Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8R3Z5 (CACB1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 105. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Voltage-dependent L-type calcium channel subunit beta-1

Short name=CAB1
Alternative name(s):
Calcium channel voltage-dependent subunit beta 1
Gene names
Name:Cacnb1
Synonyms:Cacnlb1
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length597 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting By similarity.

Subunit structure

The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma By similarity. Interacts with JSRP1. Interacts with RYR1. Ref.5 Ref.7

Subcellular location

Cell membranesarcolemma; Peripheral membrane protein; Cytoplasmic side By similarity.

Sequence similarities

Belongs to the calcium channel beta subunit family.

Contains 1 SH3 domain.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8R3Z5-1)

Also known as: Beta 1B;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8R3Z5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     210-216: AKQKQKS → GNEMTNFAFELDPLELEEEEAELGEHGGSAKTSVSSVTTPPPHGKRIPFFKK
     444-444: Q → QVQVLTSLRRNLSFWGGLEASPRGGDAVAQPQEHAM
Isoform 3 (identifier: Q8R3Z5-3)

Also known as: Beta 1C;

The sequence of this isoform differs from the canonical sequence as follows:
     445-479: GPYLASGDQPLDRATGEHASVHEYPGELGQPPGLY → VQVLTSLRRNLSFWGGLEASPRGGDAVAQPQEHAM
     480-597: Missing.
Isoform 4 (identifier: Q8R3Z5-4)

Also known as: Beta 1A;

The sequence of this isoform differs from the canonical sequence as follows:
     210-216: AKQKQKS → GNEMTNFAFELDPLELEEEEAELGEHGGSAKTSVSSVTTPPPHGKRIPFFKK
     480-597: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 597597Voltage-dependent L-type calcium channel subunit beta-1
PRO_0000144047

Regions

Domain100 – 16970SH3

Amino acid modifications

Modified residue4991Phosphothreonine Ref.6

Natural variations

Alternative sequence210 – 2167AKQKQKS → GNEMTNFAFELDPLELEEEE AELGEHGGSAKTSVSSVTTP PPHGKRIPFFKK in isoform 2 and isoform 4.
VSP_010726
Alternative sequence4441Q → QVQVLTSLRRNLSFWGGLEA SPRGGDAVAQPQEHAM in isoform 2.
VSP_010727
Alternative sequence445 – 47935GPYLA…PPGLY → VQVLTSLRRNLSFWGGLEAS PRGGDAVAQPQEHAM in isoform 3.
VSP_010728
Alternative sequence480 – 597118Missing in isoform 3 and isoform 4.
VSP_010729

Experimental info

Sequence conflict4851L → P in BAC80138. Ref.2
Sequence conflict5961T → I in BAC80138. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (Beta 1B) [UniParc].

Last modified June 1, 2002. Version 1.
Checksum: B912CEB24A6BAFB9

FASTA59765,486
        10         20         30         40         50         60 
MVQKSGMSRG PYPPSQEIPM EVFDPSPQGK YSKRKGRFKR SDGSTSSDTT SNSFVRQGSA 

        70         80         90        100        110        120 
ESYTSRPSDS DVSLEEDREA LRKEAERQAL AQLEKAKTKP VAFAVRTNVG YNPSPGDEVP 

       130        140        150        160        170        180 
VQGVAITFEP KDFLHIKEKY NNDWWIGRLV KEGCEVGFIP SPVKLDSLRL LQEQTLRQNR 

       190        200        210        220        230        240 
LSSSKSGDNS SSSLGDVVTG TRRPTPPASA KQKQKSTEHV PPYDVVPSMR PIILVGPSLK 

       250        260        270        280        290        300 
GYEVTDMMQK ALFDFLKHRF DGRISITRVT ADISLAKRSV LNNPSKHIII ERSNTRSSLA 

       310        320        330        340        350        360 
EVQSEIERIF ELARTLQLVA LDADTINHPA QLSKTSLAPI IVYIKITSPK VLQRLIKSRG 

       370        380        390        400        410        420 
KSQSKHLNVQ IAASEKLAQC PPEMFDIILD ENQLEDACEH LAEYLEAYWK ATHPPSSTPP 

       430        440        450        460        470        480 
NPLLNRTMAT AALAASPAPV SNLQGPYLAS GDQPLDRATG EHASVHEYPG ELGQPPGLYP 

       490        500        510        520        530        540 
SNHPLGRAGT LRALSRQDTF DADTPGSRNS AYTEPGDSCV DMETDPSEGP GPGDPAGGGT 

       550        560        570        580        590 
PPARQGSWED EEDYEEEMTD NRNRGRNKAR YCAEGGGPVL GRNKNELEGW GQGVYTR 

« Hide

Isoform 2 [UniParc].

Checksum: C14AB2E0BFD9CC25
Show »

FASTA67774,118
Isoform 3 (Beta 1C) [UniParc].

Checksum: 1050A2010A4BF7D5
Show »

FASTA47952,947
Isoform 4 (Beta 1A) [UniParc].

Checksum: 7E2D857F81CE1EFD
Show »

FASTA52457,718

References

« Hide 'large scale' references
[1]"The Mus musculus cDNA sequence of the skeletal muscle beta 1-A isoform of the L-type calcium channel."
Powers P.A., Ahern C.A., Iacovelli J.
Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 4).
Strain: BALB/c.
Tissue: Skeletal muscle.
[2]"Structures of the murine genes for the beta1- and beta4-Subunits of the voltage-dependent calcium channel."
Murakami M., Miyoshi I., Suzuki T., Sasano H., Iijima T.
J. Mol. Neurosci. 21:13-22(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2), ALTERNATIVE SPLICING.
[3]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[4]"The mouse voltage-gated calcium channel beta 1 subunit, partial cDNA sequence."
Hildenbrand J., Ammon H.P.T., Wahl M.A.
Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 9-109.
Strain: NMRI.
Tissue: Brain.
[5]"The junctional SR protein JP-45 affects the functional expression of the voltage-dependent Ca2+ channel Cav1.1."
Anderson A.A., Altafaj X., Zheng Z., Wang Z.-M., Delbono O., Ronjat M., Treves S., Zorzato F.
J. Cell Sci. 119:2145-2155(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH JSRP1.
[6]"Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-499, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Brain.
[7]"The beta(1a) subunit of the skeletal DHPR binds to skeletal RyR1 and activates the channel via its 35-residue C-terminal tail."
Rebbeck R.T., Karunasekara Y., Gallant E.M., Board P.G., Beard N.A., Casarotto M.G., Dulhunty A.F.
Biophys. J. 100:922-930(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH RYR1.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF322905 mRNA. Translation: AAG42829.1.
AY094172 mRNA. Translation: AAM11473.1.
AY094173 mRNA. Translation: AAM11474.1.
AB100389 Genomic DNA. Translation: BAC80138.1.
AL591209 Genomic DNA. Translation: CAM20417.1.
AF068898 mRNA. Translation: AAC19386.1.
CCDSCCDS25335.1. [Q8R3Z5-1]
CCDS48899.1. [Q8R3Z5-3]
RefSeqNP_001152791.1. NM_001159319.2. [Q8R3Z5-3]
NP_112450.1. NM_031173.4.
UniGeneMm.41252.

3D structure databases

ProteinModelPortalQ8R3Z5.
SMRQ8R3Z5. Positions 58-417.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid198439. 3 interactions.
IntActQ8R3Z5. 4 interactions.
MINTMINT-1626722.

Protein family/group databases

TCDB8.A.22.1.1. the ca(2+) channel auxiliary subunit types 1-4 (cca-) family.

PTM databases

PhosphoSiteQ8R3Z5.

Proteomic databases

MaxQBQ8R3Z5.
PaxDbQ8R3Z5.
PRIDEQ8R3Z5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000103144; ENSMUSP00000099433; ENSMUSG00000020882.
ENSMUST00000107562; ENSMUSP00000103187; ENSMUSG00000020882. [Q8R3Z5-3]
GeneID12295.
KEGGmmu:12295.
UCSCuc007lfi.2. mouse. [Q8R3Z5-3]

Organism-specific databases

CTD782.
MGIMGI:102522. Cacnb1.

Phylogenomic databases

eggNOGNOG326500.
GeneTreeENSGT00390000002740.
HOGENOMHOG000230979.
HOVERGENHBG050765.
KOK04862.
PhylomeDBQ8R3Z5.

Enzyme and pathway databases

ReactomeREACT_188576. Developmental Biology.

Gene expression databases

ArrayExpressQ8R3Z5.
BgeeQ8R3Z5.
GenevestigatorQ8R3Z5.

Family and domain databases

Gene3D3.40.50.300. 1 hit.
InterProIPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005443. VDCC_L_b1su.
IPR000584. VDCC_L_bsu.
[Graphical view]
PANTHERPTHR11824. PTHR11824. 1 hit.
PfamPF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view]
PRINTSPR01626. LCACHANNELB.
PR01627. LCACHANNELB1.
SMARTSM00072. GuKc. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMSSF50044. SSF50044. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEPS50002. SH3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio280796.
PROQ8R3Z5.
SOURCESearch...

Entry information

Entry nameCACB1_MOUSE
AccessionPrimary (citable) accession number: Q8R3Z5
Secondary accession number(s): A2A544 expand/collapse secondary AC list , O88517, Q7TPF2, Q8R3Z6, Q9EPT9
Entry history
Integrated into UniProtKB/Swiss-Prot: July 5, 2004
Last sequence update: June 1, 2002
Last modified: July 9, 2014
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot