Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8R3Z5

- CACB1_MOUSE

UniProt

Q8R3Z5 - CACB1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Voltage-dependent L-type calcium channel subunit beta-1

Gene

Cacnb1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.By similarity

GO - Molecular functioni

  1. high voltage-gated calcium channel activity Source: MGI
  2. voltage-gated calcium channel activity Source: MGI

GO - Biological processi

  1. calcium ion transport Source: MGI
  2. protein targeting to membrane Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Ion channel, Voltage-gated channel

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

Calcium

Enzyme and pathway databases

ReactomeiREACT_225645. Depolarization of the Presynaptic Terminal Triggers the Opening of Calcium Channels.

Protein family/group databases

TCDBi8.A.22.1.1. the ca(2+) channel auxiliary subunit types 1-4 (cca-) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit beta-1
Short name:
CAB1
Alternative name(s):
Calcium channel voltage-dependent subunit beta 1
Gene namesi
Name:Cacnb1
Synonyms:Cacnlb1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 11

Organism-specific databases

MGIiMGI:102522. Cacnb1.

Subcellular locationi

Cell membranesarcolemma By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity

GO - Cellular componenti

  1. plasma membrane Source: Reactome
  2. sarcoplasmic reticulum Source: MGI
  3. T-tubule Source: MGI
  4. voltage-gated calcium channel complex Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 597597Voltage-dependent L-type calcium channel subunit beta-1PRO_0000144047Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei499 – 4991Phosphothreonine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8R3Z5.
PaxDbiQ8R3Z5.
PRIDEiQ8R3Z5.

PTM databases

PhosphoSiteiQ8R3Z5.

Expressioni

Gene expression databases

BgeeiQ8R3Z5.
ExpressionAtlasiQ8R3Z5. baseline and differential.
GenevestigatoriQ8R3Z5.

Interactioni

Subunit structurei

The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma (By similarity). Interacts with JSRP1. Interacts with RYR1.By similarity2 Publications

Protein-protein interaction databases

BioGridi198439. 3 interactions.
IntActiQ8R3Z5. 4 interactions.
MINTiMINT-1626722.

Structurei

3D structure databases

ProteinModelPortaliQ8R3Z5.
SMRiQ8R3Z5. Positions 58-417.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini100 – 16970SH3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiNOG326500.
GeneTreeiENSGT00390000002740.
HOGENOMiHOG000230979.
HOVERGENiHBG050765.
InParanoidiQ8R3Z5.
KOiK04862.
PhylomeDBiQ8R3Z5.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005443. VDCC_L_b1su.
IPR000584. VDCC_L_bsu.
[Graphical view]
PANTHERiPTHR11824. PTHR11824. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view]
PRINTSiPR01626. LCACHANNELB.
PR01627. LCACHANNELB1.
SMARTiSM00072. GuKc. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8R3Z5-1) [UniParc]FASTAAdd to Basket

Also known as: Beta 1B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVQKSGMSRG PYPPSQEIPM EVFDPSPQGK YSKRKGRFKR SDGSTSSDTT
60 70 80 90 100
SNSFVRQGSA ESYTSRPSDS DVSLEEDREA LRKEAERQAL AQLEKAKTKP
110 120 130 140 150
VAFAVRTNVG YNPSPGDEVP VQGVAITFEP KDFLHIKEKY NNDWWIGRLV
160 170 180 190 200
KEGCEVGFIP SPVKLDSLRL LQEQTLRQNR LSSSKSGDNS SSSLGDVVTG
210 220 230 240 250
TRRPTPPASA KQKQKSTEHV PPYDVVPSMR PIILVGPSLK GYEVTDMMQK
260 270 280 290 300
ALFDFLKHRF DGRISITRVT ADISLAKRSV LNNPSKHIII ERSNTRSSLA
310 320 330 340 350
EVQSEIERIF ELARTLQLVA LDADTINHPA QLSKTSLAPI IVYIKITSPK
360 370 380 390 400
VLQRLIKSRG KSQSKHLNVQ IAASEKLAQC PPEMFDIILD ENQLEDACEH
410 420 430 440 450
LAEYLEAYWK ATHPPSSTPP NPLLNRTMAT AALAASPAPV SNLQGPYLAS
460 470 480 490 500
GDQPLDRATG EHASVHEYPG ELGQPPGLYP SNHPLGRAGT LRALSRQDTF
510 520 530 540 550
DADTPGSRNS AYTEPGDSCV DMETDPSEGP GPGDPAGGGT PPARQGSWED
560 570 580 590
EEDYEEEMTD NRNRGRNKAR YCAEGGGPVL GRNKNELEGW GQGVYTR
Length:597
Mass (Da):65,486
Last modified:June 1, 2002 - v1
Checksum:iB912CEB24A6BAFB9
GO
Isoform 2 (identifier: Q8R3Z5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     210-216: AKQKQKS → GNEMTNFAFELDPLELEEEEAELGEHGGSAKTSVSSVTTPPPHGKRIPFFKK
     444-444: Q → QVQVLTSLRRNLSFWGGLEASPRGGDAVAQPQEHAM

Show »
Length:677
Mass (Da):74,118
Checksum:iC14AB2E0BFD9CC25
GO
Isoform 3 (identifier: Q8R3Z5-3) [UniParc]FASTAAdd to Basket

Also known as: Beta 1C

The sequence of this isoform differs from the canonical sequence as follows:
     445-479: GPYLASGDQPLDRATGEHASVHEYPGELGQPPGLY → VQVLTSLRRNLSFWGGLEASPRGGDAVAQPQEHAM
     480-597: Missing.

Show »
Length:479
Mass (Da):52,947
Checksum:i1050A2010A4BF7D5
GO
Isoform 4 (identifier: Q8R3Z5-4) [UniParc]FASTAAdd to Basket

Also known as: Beta 1A

The sequence of this isoform differs from the canonical sequence as follows:
     210-216: AKQKQKS → GNEMTNFAFELDPLELEEEEAELGEHGGSAKTSVSSVTTPPPHGKRIPFFKK
     480-597: Missing.

Show »
Length:524
Mass (Da):57,718
Checksum:i7E2D857F81CE1EFD
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti485 – 4851L → P in BAC80138. (PubMed:14500989)Curated
Sequence conflicti596 – 5961T → I in BAC80138. (PubMed:14500989)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei210 – 2167AKQKQKS → GNEMTNFAFELDPLELEEEE AELGEHGGSAKTSVSSVTTP PPHGKRIPFFKK in isoform 2 and isoform 4. 1 PublicationVSP_010726
Alternative sequencei444 – 4441Q → QVQVLTSLRRNLSFWGGLEA SPRGGDAVAQPQEHAM in isoform 2. CuratedVSP_010727
Alternative sequencei445 – 47935GPYLA…PPGLY → VQVLTSLRRNLSFWGGLEAS PRGGDAVAQPQEHAM in isoform 3. 1 PublicationVSP_010728Add
BLAST
Alternative sequencei480 – 597118Missing in isoform 3 and isoform 4. 1 PublicationVSP_010729Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF322905 mRNA. Translation: AAG42829.1.
AY094172 mRNA. Translation: AAM11473.1.
AY094173 mRNA. Translation: AAM11474.1.
AB100389 Genomic DNA. Translation: BAC80138.1.
AL591209 Genomic DNA. Translation: CAM20417.1.
AF068898 mRNA. Translation: AAC19386.1.
CCDSiCCDS25335.1. [Q8R3Z5-1]
CCDS48899.1. [Q8R3Z5-3]
RefSeqiNP_001152791.1. NM_001159319.2. [Q8R3Z5-3]
NP_112450.1. NM_031173.4.
UniGeneiMm.41252.

Genome annotation databases

EnsembliENSMUST00000103144; ENSMUSP00000099433; ENSMUSG00000020882.
ENSMUST00000107562; ENSMUSP00000103187; ENSMUSG00000020882. [Q8R3Z5-3]
GeneIDi12295.
KEGGimmu:12295.
UCSCiuc007lfi.2. mouse. [Q8R3Z5-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF322905 mRNA. Translation: AAG42829.1 .
AY094172 mRNA. Translation: AAM11473.1 .
AY094173 mRNA. Translation: AAM11474.1 .
AB100389 Genomic DNA. Translation: BAC80138.1 .
AL591209 Genomic DNA. Translation: CAM20417.1 .
AF068898 mRNA. Translation: AAC19386.1 .
CCDSi CCDS25335.1. [Q8R3Z5-1 ]
CCDS48899.1. [Q8R3Z5-3 ]
RefSeqi NP_001152791.1. NM_001159319.2. [Q8R3Z5-3 ]
NP_112450.1. NM_031173.4.
UniGenei Mm.41252.

3D structure databases

ProteinModelPortali Q8R3Z5.
SMRi Q8R3Z5. Positions 58-417.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 198439. 3 interactions.
IntActi Q8R3Z5. 4 interactions.
MINTi MINT-1626722.

Protein family/group databases

TCDBi 8.A.22.1.1. the ca(2+) channel auxiliary subunit types 1-4 (cca-) family.

PTM databases

PhosphoSitei Q8R3Z5.

Proteomic databases

MaxQBi Q8R3Z5.
PaxDbi Q8R3Z5.
PRIDEi Q8R3Z5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000103144 ; ENSMUSP00000099433 ; ENSMUSG00000020882 .
ENSMUST00000107562 ; ENSMUSP00000103187 ; ENSMUSG00000020882 . [Q8R3Z5-3 ]
GeneIDi 12295.
KEGGi mmu:12295.
UCSCi uc007lfi.2. mouse. [Q8R3Z5-3 ]

Organism-specific databases

CTDi 782.
MGIi MGI:102522. Cacnb1.

Phylogenomic databases

eggNOGi NOG326500.
GeneTreei ENSGT00390000002740.
HOGENOMi HOG000230979.
HOVERGENi HBG050765.
InParanoidi Q8R3Z5.
KOi K04862.
PhylomeDBi Q8R3Z5.

Enzyme and pathway databases

Reactomei REACT_225645. Depolarization of the Presynaptic Terminal Triggers the Opening of Calcium Channels.

Miscellaneous databases

NextBioi 280796.
PROi Q8R3Z5.
SOURCEi Search...

Gene expression databases

Bgeei Q8R3Z5.
ExpressionAtlasi Q8R3Z5. baseline and differential.
Genevestigatori Q8R3Z5.

Family and domain databases

Gene3Di 3.40.50.300. 1 hit.
InterProi IPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005443. VDCC_L_b1su.
IPR000584. VDCC_L_bsu.
[Graphical view ]
PANTHERi PTHR11824. PTHR11824. 1 hit.
Pfami PF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view ]
PRINTSi PR01626. LCACHANNELB.
PR01627. LCACHANNELB1.
SMARTi SM00072. GuKc. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF50044. SSF50044. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEi PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The Mus musculus cDNA sequence of the skeletal muscle beta 1-A isoform of the L-type calcium channel."
    Powers P.A., Ahern C.A., Iacovelli J.
    Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 4).
    Strain: BALB/c.
    Tissue: Skeletal muscle.
  2. "Structures of the murine genes for the beta1- and beta4-Subunits of the voltage-dependent calcium channel."
    Murakami M., Miyoshi I., Suzuki T., Sasano H., Iijima T.
    J. Mol. Neurosci. 21:13-22(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2), ALTERNATIVE SPLICING.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "The mouse voltage-gated calcium channel beta 1 subunit, partial cDNA sequence."
    Hildenbrand J., Ammon H.P.T., Wahl M.A.
    Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 9-109.
    Strain: NMRI.
    Tissue: Brain.
  5. "The junctional SR protein JP-45 affects the functional expression of the voltage-dependent Ca2+ channel Cav1.1."
    Anderson A.A., Altafaj X., Zheng Z., Wang Z.-M., Delbono O., Ronjat M., Treves S., Zorzato F.
    J. Cell Sci. 119:2145-2155(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH JSRP1.
  6. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
    Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
    Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-499, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.
  7. "The beta(1a) subunit of the skeletal DHPR binds to skeletal RyR1 and activates the channel via its 35-residue C-terminal tail."
    Rebbeck R.T., Karunasekara Y., Gallant E.M., Board P.G., Beard N.A., Casarotto M.G., Dulhunty A.F.
    Biophys. J. 100:922-930(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH RYR1.

Entry informationi

Entry nameiCACB1_MOUSE
AccessioniPrimary (citable) accession number: Q8R3Z5
Secondary accession number(s): A2A544
, O88517, Q7TPF2, Q8R3Z6, Q9EPT9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 5, 2004
Last sequence update: June 1, 2002
Last modified: October 29, 2014
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3