Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8R4E6

- PURG_MOUSE

UniProt

Q8R4E6 - PURG_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Purine-rich element-binding protein gamma

Gene

Purg

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli

Functioni

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi54 – 296243By similarityAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. poly(A) RNA binding Source: Ensembl
Complete GO annotation...

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Purine-rich element-binding protein gamma
Gene namesi
Name:Purg
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 8

Organism-specific databases

MGIiMGI:1922279. Purg.

Subcellular locationi

Nucleus By similarity

GO - Cellular componenti

  1. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 350350Purine-rich element-binding protein gammaPRO_0000255953Add
BLAST

Proteomic databases

MaxQBiQ8R4E6.
PaxDbiQ8R4E6.
PRIDEiQ8R4E6.

PTM databases

PhosphoSiteiQ8R4E6.

Expressioni

Tissue specificityi

Isoform 1 is expressed in testis. Isoform 2 is expressed in blastocyst and kidney.1 Publication

Gene expression databases

BgeeiQ8R4E6.
CleanExiMM_PURG.
GenevestigatoriQ8R4E6.

Interactioni

Protein-protein interaction databases

IntActiQ8R4E6. 1 interaction.
MINTiMINT-4119144.
STRINGi10090.ENSMUSP00000065002.

Structurei

3D structure databases

ProteinModelPortaliQ8R4E6.
SMRiQ8R4E6. Positions 61-323.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi8 – 2720Gly-richAdd
BLAST

Sequence similaritiesi

Belongs to the PUR DNA-binding protein family.Curated

Phylogenomic databases

eggNOGiNOG312871.
GeneTreeiENSGT00390000015406.
HOGENOMiHOG000232132.
HOVERGENiHBG006888.
InParanoidiQ8R4E6.
OMAiFGHTLGQ.
OrthoDBiEOG78D7M4.
PhylomeDBiQ8R4E6.
TreeFamiTF313701.

Family and domain databases

InterProiIPR006628. PUR_DNA_RNA-bd.
[Graphical view]
PANTHERiPTHR12611. PTHR12611. 1 hit.
PfamiPF04845. PurA. 1 hit.
[Graphical view]
SMARTiSM00712. PUR. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8R4E6-1) [UniParc]FASTAAdd to Basket

Also known as: PURG-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MERARRRGGG GSGGGRGRGG KNVGGPGLSK SRLYPQAQHS HYPHYSASAT
60 70 80 90 100
PNQSGGTSEI QELASKRVDI QKKRFYLDVK QSSRGRFLKI AEVWIGRGRQ
110 120 130 140 150
DNIRKSKLTL SLSVAAELKD CLGDFIEHYA HLGLKGHRQE HGQSKEQVSR
160 170 180 190 200
RRQKHSAPSP PVSVGSEEHP HSVLKTDYIE RDNRKYYLDL KENQRGRFLR
210 220 230 240 250
IRQTMMRGTG MIGYFGHSLG QDQTIVLPAQ GMIEFRDALV QLIEDYGEGD
260 270 280 290 300
IEERRCGDDD PLELPEGTSF RVDNKRFYFD VGSNKYGIFL KVSEVRPPYR
310 320 330 340 350
NTITVPFKAW TRFGENFIKY EEEMRKICNS HKEKRMDGRR ASGEEQECLD
Length:350
Mass (Da):39,938
Last modified:June 1, 2002 - v1
Checksum:i983142173937D7D4
GO
Isoform 2 (identifier: Q8R4E6-2) [UniParc]FASTAAdd to Basket

Also known as: PURG-A

The sequence of this isoform differs from the canonical sequence as follows:
     292-350: VSEVRPPYRN...ASGEEQECLD → LTNYPKSRENLNLFHCCQTKHKEQPYDTPKTVEE

Show »
Length:325
Mass (Da):36,936
Checksum:i57D07EF6AD8967AD
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti222 – 2221D → E in AAI16407. (PubMed:15489334)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei292 – 35059VSEVR…QECLD → LTNYPKSRENLNLFHCCQTK HKEQPYDTPKTVEE in isoform 2. 1 PublicationVSP_021320Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF479672 mRNA. Translation: AAL86450.1.
AF479673 mRNA. Translation: AAL86451.1.
BC116406 mRNA. Translation: AAI16407.1.
CCDSiCCDS22230.1. [Q8R4E6-1]
CCDS52538.1. [Q8R4E6-2]
RefSeqiNP_001091703.1. NM_001098233.1. [Q8R4E6-2]
NP_690034.1. NM_152821.2. [Q8R4E6-1]
XP_006509269.1. XM_006509206.1. [Q8R4E6-1]
XP_006509272.1. XM_006509209.1. [Q8R4E6-2]
UniGeneiMm.159402.

Genome annotation databases

EnsembliENSMUST00000070340; ENSMUSP00000065002; ENSMUSG00000049184. [Q8R4E6-1]
ENSMUST00000078058; ENSMUSP00000077205; ENSMUSG00000049184. [Q8R4E6-2]
GeneIDi75029.
KEGGimmu:75029.
UCSCiuc009ljx.1. mouse. [Q8R4E6-1]
uc009ljy.1. mouse. [Q8R4E6-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF479672 mRNA. Translation: AAL86450.1 .
AF479673 mRNA. Translation: AAL86451.1 .
BC116406 mRNA. Translation: AAI16407.1 .
CCDSi CCDS22230.1. [Q8R4E6-1 ]
CCDS52538.1. [Q8R4E6-2 ]
RefSeqi NP_001091703.1. NM_001098233.1. [Q8R4E6-2 ]
NP_690034.1. NM_152821.2. [Q8R4E6-1 ]
XP_006509269.1. XM_006509206.1. [Q8R4E6-1 ]
XP_006509272.1. XM_006509209.1. [Q8R4E6-2 ]
UniGenei Mm.159402.

3D structure databases

ProteinModelPortali Q8R4E6.
SMRi Q8R4E6. Positions 61-323.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q8R4E6. 1 interaction.
MINTi MINT-4119144.
STRINGi 10090.ENSMUSP00000065002.

PTM databases

PhosphoSitei Q8R4E6.

Proteomic databases

MaxQBi Q8R4E6.
PaxDbi Q8R4E6.
PRIDEi Q8R4E6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000070340 ; ENSMUSP00000065002 ; ENSMUSG00000049184 . [Q8R4E6-1 ]
ENSMUST00000078058 ; ENSMUSP00000077205 ; ENSMUSG00000049184 . [Q8R4E6-2 ]
GeneIDi 75029.
KEGGi mmu:75029.
UCSCi uc009ljx.1. mouse. [Q8R4E6-1 ]
uc009ljy.1. mouse. [Q8R4E6-2 ]

Organism-specific databases

CTDi 29942.
MGIi MGI:1922279. Purg.

Phylogenomic databases

eggNOGi NOG312871.
GeneTreei ENSGT00390000015406.
HOGENOMi HOG000232132.
HOVERGENi HBG006888.
InParanoidi Q8R4E6.
OMAi FGHTLGQ.
OrthoDBi EOG78D7M4.
PhylomeDBi Q8R4E6.
TreeFami TF313701.

Miscellaneous databases

ChiTaRSi Purg. mouse.
NextBioi 342048.
PROi Q8R4E6.
SOURCEi Search...

Gene expression databases

Bgeei Q8R4E6.
CleanExi MM_PURG.
Genevestigatori Q8R4E6.

Family and domain databases

InterProi IPR006628. PUR_DNA_RNA-bd.
[Graphical view ]
PANTHERi PTHR12611. PTHR12611. 1 hit.
Pfami PF04845. PurA. 1 hit.
[Graphical view ]
SMARTi SM00712. PUR. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Distinct proteins encoded by alternative transcripts of the PURG gene, located contrapodal to WRN on chromosome 8, determined by differential termination/polyadenylation."
    Liu H., Johnson E.M.
    Nucleic Acids Res. 30:2417-2426(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
    Strain: B6D2 x J F1 and C57BL/6J.
    Tissue: Testis.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).

Entry informationi

Entry nameiPURG_MOUSE
AccessioniPrimary (citable) accession number: Q8R4E6
Secondary accession number(s): Q14B11, Q8R4E7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: June 1, 2002
Last modified: November 26, 2014
This is version 81 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3