProRule annotation
Disulfide bondi1359 ↔ 1370PROSITE-ProRule annotation
Disulfide bondi1374 ↔ 1407PROSITE-ProRule annotation
Disulfide bondi1412 ↔ 1455PROSITE-ProRule annotation
Disulfide bondi1425 ↔ 1435PROSITE-ProRule annotation
Disulfide bondi1439 ↔ 1468PROSITE-ProRule annotation
Disulfide bondi1475 ↔ 1536PROSITE-ProRule annotation
Disulfide bondi1489 ↔ 1499PROSITE-ProRule annotation
Disulfide bondi1503 ↔ 1551PROSITE-ProRule annotation
Glycosylationi1516 – 15161N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi1555 ↔ 1573PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

PaxDbiQ8R4K8.
PRIDEiQ8R4K8.

PTM databases

PhosphoSiteiQ8R4K8.

Expressioni

Tissue specificityi

Detected in kidney, spleen, brain, ovary, breast, skin, prostate, uterus, and placenta.2 Publications

Gene expression databases

BgeeiQ8R4K8.
CleanExiMM_PAPPA.
GenevestigatoriQ8R4K8.

Interactioni

Subunit structurei

Homodimer; disulfide-linked. In pregnancy serum, predominantly found as a disulfide-linked 2:2 heterotetramer with the proform of PRG2 (By similarity).By similarity

Structurei

3D structure databases

ProteinModelPortaliQ8R4K8.
SMRiQ8R4K8. Positions 540-657, 1281-1509.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1210 – 127970Sushi 1PROSITE-ProRule annotationAdd
BLAST
Domaini1280 – 134162Sushi 2PROSITE-ProRule annotationAdd
BLAST
Domaini1342 – 140968Sushi 3PROSITE-ProRule annotationAdd
BLAST
Domaini1410 – 147061Sushi 4PROSITE-ProRule annotationAdd
BLAST
Domaini1473 – 155381Sushi 5PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni272 – 583312MetalloproteaseAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi24 – 8259Arg-richAdd
BLAST

Sequence similaritiesi

Belongs to the peptidase M43B family.Curated
Contains 5 Sushi (CCP/SCR) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Sushi

Phylogenomic databases

eggNOGiNOG128309.
GeneTreeiENSGT00390000009007.
HOVERGENiHBG053501.
InParanoidiQ8R4K8.
KOiK07762.
OMAiGIQIYTL.
OrthoDBiEOG7HB58B.
PhylomeDBiQ8R4K8.
TreeFamiTF331636.

Family and domain databases

Gene3Di2.60.120.200. 1 hit.
3.40.390.10. 1 hit.
InterProiIPR013320. ConA-like_dom.
IPR006558. LamG-like.
IPR024079. MetalloPept_cat_dom.
IPR011936. Myxo_disulph_rpt.
IPR000800. Notch_dom.
IPR008754. Peptidase_M43.
IPR000436. Sushi_SCR_CCP.
[Graphical view]
PfamiPF00066. Notch. 2 hits.
PF05572. Peptidase_M43. 1 hit.
PF00084. Sushi. 3 hits.
[Graphical view]
SMARTiSM00032. CCP. 4 hits.
SM00560. LamGL. 1 hit.
SM00004. NL. 3 hits.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 1 hit.
SSF57535. SSF57535. 4 hits.
TIGRFAMsiTIGR02232. myxo_disulf_rpt. 1 hit.
PROSITEiPS50923. SUSHI. 5 hits.
PS00142. ZINC_PROTEASE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8R4K8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRLWSWVLRL GLLSAALGCG LAERPRRVRR DPRAVRPPRP AAGPATCATR
60 70 80 90 100
AARGRRASPP PPPGGAWEAV RVPRRRQQRA ARGAEEPSPP SRALYFSGRG
110 120 130 140 150
EQLRLRADLE LPRDAFTLQV WLRAEGGQKS PAVITGLYDK CSYTSRDRGW
160 170 180 190 200
VMGIHTTSDQ GNRDPRYFFS LKTDRARKVT TIDAHRSYLP GQWVHLAATY
210 220 230 240 250
DGRLMKLYMN GAQVATSAEQ VGGIFSPLTQ KCKVLMLGGS ALNHNFRGHI
260 270 280 290 300
EHFSLWKVAR TQREIVSDME TRGLHTPLPQ LLLQENWDNV KRTWSPMKDG
310 320 330 340 350
NSPQVEFSNA HGFLLDTNLE PPLCGQTLCD NTEVISSYNQ LPSFRQPKVV
360 370 380 390 400
RYRVVNIYDD HHENPTVSWQ QIDFQHQQLA EAFQHYNISW ELEVLNINSS
410 420 430 440 450
SLRHRLILAN CDISKIGDEK CDPECNHTLT GHDGGDCRQL RYPAFMKKQQ
460 470 480 490 500
NGVCDMDCNY ERFNFDGGEC CDPDITDVTK TCFDPDSPHR AYLDVNELKN
510 520 530 540 550
ILRLDGSTHL NIFFANSSEE ELAGVATWPW DKEALMHLGG IVLNPSFYGI
560 570 580 590 600
PGHTHTMIHE IGHSLGLYHI FRGISEIQSC SDPCMETEPS FETGDLCNDT
610 620 630 640 650
NPAPKHKFCG DPGPGNDTCG FHGFFNTPYN NFMSYADDDC TDSFTPNQVS
660 670 680 690 700
RMHCYLDLVY QSWQPSRKPA PVALAPQVVG HTMDSVMLEW FPPIDGHFFE
710 720 730 740 750
RELGSACDLC LEGRILVQYA FNASSPMPCG PSGHWSPREA EGHPDVEQPC
760 770 780 790 800
KSSVRTWSPN SAVNPHTVPP ACPEPQGCYL ELEFRYPLVP ESLTIWVTFV
810 820 830 840 850
SSDWDSSGAV NDIKLLTISG KNISLGPQNV FCDIPLTIRL RDVGEEVYGI
860 870 880 890 900
QIYTLDEHLE IDAAMLTSTV DSPLCLQCKP LQYKVLRDPP LLEDVASLLH
910 920 930 940 950
LNRRFMDTDL KLGSVYQYRI ITISGNEESE PSPAAIYTHG SGYCGDGVIQ
960 970 980 990 1000
KDQGEECDDM NKVNGDGCSL FCKQEVSFNC IDEPSRCYFH DGDGMCEEFE
1010 1020 1030 1040 1050
QKTSIKDCGV YTPQGFLDQW ASNASVSHQD QQCPGWVVIG QPAASQVCRT
1060 1070 1080 1090 1100
KVIDLSEGIS QHAWYPCTIT YPYYHLPQTT FWLQTYFSQP MVAAAVIIHL
1110 1120 1130 1140 1150
VTDGTYYGDQ KQETISVQLL DTKDQSHDLG LHVLSCRNNP LIIPVVHDLS
1160 1170 1180 1190 1200
QPFYHSQAVH VSFSSPLVAI SGVALRSFDN FDPVTLSSCQ RGETYSPAEQ
1210 1220 1230 1240 1250
SCVHFACQAA DCPELAVGNA SLNCSSNHHY HGAQCTVSCQ TGYVLQIQRD
1260 1270 1280 1290 1300
DELIKSQVGP SITVTCTEGK WNKQVACEPV DCGIPDHHHV YAASFSCPEG
1310 1320 1330 1340 1350
TTFGRRCSFQ CRHPAQLKGN NSFLTCMEDG LWSFPEALCE LMCLAPPPVP
1360 1370 1380 1390 1400
NADLQTARCR ENKHKVGSFC KYKCKPGYHV PGSSRKSKKR AFKTQCTQDG
1410 1420 1430 1440 1450
SWQEGTCVPV TCDPPPPKFH GLYQCTNGFQ FNSECRIKCE DSDASQGRGS
1460 1470 1480 1490 1500
NIIHCRKDGT WSGSFHVCRE MQGQCSAPNQ LNSNLKLQCP DGYAIGSECA
1510 1520 1530 1540 1550
ISCLDHNSES IILPVNLTVR DIPHWMNPTR VQRIVCTAGL QWYPHPALIH
1560 1570 1580 1590 1600
CVKGCEPFMG DNYCDAINNR AFCNYDGGDC CTSTVKTKKV TPFPMSCDLQ
1610 1620
NDCACRDPEA QEHNRKDLRG YSHG
Length:1,624
Mass (Da):181,318
Last modified:December 7, 2004 - v2
Checksum:iB09404C206CB60D1
GO
Isoform 2 (identifier: Q8R4K8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     490-490: R → RQSIRKRAHVVEESWLPHGKQKAKKRKRTR

Show »
Length:1,653
Mass (Da):184,839
Checksum:iEF7A13AFE698A430
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei490 – 4901R → RQSIRKRAHVVEESWLPHGK QKAKKRKRTR in isoform 2. 1 PublicationVSP_012193

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL691491, AL691454 Genomic DNA. Translation: CAD83034.2.
AL691454, AL691491 Genomic DNA. Translation: CAD62274.2.
AF439513 mRNA. Translation: AAM12687.1.
AF439514 mRNA. Translation: AAM12688.1.
AF510317 Genomic DNA. Translation: AAM44048.1.
AF258461 mRNA. Translation: AAG09799.1.
AF260433 mRNA. Translation: AAF70319.1.
CCDSiCCDS18267.1. [Q8R4K8-1]
RefSeqiNP_067337.1. NM_021362.1. [Q8R4K8-1]
UniGeneiMm.317854.

Genome annotation databases

EnsembliENSMUST00000084501; ENSMUSP00000081545; ENSMUSG00000028370. [Q8R4K8-1]
GeneIDi18491.
KEGGimmu:18491.
UCSCiuc008thm.1. mouse. [Q8R4K8-1]
uc012dgb.1. mouse. [Q8R4K8-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL691491 , AL691454 Genomic DNA. Translation: CAD83034.2 .
AL691454 , AL691491 Genomic DNA. Translation: CAD62274.2 .
AF439513 mRNA. Translation: AAM12687.1 .
AF439514 mRNA. Translation: AAM12688.1 .
AF510317 Genomic DNA. Translation: AAM44048.1 .
AF258461 mRNA. Translation: AAG09799.1 .
AF260433 mRNA. Translation: AAF70319.1 .
CCDSi CCDS18267.1. [Q8R4K8-1 ]
RefSeqi NP_067337.1. NM_021362.1. [Q8R4K8-1 ]
UniGenei Mm.317854.

3D structure databases

ProteinModelPortali Q8R4K8.
SMRi Q8R4K8. Positions 540-657, 1281-1509.
ModBasei Search...
MobiDBi Search...

Protein family/group databases

MEROPSi M43.004.

PTM databases

PhosphoSitei Q8R4K8.

Proteomic databases

PaxDbi Q8R4K8.
PRIDEi Q8R4K8.

Protocols and materials databases

DNASUi 18491.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000084501 ; ENSMUSP00000081545 ; ENSMUSG00000028370 . [Q8R4K8-1 ]
GeneIDi 18491.
KEGGi mmu:18491.
UCSCi uc008thm.1. mouse. [Q8R4K8-1 ]
uc012dgb.1. mouse. [Q8R4K8-2 ]

Organism-specific databases

CTDi 5069.
MGIi MGI:97479. Pappa.

Phylogenomic databases

eggNOGi NOG128309.
GeneTreei ENSGT00390000009007.
HOVERGENi HBG053501.
InParanoidi Q8R4K8.
KOi K07762.
OMAi GIQIYTL.
OrthoDBi EOG7HB58B.
PhylomeDBi Q8R4K8.
TreeFami TF331636.

Enzyme and pathway databases

Reactomei REACT_235886. Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs).

Miscellaneous databases

NextBioi 294210.
PROi Q8R4K8.
SOURCEi Search...

Gene expression databases

Bgeei Q8R4K8.
CleanExi MM_PAPPA.
Genevestigatori Q8R4K8.

Family and domain databases

Gene3Di 2.60.120.200. 1 hit.
3.40.390.10. 1 hit.
InterProi IPR013320. ConA-like_dom.
IPR006558. LamG-like.
IPR024079. MetalloPept_cat_dom.
IPR011936. Myxo_disulph_rpt.
IPR000800. Notch_dom.
IPR008754. Peptidase_M43.
IPR000436. Sushi_SCR_CCP.
[Graphical view ]
Pfami PF00066. Notch. 2 hits.
PF05572. Peptidase_M43. 1 hit.
PF00084. Sushi. 3 hits.
[Graphical view ]
SMARTi SM00032. CCP. 4 hits.
SM00560. LamGL. 1 hit.
SM00004. NL. 3 hits.
[Graphical view ]
SUPFAMi SSF49899. SSF49899. 1 hit.
SSF57535. SSF57535. 4 hits.
TIGRFAMsi TIGR02232. myxo_disulf_rpt. 1 hit.
PROSITEi PS50923. SUSHI. 5 hits.
PS00142. ZINC_PROTEASE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  2. "Expression of recombinant murine pregnancy-associated plasma protein-A (PAPP-A) and a novel variant (PAPP-Ai) with differential proteolytic activity."
    Soe R., Overgaard M.T., Thomsen A.R., Laursen L.S., Olsen I.M., Sottrup-Jensen L., Haaning J., Giudice L.C., Conover C.A., Oxvig C.
    Eur. J. Biochem. 269:2247-2256(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 80-1624 (ISOFORMS 1 AND 2), FUNCTION, TISSUE SPECIFICITY.
  3. "Differential regulation of pregnancy associated plasma protein (PAPP)-A during pregnancy in human and mouse."
    Qin X., Sexton C., Byun D., Strong D.D., Baylink D.J., Mohan S.
    Growth Horm. IGF Res. 12:359-366(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 136-489 (ISOFORM 1).
    Strain: 129/SvJ.
  4. "The regulated expression of the pregnancy-associated plasma protein-A in the rodent ovary: a proposed role in the development of dominant follicles and of corpora lutea."
    Hourvitz A., Kuwahara A., Hennebold J.D., Tavares A.B., Negishi H., Lee T.H., Erickson G.F., Adashi E.Y.
    Endocrinology 143:1833-1844(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 258-1624 (ISOFORM 1), TISSUE SPECIFICITY.
    Strain: C57BL/6J.
  5. "Partial sequence of Mus musculus Mus musculus pregnancy-associated plasma protein A (Pappa)."
    Olesen C., Hansen C., Hayashizaki Y., Byskov A., Tommerup N.
    Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1157-1624 (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Embryo.

Entry informationi

Entry nameiPAPP1_MOUSE
AccessioniPrimary (citable) accession number: Q8R4K8
Secondary accession number(s): Q80VW3
, Q80YY1, Q8K423, Q8R4K7, Q9ES06, Q9JK57
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: December 7, 2004
Last modified: November 26, 2014
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3