Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8R4K8

- PAPP1_MOUSE

UniProt

Q8R4K8 - PAPP1_MOUSE

Protein

Pappalysin-1

Gene

Pappa

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 101 (01 Oct 2014)
      Sequence version 2 (07 Dec 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Metalloproteinase which specifically cleaves IGFBP-4 and IGFBP-5, resulting in release of bound IGF. Cleavage of IGFBP-4 is dramatically enhanced by the presence of IGF, whereas cleavage of IGFBP-5 is slightly inhibited by the presence of IGF. Isoform 2 cleaves IGFBP-4 very slowly compared to PAPP-A, but its ability to cleave IGFBP-5 is unaffected.1 Publication

    Catalytic activityi

    Cleavage of the 135-Met-|-Lys-136 bond in insulin-like growth factor binding protein (IGFBP)-4, and the 143-Ser-|-Lys-144 bond in IGFBP-5.

    Cofactori

    Binds 1 zinc ion per subunit.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi559 – 5591Zinc; catalyticPROSITE-ProRule annotation
    Active sitei560 – 5601PROSITE-ProRule annotation
    Metal bindingi563 – 5631Zinc; catalyticPROSITE-ProRule annotation
    Metal bindingi569 – 5691Zinc; catalyticPROSITE-ProRule annotation

    GO - Molecular functioni

    1. endopeptidase activity Source: MGI
    2. metal ion binding Source: UniProtKB-KW
    3. metallopeptidase activity Source: UniProtKB-KW

    GO - Biological processi

    1. cell differentiation Source: InterPro
    2. response to follicle-stimulating hormone Source: Ensembl
    3. response to glucocorticoid Source: Ensembl

    Keywords - Molecular functioni

    Hydrolase, Metalloprotease, Protease

    Keywords - Ligandi

    Metal-binding, Zinc

    Protein family/group databases

    MEROPSiM43.004.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Pappalysin-1 (EC:3.4.24.79)
    Alternative name(s):
    Insulin-like growth factor-dependent IGF-binding protein 4 protease
    Short name:
    IGF-dependent IGFBP-4 protease
    Short name:
    IGFBP-4ase
    Pregnancy-associated plasma protein A
    Short name:
    PAPP-A
    Gene namesi
    Name:Pappa
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 4

    Organism-specific databases

    MGIiMGI:97479. Pappa.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular space Source: Ensembl
    2. membrane Source: InterPro

    Keywords - Cellular componenti

    Secreted

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2222Sequence AnalysisAdd
    BLAST
    Propeptidei23 – 8058By similarityPRO_0000029247Add
    BLAST
    Chaini81 – 16241544Pappalysin-1PRO_0000029248Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi141 ↔ 232PROSITE-ProRule annotation
    Disulfide bondi324 ↔ 619PROSITE-ProRule annotation
    Disulfide bondi329 ↔ 654PROSITE-ProRule annotation
    Glycosylationi387 – 3871N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi398 – 3981N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi411 ↔ 425PROSITE-ProRule annotation
    Disulfide bondi421 ↔ 437PROSITE-ProRule annotation
    Glycosylationi426 – 4261N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi454 ↔ 470PROSITE-ProRule annotation
    Disulfide bondi458 – 458Interchain (with C-49 in PRG2 proform)PROSITE-ProRule annotation
    Disulfide bondi471 ↔ 482PROSITE-ProRule annotation
    Glycosylationi516 – 5161N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi580 ↔ 597Or C-580 with C-609PROSITE-ProRule annotation
    Disulfide bondi584 ↔ 609Or C-584 with C-597PROSITE-ProRule annotation
    Glycosylationi598 – 5981N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi616 – 6161N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi707 ↔ 875PROSITE-ProRule annotation
    Disulfide bondi710 ↔ 878PROSITE-ProRule annotation
    Glycosylationi722 – 7221N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi729 – 729Interchain (with C-170 in PRG2 proform)PROSITE-ProRule annotation
    Disulfide bondi750 ↔ 832PROSITE-ProRule annotation
    Disulfide bondi772 ↔ 778PROSITE-ProRule annotation
    Glycosylationi822 – 8221N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi944 ↔ 972PROSITE-ProRule annotation
    Disulfide bondi957 ↔ 968PROSITE-ProRule annotation
    Disulfide bondi980 ↔ 987PROSITE-ProRule annotation
    Disulfide bondi996 ↔ 1008PROSITE-ProRule annotation
    Glycosylationi1023 – 10231N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi1033 ↔ 1067PROSITE-ProRule annotation
    Disulfide bondi1048 ↔ 1136PROSITE-ProRule annotation
    Disulfide bondi1189 ↔ 1202PROSITE-ProRule annotation
    Disulfide bondi1207 – 1207InterchainPROSITE-ProRule annotation
    Disulfide bondi1212 ↔ 1266PROSITE-ProRule annotation
    Glycosylationi1219 – 12191N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1223 – 12231N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi1224 ↔ 1235PROSITE-ProRule annotation
    Disulfide bondi1239 ↔ 1277PROSITE-ProRule annotation
    Disulfide bondi1282 ↔ 1326PROSITE-ProRule annotation
    Disulfide bondi1297 ↔ 1307PROSITE-ProRule annotation
    Disulfide bondi1311 ↔ 1339PROSITE-ProRule annotation
    Glycosylationi1320 – 13201N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi1343 ↔ 1396PROSITE-ProRule annotation
    Disulfide bondi1359 ↔ 1370PROSITE-ProRule annotation
    Disulfide bondi1374 ↔ 1407PROSITE-ProRule annotation
    Disulfide bondi1412 ↔ 1455PROSITE-ProRule annotation
    Disulfide bondi1425 ↔ 1435PROSITE-ProRule annotation
    Disulfide bondi1439 ↔ 1468PROSITE-ProRule annotation
    Disulfide bondi1475 ↔ 1536PROSITE-ProRule annotation
    Disulfide bondi1489 ↔ 1499PROSITE-ProRule annotation
    Disulfide bondi1503 ↔ 1551PROSITE-ProRule annotation
    Glycosylationi1516 – 15161N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi1555 ↔ 1573PROSITE-ProRule annotation

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Zymogen

    Proteomic databases

    PaxDbiQ8R4K8.
    PRIDEiQ8R4K8.

    PTM databases

    PhosphoSiteiQ8R4K8.

    Expressioni

    Tissue specificityi

    Detected in kidney, spleen, brain, ovary, breast, skin, prostate, uterus, and placenta.2 Publications

    Gene expression databases

    BgeeiQ8R4K8.
    CleanExiMM_PAPPA.
    GenevestigatoriQ8R4K8.

    Interactioni

    Subunit structurei

    Homodimer; disulfide-linked. In pregnancy serum, predominantly found as a disulfide-linked 2:2 heterotetramer with the proform of PRG2 By similarity.By similarity

    Structurei

    3D structure databases

    ProteinModelPortaliQ8R4K8.
    SMRiQ8R4K8. Positions 540-657, 1225-1509.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini1210 – 127970Sushi 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini1280 – 134162Sushi 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini1342 – 140968Sushi 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini1410 – 147061Sushi 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini1473 – 155381Sushi 5PROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni272 – 583312MetalloproteaseAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi24 – 8259Arg-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the peptidase M43B family.Curated
    Contains 5 Sushi (CCP/SCR) domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Signal, Sushi

    Phylogenomic databases

    eggNOGiNOG128309.
    GeneTreeiENSGT00390000009007.
    HOVERGENiHBG053501.
    KOiK07762.
    OMAiGIQIYTL.
    OrthoDBiEOG7HB58B.
    PhylomeDBiQ8R4K8.
    TreeFamiTF331636.

    Family and domain databases

    Gene3Di2.60.120.200. 1 hit.
    3.40.390.10. 1 hit.
    InterProiIPR008985. ConA-like_lec_gl_sf.
    IPR013320. ConA-like_subgrp.
    IPR006558. LamG-like.
    IPR024079. MetalloPept_cat_dom.
    IPR011936. Myxo_disulph_rpt.
    IPR000800. Notch_dom.
    IPR008754. Peptidase_M43.
    IPR000436. Sushi_SCR_CCP.
    [Graphical view]
    PfamiPF00066. Notch. 2 hits.
    PF05572. Peptidase_M43. 1 hit.
    PF00084. Sushi. 3 hits.
    [Graphical view]
    SMARTiSM00032. CCP. 4 hits.
    SM00560. LamGL. 1 hit.
    SM00004. NL. 3 hits.
    [Graphical view]
    SUPFAMiSSF49899. SSF49899. 1 hit.
    SSF57535. SSF57535. 4 hits.
    TIGRFAMsiTIGR02232. myxo_disulf_rpt. 1 hit.
    PROSITEiPS50923. SUSHI. 5 hits.
    PS00142. ZINC_PROTEASE. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8R4K8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRLWSWVLRL GLLSAALGCG LAERPRRVRR DPRAVRPPRP AAGPATCATR     50
    AARGRRASPP PPPGGAWEAV RVPRRRQQRA ARGAEEPSPP SRALYFSGRG 100
    EQLRLRADLE LPRDAFTLQV WLRAEGGQKS PAVITGLYDK CSYTSRDRGW 150
    VMGIHTTSDQ GNRDPRYFFS LKTDRARKVT TIDAHRSYLP GQWVHLAATY 200
    DGRLMKLYMN GAQVATSAEQ VGGIFSPLTQ KCKVLMLGGS ALNHNFRGHI 250
    EHFSLWKVAR TQREIVSDME TRGLHTPLPQ LLLQENWDNV KRTWSPMKDG 300
    NSPQVEFSNA HGFLLDTNLE PPLCGQTLCD NTEVISSYNQ LPSFRQPKVV 350
    RYRVVNIYDD HHENPTVSWQ QIDFQHQQLA EAFQHYNISW ELEVLNINSS 400
    SLRHRLILAN CDISKIGDEK CDPECNHTLT GHDGGDCRQL RYPAFMKKQQ 450
    NGVCDMDCNY ERFNFDGGEC CDPDITDVTK TCFDPDSPHR AYLDVNELKN 500
    ILRLDGSTHL NIFFANSSEE ELAGVATWPW DKEALMHLGG IVLNPSFYGI 550
    PGHTHTMIHE IGHSLGLYHI FRGISEIQSC SDPCMETEPS FETGDLCNDT 600
    NPAPKHKFCG DPGPGNDTCG FHGFFNTPYN NFMSYADDDC TDSFTPNQVS 650
    RMHCYLDLVY QSWQPSRKPA PVALAPQVVG HTMDSVMLEW FPPIDGHFFE 700
    RELGSACDLC LEGRILVQYA FNASSPMPCG PSGHWSPREA EGHPDVEQPC 750
    KSSVRTWSPN SAVNPHTVPP ACPEPQGCYL ELEFRYPLVP ESLTIWVTFV 800
    SSDWDSSGAV NDIKLLTISG KNISLGPQNV FCDIPLTIRL RDVGEEVYGI 850
    QIYTLDEHLE IDAAMLTSTV DSPLCLQCKP LQYKVLRDPP LLEDVASLLH 900
    LNRRFMDTDL KLGSVYQYRI ITISGNEESE PSPAAIYTHG SGYCGDGVIQ 950
    KDQGEECDDM NKVNGDGCSL FCKQEVSFNC IDEPSRCYFH DGDGMCEEFE 1000
    QKTSIKDCGV YTPQGFLDQW ASNASVSHQD QQCPGWVVIG QPAASQVCRT 1050
    KVIDLSEGIS QHAWYPCTIT YPYYHLPQTT FWLQTYFSQP MVAAAVIIHL 1100
    VTDGTYYGDQ KQETISVQLL DTKDQSHDLG LHVLSCRNNP LIIPVVHDLS 1150
    QPFYHSQAVH VSFSSPLVAI SGVALRSFDN FDPVTLSSCQ RGETYSPAEQ 1200
    SCVHFACQAA DCPELAVGNA SLNCSSNHHY HGAQCTVSCQ TGYVLQIQRD 1250
    DELIKSQVGP SITVTCTEGK WNKQVACEPV DCGIPDHHHV YAASFSCPEG 1300
    TTFGRRCSFQ CRHPAQLKGN NSFLTCMEDG LWSFPEALCE LMCLAPPPVP 1350
    NADLQTARCR ENKHKVGSFC KYKCKPGYHV PGSSRKSKKR AFKTQCTQDG 1400
    SWQEGTCVPV TCDPPPPKFH GLYQCTNGFQ FNSECRIKCE DSDASQGRGS 1450
    NIIHCRKDGT WSGSFHVCRE MQGQCSAPNQ LNSNLKLQCP DGYAIGSECA 1500
    ISCLDHNSES IILPVNLTVR DIPHWMNPTR VQRIVCTAGL QWYPHPALIH 1550
    CVKGCEPFMG DNYCDAINNR AFCNYDGGDC CTSTVKTKKV TPFPMSCDLQ 1600
    NDCACRDPEA QEHNRKDLRG YSHG 1624
    Length:1,624
    Mass (Da):181,318
    Last modified:December 7, 2004 - v2
    Checksum:iB09404C206CB60D1
    GO
    Isoform 2 (identifier: Q8R4K8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         490-490: R → RQSIRKRAHVVEESWLPHGKQKAKKRKRTR

    Show »
    Length:1,653
    Mass (Da):184,839
    Checksum:iEF7A13AFE698A430
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei490 – 4901R → RQSIRKRAHVVEESWLPHGK QKAKKRKRTR in isoform 2. 1 PublicationVSP_012193

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL691491, AL691454 Genomic DNA. Translation: CAD83034.2.
    AL691454, AL691491 Genomic DNA. Translation: CAD62274.2.
    AF439513 mRNA. Translation: AAM12687.1.
    AF439514 mRNA. Translation: AAM12688.1.
    AF510317 Genomic DNA. Translation: AAM44048.1.
    AF258461 mRNA. Translation: AAG09799.1.
    AF260433 mRNA. Translation: AAF70319.1.
    CCDSiCCDS18267.1. [Q8R4K8-1]
    RefSeqiNP_067337.1. NM_021362.1. [Q8R4K8-1]
    UniGeneiMm.317854.

    Genome annotation databases

    EnsembliENSMUST00000084501; ENSMUSP00000081545; ENSMUSG00000028370. [Q8R4K8-1]
    GeneIDi18491.
    KEGGimmu:18491.
    UCSCiuc008thm.1. mouse. [Q8R4K8-1]
    uc012dgb.1. mouse. [Q8R4K8-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL691491 , AL691454 Genomic DNA. Translation: CAD83034.2 .
    AL691454 , AL691491 Genomic DNA. Translation: CAD62274.2 .
    AF439513 mRNA. Translation: AAM12687.1 .
    AF439514 mRNA. Translation: AAM12688.1 .
    AF510317 Genomic DNA. Translation: AAM44048.1 .
    AF258461 mRNA. Translation: AAG09799.1 .
    AF260433 mRNA. Translation: AAF70319.1 .
    CCDSi CCDS18267.1. [Q8R4K8-1 ]
    RefSeqi NP_067337.1. NM_021362.1. [Q8R4K8-1 ]
    UniGenei Mm.317854.

    3D structure databases

    ProteinModelPortali Q8R4K8.
    SMRi Q8R4K8. Positions 540-657, 1225-1509.
    ModBasei Search...
    MobiDBi Search...

    Protein family/group databases

    MEROPSi M43.004.

    PTM databases

    PhosphoSitei Q8R4K8.

    Proteomic databases

    PaxDbi Q8R4K8.
    PRIDEi Q8R4K8.

    Protocols and materials databases

    DNASUi 18491.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000084501 ; ENSMUSP00000081545 ; ENSMUSG00000028370 . [Q8R4K8-1 ]
    GeneIDi 18491.
    KEGGi mmu:18491.
    UCSCi uc008thm.1. mouse. [Q8R4K8-1 ]
    uc012dgb.1. mouse. [Q8R4K8-2 ]

    Organism-specific databases

    CTDi 5069.
    MGIi MGI:97479. Pappa.

    Phylogenomic databases

    eggNOGi NOG128309.
    GeneTreei ENSGT00390000009007.
    HOVERGENi HBG053501.
    KOi K07762.
    OMAi GIQIYTL.
    OrthoDBi EOG7HB58B.
    PhylomeDBi Q8R4K8.
    TreeFami TF331636.

    Miscellaneous databases

    NextBioi 294210.
    PROi Q8R4K8.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8R4K8.
    CleanExi MM_PAPPA.
    Genevestigatori Q8R4K8.

    Family and domain databases

    Gene3Di 2.60.120.200. 1 hit.
    3.40.390.10. 1 hit.
    InterProi IPR008985. ConA-like_lec_gl_sf.
    IPR013320. ConA-like_subgrp.
    IPR006558. LamG-like.
    IPR024079. MetalloPept_cat_dom.
    IPR011936. Myxo_disulph_rpt.
    IPR000800. Notch_dom.
    IPR008754. Peptidase_M43.
    IPR000436. Sushi_SCR_CCP.
    [Graphical view ]
    Pfami PF00066. Notch. 2 hits.
    PF05572. Peptidase_M43. 1 hit.
    PF00084. Sushi. 3 hits.
    [Graphical view ]
    SMARTi SM00032. CCP. 4 hits.
    SM00560. LamGL. 1 hit.
    SM00004. NL. 3 hits.
    [Graphical view ]
    SUPFAMi SSF49899. SSF49899. 1 hit.
    SSF57535. SSF57535. 4 hits.
    TIGRFAMsi TIGR02232. myxo_disulf_rpt. 1 hit.
    PROSITEi PS50923. SUSHI. 5 hits.
    PS00142. ZINC_PROTEASE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    2. "Expression of recombinant murine pregnancy-associated plasma protein-A (PAPP-A) and a novel variant (PAPP-Ai) with differential proteolytic activity."
      Soe R., Overgaard M.T., Thomsen A.R., Laursen L.S., Olsen I.M., Sottrup-Jensen L., Haaning J., Giudice L.C., Conover C.A., Oxvig C.
      Eur. J. Biochem. 269:2247-2256(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 80-1624 (ISOFORMS 1 AND 2), FUNCTION, TISSUE SPECIFICITY.
    3. "Differential regulation of pregnancy associated plasma protein (PAPP)-A during pregnancy in human and mouse."
      Qin X., Sexton C., Byun D., Strong D.D., Baylink D.J., Mohan S.
      Growth Horm. IGF Res. 12:359-366(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 136-489 (ISOFORM 1).
      Strain: 129/SvJ.
    4. "The regulated expression of the pregnancy-associated plasma protein-A in the rodent ovary: a proposed role in the development of dominant follicles and of corpora lutea."
      Hourvitz A., Kuwahara A., Hennebold J.D., Tavares A.B., Negishi H., Lee T.H., Erickson G.F., Adashi E.Y.
      Endocrinology 143:1833-1844(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 258-1624 (ISOFORM 1), TISSUE SPECIFICITY.
      Strain: C57BL/6J.
    5. "Partial sequence of Mus musculus Mus musculus pregnancy-associated plasma protein A (Pappa)."
      Olesen C., Hansen C., Hayashizaki Y., Byskov A., Tommerup N.
      Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1157-1624 (ISOFORM 1).
      Strain: C57BL/6J.
      Tissue: Embryo.

    Entry informationi

    Entry nameiPAPP1_MOUSE
    AccessioniPrimary (citable) accession number: Q8R4K8
    Secondary accession number(s): Q80VW3
    , Q80YY1, Q8K423, Q8R4K7, Q9ES06, Q9JK57
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 7, 2004
    Last sequence update: December 7, 2004
    Last modified: October 1, 2014
    This is version 101 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. Peptidase families
      Classification of peptidase families and list of entries
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3