Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8R4E6 (PURG_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 76. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Purine-rich element-binding protein gamma
Gene names
Name:Purg
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length350 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Subcellular location

Nucleus By similarity.

Tissue specificity

Isoform 1 is expressed in testis. Isoform 2 is expressed in blastocyst and kidney. Ref.1

Sequence similarities

Belongs to the PUR DNA-binding protein family.

Ontologies

Keywords
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
   LigandDNA-binding
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentnucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionDNA binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8R4E6-1)

Also known as: PURG-A;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8R4E6-2)

Also known as: PURG-A;

The sequence of this isoform differs from the canonical sequence as follows:
     292-350: VSEVRPPYRN...ASGEEQECLD → LTNYPKSRENLNLFHCCQTKHKEQPYDTPKTVEE

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 350350Purine-rich element-binding protein gamma
PRO_0000255953

Regions

DNA binding54 – 296243 By similarity
Compositional bias8 – 2720Gly-rich

Natural variations

Alternative sequence292 – 35059VSEVR…QECLD → LTNYPKSRENLNLFHCCQTK HKEQPYDTPKTVEE in isoform 2.
VSP_021320

Experimental info

Sequence conflict2221D → E in AAI16407. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (PURG-A) [UniParc].

Last modified June 1, 2002. Version 1.
Checksum: 983142173937D7D4

FASTA35039,938
        10         20         30         40         50         60 
MERARRRGGG GSGGGRGRGG KNVGGPGLSK SRLYPQAQHS HYPHYSASAT PNQSGGTSEI 

        70         80         90        100        110        120 
QELASKRVDI QKKRFYLDVK QSSRGRFLKI AEVWIGRGRQ DNIRKSKLTL SLSVAAELKD 

       130        140        150        160        170        180 
CLGDFIEHYA HLGLKGHRQE HGQSKEQVSR RRQKHSAPSP PVSVGSEEHP HSVLKTDYIE 

       190        200        210        220        230        240 
RDNRKYYLDL KENQRGRFLR IRQTMMRGTG MIGYFGHSLG QDQTIVLPAQ GMIEFRDALV 

       250        260        270        280        290        300 
QLIEDYGEGD IEERRCGDDD PLELPEGTSF RVDNKRFYFD VGSNKYGIFL KVSEVRPPYR 

       310        320        330        340        350 
NTITVPFKAW TRFGENFIKY EEEMRKICNS HKEKRMDGRR ASGEEQECLD 

« Hide

Isoform 2 (PURG-A) [UniParc].

Checksum: 57D07EF6AD8967AD
Show »

FASTA32536,936

References

« Hide 'large scale' references
[1]"Distinct proteins encoded by alternative transcripts of the PURG gene, located contrapodal to WRN on chromosome 8, determined by differential termination/polyadenylation."
Liu H., Johnson E.M.
Nucleic Acids Res. 30:2417-2426(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
Strain: B6D2 x J F1 and C57BL/6J.
Tissue: Testis.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF479672 mRNA. Translation: AAL86450.1.
AF479673 mRNA. Translation: AAL86451.1.
BC116406 mRNA. Translation: AAI16407.1.
RefSeqNP_001091703.1. NM_001098233.1.
NP_690034.1. NM_152821.2.
XP_006509269.1. XM_006509206.1.
XP_006509272.1. XM_006509209.1.
UniGeneMm.159402.

3D structure databases

ProteinModelPortalQ8R4E6.
SMRQ8R4E6. Positions 61-323.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ8R4E6. 1 interaction.
MINTMINT-4119144.
STRING10090.ENSMUSP00000065002.

PTM databases

PhosphoSiteQ8R4E6.

Proteomic databases

PaxDbQ8R4E6.
PRIDEQ8R4E6.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000070340; ENSMUSP00000065002; ENSMUSG00000049184. [Q8R4E6-1]
ENSMUST00000078058; ENSMUSP00000077205; ENSMUSG00000049184. [Q8R4E6-2]
GeneID75029.
KEGGmmu:75029.
UCSCuc009ljx.1. mouse. [Q8R4E6-1]
uc009ljy.1. mouse. [Q8R4E6-2]

Organism-specific databases

CTD29942.
MGIMGI:1922279. Purg.

Phylogenomic databases

eggNOGNOG312871.
GeneTreeENSGT00390000015406.
HOGENOMHOG000232132.
HOVERGENHBG006888.
InParanoidQ8R4E6.
OMAFGHTLGQ.
OrthoDBEOG78D7M4.
PhylomeDBQ8R4E6.
TreeFamTF313701.

Gene expression databases

BgeeQ8R4E6.
CleanExMM_PURG.
GenevestigatorQ8R4E6.

Family and domain databases

InterProIPR006628. PUR_DNA_RNA-bd.
[Graphical view]
PANTHERPTHR12611. PTHR12611. 1 hit.
PfamPF04845. PurA. 1 hit.
[Graphical view]
SMARTSM00712. PUR. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

NextBio342048.
PROQ8R4E6.
SOURCESearch...

Entry information

Entry namePURG_MOUSE
AccessionPrimary (citable) accession number: Q8R4E6
Secondary accession number(s): Q14B11, Q8R4E7
Entry history
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: June 1, 2002
Last modified: April 16, 2014
This is version 76 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot