Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8R4E6

- PURG_MOUSE

UniProt

Q8R4E6 - PURG_MOUSE

Protein

Purine-rich element-binding protein gamma

Gene

Purg

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 79 (01 Oct 2014)
      Sequence version 1 (01 Jun 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi54 – 296243By similarityAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Purine-rich element-binding protein gamma
    Gene namesi
    Name:Purg
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 8

    Organism-specific databases

    MGIiMGI:1922279. Purg.

    Subcellular locationi

    Nucleus By similarity

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 350350Purine-rich element-binding protein gammaPRO_0000255953Add
    BLAST

    Proteomic databases

    PaxDbiQ8R4E6.
    PRIDEiQ8R4E6.

    PTM databases

    PhosphoSiteiQ8R4E6.

    Expressioni

    Tissue specificityi

    Isoform 1 is expressed in testis. Isoform 2 is expressed in blastocyst and kidney.1 Publication

    Gene expression databases

    BgeeiQ8R4E6.
    CleanExiMM_PURG.
    GenevestigatoriQ8R4E6.

    Interactioni

    Protein-protein interaction databases

    IntActiQ8R4E6. 1 interaction.
    MINTiMINT-4119144.
    STRINGi10090.ENSMUSP00000065002.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8R4E6.
    SMRiQ8R4E6. Positions 61-323.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi8 – 2720Gly-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the PUR DNA-binding protein family.Curated

    Phylogenomic databases

    eggNOGiNOG312871.
    GeneTreeiENSGT00390000015406.
    HOGENOMiHOG000232132.
    HOVERGENiHBG006888.
    InParanoidiQ8R4E6.
    OMAiFGHTLGQ.
    OrthoDBiEOG78D7M4.
    PhylomeDBiQ8R4E6.
    TreeFamiTF313701.

    Family and domain databases

    InterProiIPR006628. PUR_DNA_RNA-bd.
    [Graphical view]
    PANTHERiPTHR12611. PTHR12611. 1 hit.
    PfamiPF04845. PurA. 1 hit.
    [Graphical view]
    SMARTiSM00712. PUR. 3 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8R4E6-1) [UniParc]FASTAAdd to Basket

    Also known as: PURG-A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MERARRRGGG GSGGGRGRGG KNVGGPGLSK SRLYPQAQHS HYPHYSASAT    50
    PNQSGGTSEI QELASKRVDI QKKRFYLDVK QSSRGRFLKI AEVWIGRGRQ 100
    DNIRKSKLTL SLSVAAELKD CLGDFIEHYA HLGLKGHRQE HGQSKEQVSR 150
    RRQKHSAPSP PVSVGSEEHP HSVLKTDYIE RDNRKYYLDL KENQRGRFLR 200
    IRQTMMRGTG MIGYFGHSLG QDQTIVLPAQ GMIEFRDALV QLIEDYGEGD 250
    IEERRCGDDD PLELPEGTSF RVDNKRFYFD VGSNKYGIFL KVSEVRPPYR 300
    NTITVPFKAW TRFGENFIKY EEEMRKICNS HKEKRMDGRR ASGEEQECLD 350
    Length:350
    Mass (Da):39,938
    Last modified:June 1, 2002 - v1
    Checksum:i983142173937D7D4
    GO
    Isoform 2 (identifier: Q8R4E6-2) [UniParc]FASTAAdd to Basket

    Also known as: PURG-A

    The sequence of this isoform differs from the canonical sequence as follows:
         292-350: VSEVRPPYRN...ASGEEQECLD → LTNYPKSRENLNLFHCCQTKHKEQPYDTPKTVEE

    Show »
    Length:325
    Mass (Da):36,936
    Checksum:i57D07EF6AD8967AD
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti222 – 2221D → E in AAI16407. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei292 – 35059VSEVR…QECLD → LTNYPKSRENLNLFHCCQTK HKEQPYDTPKTVEE in isoform 2. 1 PublicationVSP_021320Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF479672 mRNA. Translation: AAL86450.1.
    AF479673 mRNA. Translation: AAL86451.1.
    BC116406 mRNA. Translation: AAI16407.1.
    CCDSiCCDS22230.1. [Q8R4E6-1]
    CCDS52538.1. [Q8R4E6-2]
    RefSeqiNP_001091703.1. NM_001098233.1. [Q8R4E6-2]
    NP_690034.1. NM_152821.2. [Q8R4E6-1]
    XP_006509269.1. XM_006509206.1. [Q8R4E6-1]
    XP_006509272.1. XM_006509209.1. [Q8R4E6-2]
    UniGeneiMm.159402.

    Genome annotation databases

    EnsembliENSMUST00000070340; ENSMUSP00000065002; ENSMUSG00000049184. [Q8R4E6-1]
    ENSMUST00000078058; ENSMUSP00000077205; ENSMUSG00000049184. [Q8R4E6-2]
    GeneIDi75029.
    KEGGimmu:75029.
    UCSCiuc009ljx.1. mouse. [Q8R4E6-1]
    uc009ljy.1. mouse. [Q8R4E6-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF479672 mRNA. Translation: AAL86450.1 .
    AF479673 mRNA. Translation: AAL86451.1 .
    BC116406 mRNA. Translation: AAI16407.1 .
    CCDSi CCDS22230.1. [Q8R4E6-1 ]
    CCDS52538.1. [Q8R4E6-2 ]
    RefSeqi NP_001091703.1. NM_001098233.1. [Q8R4E6-2 ]
    NP_690034.1. NM_152821.2. [Q8R4E6-1 ]
    XP_006509269.1. XM_006509206.1. [Q8R4E6-1 ]
    XP_006509272.1. XM_006509209.1. [Q8R4E6-2 ]
    UniGenei Mm.159402.

    3D structure databases

    ProteinModelPortali Q8R4E6.
    SMRi Q8R4E6. Positions 61-323.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q8R4E6. 1 interaction.
    MINTi MINT-4119144.
    STRINGi 10090.ENSMUSP00000065002.

    PTM databases

    PhosphoSitei Q8R4E6.

    Proteomic databases

    PaxDbi Q8R4E6.
    PRIDEi Q8R4E6.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000070340 ; ENSMUSP00000065002 ; ENSMUSG00000049184 . [Q8R4E6-1 ]
    ENSMUST00000078058 ; ENSMUSP00000077205 ; ENSMUSG00000049184 . [Q8R4E6-2 ]
    GeneIDi 75029.
    KEGGi mmu:75029.
    UCSCi uc009ljx.1. mouse. [Q8R4E6-1 ]
    uc009ljy.1. mouse. [Q8R4E6-2 ]

    Organism-specific databases

    CTDi 29942.
    MGIi MGI:1922279. Purg.

    Phylogenomic databases

    eggNOGi NOG312871.
    GeneTreei ENSGT00390000015406.
    HOGENOMi HOG000232132.
    HOVERGENi HBG006888.
    InParanoidi Q8R4E6.
    OMAi FGHTLGQ.
    OrthoDBi EOG78D7M4.
    PhylomeDBi Q8R4E6.
    TreeFami TF313701.

    Miscellaneous databases

    NextBioi 342048.
    PROi Q8R4E6.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8R4E6.
    CleanExi MM_PURG.
    Genevestigatori Q8R4E6.

    Family and domain databases

    InterProi IPR006628. PUR_DNA_RNA-bd.
    [Graphical view ]
    PANTHERi PTHR12611. PTHR12611. 1 hit.
    Pfami PF04845. PurA. 1 hit.
    [Graphical view ]
    SMARTi SM00712. PUR. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Distinct proteins encoded by alternative transcripts of the PURG gene, located contrapodal to WRN on chromosome 8, determined by differential termination/polyadenylation."
      Liu H., Johnson E.M.
      Nucleic Acids Res. 30:2417-2426(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
      Strain: B6D2 x J F1 and C57BL/6J.
      Tissue: Testis.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).

    Entry informationi

    Entry nameiPURG_MOUSE
    AccessioniPrimary (citable) accession number: Q8R4E6
    Secondary accession number(s): Q14B11, Q8R4E7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 31, 2006
    Last sequence update: June 1, 2002
    Last modified: October 1, 2014
    This is version 79 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3