Q8R4E6 (PURG_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 68.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Purine-rich element-binding protein gamma | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 350 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Nucleus By similarity. |
| Tissue specificity | Isoform 1 is expressed in testis. Isoform 2 is expressed in blastocyst and kidney. Ref.1 |
| Sequence similarities | Belongs to the PUR DNA-binding protein family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | DNA-binding |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8R4E6-1) Also known as: PURG-A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8R4E6-2) Also known as: PURG-A; The sequence of this isoform differs from the canonical sequence as follows: 292-350: VSEVRPPYRN...ASGEEQECLD → LTNYPKSRENLNLFHCCQTKHKEQPYDTPKTVEE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 350 | 350 | Purine-rich element-binding protein gamma | PRO_0000255953 | |||||
Regions | |||||||||
| DNA binding | 54 – 296 | 243 | By similarity | ||||||
| Compositional bias | 8 – 27 | 20 | Gly-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 163 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 166 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 342 | 1 | Phosphoserine Ref.3 | ||||||
Natural variations | |||||||||
| Alternative sequence | 292 – 350 | 59 | VSEVR…QECLD → LTNYPKSRENLNLFHCCQTK HKEQPYDTPKTVEE in isoform 2. | VSP_021320 | |||||
Experimental info | |||||||||
| Sequence conflict | 222 | 1 | D → E in AAI16407. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Distinct proteins encoded by alternative transcripts of the PURG gene, located contrapodal to WRN on chromosome 8, determined by differential termination/polyadenylation." Liu H., Johnson E.M. Nucleic Acids Res. 30:2417-2426(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY. Strain: B6D2 x J F1 and C57BL/6J. Tissue: Testis. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | "Comprehensive identification of phosphorylation sites in postsynaptic density preparations." Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L. Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-342, MASS SPECTROMETRY. Tissue: Brain. |
| [4] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-163 AND SER-166, MASS SPECTROMETRY. Tissue: Melanoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF479672 mRNA. Translation: AAL86450.1. AF479673 mRNA. Translation: AAL86451.1. BC116406 mRNA. Translation: AAI16407.1. |
| IPI | IPI00153880. IPI00408500. |
| RefSeq | NP_001091703.1. NM_001098233.1. NP_690034.1. NM_152821.2. |
| UniGene | Mm.159402. |
3D structure databases | |
| ProteinModelPortal | Q8R4E6. |
| SMR | Q8R4E6. Positions 61-323. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 10090.ENSMUSP00000065002. |
PTM databases | |
| PhosphoSite | Q8R4E6. |
Proteomic databases | |
| PaxDb | Q8R4E6. |
| PRIDE | Q8R4E6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000070340; ENSMUSP00000065002; ENSMUSG00000049184. ENSMUST00000078058; ENSMUSP00000077205; ENSMUSG00000049184. |
| GeneID | 75029. |
| KEGG | mmu:75029. |
| UCSC | uc009ljx.1. mouse. uc009ljy.1. mouse. |
Organism-specific databases | |
| CTD | 29942. |
| MGI | MGI:1922279. Purg. |
Phylogenomic databases | |
| eggNOG | NOG312871. |
| GeneTree | ENSGT00390000015406. |
| HOGENOM | HOG000232132. |
| HOVERGEN | HBG006888. |
| InParanoid | Q8R4E6. |
| OMA | FGHTLGQ. |
| OrthoDB | EOG4PRSRB. |
Gene expression databases | |
| Bgee | Q8R4E6. |
| CleanEx | MM_PURG. |
| Genevestigator | Q8R4E6. |
| GermOnline | ENSMUSG00000049184. Mus musculus. |
Family and domain databases | |
| InterPro | IPR006628. PUR_DNA_RNA-bd. [Graphical view] |
| PANTHER | PTHR12611. PTHR12611. 1 hit. |
| Pfam | PF04845. PurA. 1 hit. [Graphical view] |
| SMART | SM00712. PUR. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 342048. |
| SOURCE | Search... |
Entry information
| Entry name | PURG_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8R4E6 Secondary accession number(s): Q14B11, Q8R4E7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
