Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Purine-rich element-binding protein gamma

Gene

Purg

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi54 – 296By similarityAdd BLAST243

GO - Molecular functioni

Keywordsi

Molecular functionDNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Purine-rich element-binding protein gamma
Gene namesi
Name:Purg
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:1922279 Purg

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002559531 – 350Purine-rich element-binding protein gammaAdd BLAST350

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei163PhosphoserineCombined sources1
Modified residuei166PhosphoserineCombined sources1
Modified residuei342PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8R4E6
PeptideAtlasiQ8R4E6
PRIDEiQ8R4E6

PTM databases

iPTMnetiQ8R4E6
PhosphoSitePlusiQ8R4E6

Expressioni

Tissue specificityi

Isoform 1 is expressed in testis. Isoform 2 is expressed in blastocyst and kidney.1 Publication

Gene expression databases

BgeeiENSMUSG00000049184
CleanExiMM_PURG
GenevisibleiQ8R4E6 MM

Interactioni

Protein-protein interaction databases

IntActiQ8R4E6 1 interactor.
MINTiQ8R4E6

Structurei

3D structure databases

ProteinModelPortaliQ8R4E6
SMRiQ8R4E6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi8 – 27Gly-richAdd BLAST20

Sequence similaritiesi

Belongs to the PUR DNA-binding protein family.Curated

Phylogenomic databases

eggNOGiKOG3074 Eukaryota
ENOG410ZKKR LUCA
GeneTreeiENSGT00390000015406
HOGENOMiHOG000232132
HOVERGENiHBG006888
InParanoidiQ8R4E6
KOiK21800
OMAiIGYFGHT
OrthoDBiEOG091G0JS7
PhylomeDBiQ8R4E6
TreeFamiTF313701

Family and domain databases

InterProiView protein in InterPro
IPR006628 PUR-bd_fam
IPR030501 PURgamma
PANTHERiPTHR12611 PTHR12611, 1 hit
PTHR12611:SF3 PTHR12611:SF3, 1 hit
PfamiView protein in Pfam
PF04845 PurA, 1 hit
SMARTiView protein in SMART
SM00712 PUR, 3 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8R4E6-1) [UniParc]FASTAAdd to basket
Also known as: PURG-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MERARRRGGG GSGGGRGRGG KNVGGPGLSK SRLYPQAQHS HYPHYSASAT
60 70 80 90 100
PNQSGGTSEI QELASKRVDI QKKRFYLDVK QSSRGRFLKI AEVWIGRGRQ
110 120 130 140 150
DNIRKSKLTL SLSVAAELKD CLGDFIEHYA HLGLKGHRQE HGQSKEQVSR
160 170 180 190 200
RRQKHSAPSP PVSVGSEEHP HSVLKTDYIE RDNRKYYLDL KENQRGRFLR
210 220 230 240 250
IRQTMMRGTG MIGYFGHSLG QDQTIVLPAQ GMIEFRDALV QLIEDYGEGD
260 270 280 290 300
IEERRCGDDD PLELPEGTSF RVDNKRFYFD VGSNKYGIFL KVSEVRPPYR
310 320 330 340 350
NTITVPFKAW TRFGENFIKY EEEMRKICNS HKEKRMDGRR ASGEEQECLD
Length:350
Mass (Da):39,938
Last modified:June 1, 2002 - v1
Checksum:i983142173937D7D4
GO
Isoform 2 (identifier: Q8R4E6-2) [UniParc]FASTAAdd to basket
Also known as: PURG-A

The sequence of this isoform differs from the canonical sequence as follows:
     292-350: VSEVRPPYRN...ASGEEQECLD → LTNYPKSRENLNLFHCCQTKHKEQPYDTPKTVEE

Show »
Length:325
Mass (Da):36,936
Checksum:i57D07EF6AD8967AD
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti222D → E in AAI16407 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_021320292 – 350VSEVR…QECLD → LTNYPKSRENLNLFHCCQTK HKEQPYDTPKTVEE in isoform 2. 1 PublicationAdd BLAST59

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF479672 mRNA Translation: AAL86450.1
AF479673 mRNA Translation: AAL86451.1
BC116406 mRNA Translation: AAI16407.1
CCDSiCCDS22230.1 [Q8R4E6-1]
CCDS52538.1 [Q8R4E6-2]
RefSeqiNP_001091703.1, NM_001098233.1 [Q8R4E6-2]
NP_690034.1, NM_152821.2 [Q8R4E6-1]
XP_006509269.1, XM_006509206.1 [Q8R4E6-1]
XP_006509272.1, XM_006509209.3 [Q8R4E6-2]
UniGeneiMm.159402

Genome annotation databases

EnsembliENSMUST00000070340; ENSMUSP00000065002; ENSMUSG00000049184 [Q8R4E6-1]
ENSMUST00000078058; ENSMUSP00000077205; ENSMUSG00000049184 [Q8R4E6-2]
GeneIDi75029
KEGGimmu:75029
UCSCiuc009ljx.1 mouse [Q8R4E6-1]
uc009ljy.1 mouse [Q8R4E6-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPURG_MOUSE
AccessioniPrimary (citable) accession number: Q8R4E6
Secondary accession number(s): Q14B11, Q8R4E7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: June 1, 2002
Last modified: March 28, 2018
This is version 104 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome