Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8R3Z5

- CACB1_MOUSE

UniProt

Q8R3Z5 - CACB1_MOUSE

Protein

Voltage-dependent L-type calcium channel subunit beta-1

Gene

Cacnb1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 107 (01 Oct 2014)
      Sequence version 1 (01 Jun 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.By similarity

    GO - Molecular functioni

    1. high voltage-gated calcium channel activity Source: MGI
    2. protein binding Source: MGI
    3. voltage-gated calcium channel activity Source: MGI

    GO - Biological processi

    1. calcium ion transport Source: MGI
    2. protein targeting to membrane Source: MGI

    Keywords - Molecular functioni

    Calcium channel, Ion channel, Voltage-gated channel

    Keywords - Biological processi

    Calcium transport, Ion transport, Transport

    Keywords - Ligandi

    Calcium

    Enzyme and pathway databases

    ReactomeiREACT_225645. Depolarization of the Presynaptic Terminal Triggers the Opening of Calcium Channels.

    Protein family/group databases

    TCDBi8.A.22.1.1. the ca(2+) channel auxiliary subunit types 1-4 (cca-) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Voltage-dependent L-type calcium channel subunit beta-1
    Short name:
    CAB1
    Alternative name(s):
    Calcium channel voltage-dependent subunit beta 1
    Gene namesi
    Name:Cacnb1
    Synonyms:Cacnlb1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 11

    Organism-specific databases

    MGIiMGI:102522. Cacnb1.

    Subcellular locationi

    Cell membranesarcolemma By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity

    GO - Cellular componenti

    1. plasma membrane Source: Reactome
    2. sarcoplasmic reticulum Source: MGI
    3. T-tubule Source: MGI
    4. voltage-gated calcium channel complex Source: MGI

    Keywords - Cellular componenti

    Cell membrane, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 597597Voltage-dependent L-type calcium channel subunit beta-1PRO_0000144047Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei499 – 4991Phosphothreonine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ8R3Z5.
    PaxDbiQ8R3Z5.
    PRIDEiQ8R3Z5.

    PTM databases

    PhosphoSiteiQ8R3Z5.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8R3Z5.
    BgeeiQ8R3Z5.
    GenevestigatoriQ8R3Z5.

    Interactioni

    Subunit structurei

    The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma By similarity. Interacts with JSRP1. Interacts with RYR1.By similarity2 Publications

    Protein-protein interaction databases

    BioGridi198439. 3 interactions.
    IntActiQ8R3Z5. 4 interactions.
    MINTiMINT-1626722.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8R3Z5.
    SMRiQ8R3Z5. Positions 58-417.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini100 – 16970SH3PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 SH3 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    SH3 domain

    Phylogenomic databases

    eggNOGiNOG326500.
    GeneTreeiENSGT00390000002740.
    HOGENOMiHOG000230979.
    HOVERGENiHBG050765.
    KOiK04862.
    PhylomeDBiQ8R3Z5.

    Family and domain databases

    Gene3Di3.40.50.300. 1 hit.
    InterProiIPR008145. GK/Ca_channel_bsu.
    IPR027417. P-loop_NTPase.
    IPR001452. SH3_domain.
    IPR005443. VDCC_L_b1su.
    IPR000584. VDCC_L_bsu.
    [Graphical view]
    PANTHERiPTHR11824. PTHR11824. 1 hit.
    PfamiPF00625. Guanylate_kin. 1 hit.
    PF12052. VGCC_beta4Aa_N. 1 hit.
    [Graphical view]
    PRINTSiPR01626. LCACHANNELB.
    PR01627. LCACHANNELB1.
    SMARTiSM00072. GuKc. 1 hit.
    SM00326. SH3. 1 hit.
    [Graphical view]
    SUPFAMiSSF50044. SSF50044. 1 hit.
    SSF52540. SSF52540. 1 hit.
    PROSITEiPS50002. SH3. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8R3Z5-1) [UniParc]FASTAAdd to Basket

    Also known as: Beta 1B

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVQKSGMSRG PYPPSQEIPM EVFDPSPQGK YSKRKGRFKR SDGSTSSDTT    50
    SNSFVRQGSA ESYTSRPSDS DVSLEEDREA LRKEAERQAL AQLEKAKTKP 100
    VAFAVRTNVG YNPSPGDEVP VQGVAITFEP KDFLHIKEKY NNDWWIGRLV 150
    KEGCEVGFIP SPVKLDSLRL LQEQTLRQNR LSSSKSGDNS SSSLGDVVTG 200
    TRRPTPPASA KQKQKSTEHV PPYDVVPSMR PIILVGPSLK GYEVTDMMQK 250
    ALFDFLKHRF DGRISITRVT ADISLAKRSV LNNPSKHIII ERSNTRSSLA 300
    EVQSEIERIF ELARTLQLVA LDADTINHPA QLSKTSLAPI IVYIKITSPK 350
    VLQRLIKSRG KSQSKHLNVQ IAASEKLAQC PPEMFDIILD ENQLEDACEH 400
    LAEYLEAYWK ATHPPSSTPP NPLLNRTMAT AALAASPAPV SNLQGPYLAS 450
    GDQPLDRATG EHASVHEYPG ELGQPPGLYP SNHPLGRAGT LRALSRQDTF 500
    DADTPGSRNS AYTEPGDSCV DMETDPSEGP GPGDPAGGGT PPARQGSWED 550
    EEDYEEEMTD NRNRGRNKAR YCAEGGGPVL GRNKNELEGW GQGVYTR 597
    Length:597
    Mass (Da):65,486
    Last modified:June 1, 2002 - v1
    Checksum:iB912CEB24A6BAFB9
    GO
    Isoform 2 (identifier: Q8R3Z5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         210-216: AKQKQKS → GNEMTNFAFELDPLELEEEEAELGEHGGSAKTSVSSVTTPPPHGKRIPFFKK
         444-444: Q → QVQVLTSLRRNLSFWGGLEASPRGGDAVAQPQEHAM

    Show »
    Length:677
    Mass (Da):74,118
    Checksum:iC14AB2E0BFD9CC25
    GO
    Isoform 3 (identifier: Q8R3Z5-3) [UniParc]FASTAAdd to Basket

    Also known as: Beta 1C

    The sequence of this isoform differs from the canonical sequence as follows:
         445-479: GPYLASGDQPLDRATGEHASVHEYPGELGQPPGLY → VQVLTSLRRNLSFWGGLEASPRGGDAVAQPQEHAM
         480-597: Missing.

    Show »
    Length:479
    Mass (Da):52,947
    Checksum:i1050A2010A4BF7D5
    GO
    Isoform 4 (identifier: Q8R3Z5-4) [UniParc]FASTAAdd to Basket

    Also known as: Beta 1A

    The sequence of this isoform differs from the canonical sequence as follows:
         210-216: AKQKQKS → GNEMTNFAFELDPLELEEEEAELGEHGGSAKTSVSSVTTPPPHGKRIPFFKK
         480-597: Missing.

    Show »
    Length:524
    Mass (Da):57,718
    Checksum:i7E2D857F81CE1EFD
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti485 – 4851L → P in BAC80138. (PubMed:14500989)Curated
    Sequence conflicti596 – 5961T → I in BAC80138. (PubMed:14500989)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei210 – 2167AKQKQKS → GNEMTNFAFELDPLELEEEE AELGEHGGSAKTSVSSVTTP PPHGKRIPFFKK in isoform 2 and isoform 4. 1 PublicationVSP_010726
    Alternative sequencei444 – 4441Q → QVQVLTSLRRNLSFWGGLEA SPRGGDAVAQPQEHAM in isoform 2. CuratedVSP_010727
    Alternative sequencei445 – 47935GPYLA…PPGLY → VQVLTSLRRNLSFWGGLEAS PRGGDAVAQPQEHAM in isoform 3. 1 PublicationVSP_010728Add
    BLAST
    Alternative sequencei480 – 597118Missing in isoform 3 and isoform 4. 1 PublicationVSP_010729Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF322905 mRNA. Translation: AAG42829.1.
    AY094172 mRNA. Translation: AAM11473.1.
    AY094173 mRNA. Translation: AAM11474.1.
    AB100389 Genomic DNA. Translation: BAC80138.1.
    AL591209 Genomic DNA. Translation: CAM20417.1.
    AF068898 mRNA. Translation: AAC19386.1.
    CCDSiCCDS25335.1. [Q8R3Z5-1]
    CCDS48899.1. [Q8R3Z5-3]
    RefSeqiNP_001152791.1. NM_001159319.2. [Q8R3Z5-3]
    NP_112450.1. NM_031173.4.
    UniGeneiMm.41252.

    Genome annotation databases

    EnsembliENSMUST00000103144; ENSMUSP00000099433; ENSMUSG00000020882.
    ENSMUST00000107562; ENSMUSP00000103187; ENSMUSG00000020882. [Q8R3Z5-3]
    GeneIDi12295.
    KEGGimmu:12295.
    UCSCiuc007lfi.2. mouse. [Q8R3Z5-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF322905 mRNA. Translation: AAG42829.1 .
    AY094172 mRNA. Translation: AAM11473.1 .
    AY094173 mRNA. Translation: AAM11474.1 .
    AB100389 Genomic DNA. Translation: BAC80138.1 .
    AL591209 Genomic DNA. Translation: CAM20417.1 .
    AF068898 mRNA. Translation: AAC19386.1 .
    CCDSi CCDS25335.1. [Q8R3Z5-1 ]
    CCDS48899.1. [Q8R3Z5-3 ]
    RefSeqi NP_001152791.1. NM_001159319.2. [Q8R3Z5-3 ]
    NP_112450.1. NM_031173.4.
    UniGenei Mm.41252.

    3D structure databases

    ProteinModelPortali Q8R3Z5.
    SMRi Q8R3Z5. Positions 58-417.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 198439. 3 interactions.
    IntActi Q8R3Z5. 4 interactions.
    MINTi MINT-1626722.

    Protein family/group databases

    TCDBi 8.A.22.1.1. the ca(2+) channel auxiliary subunit types 1-4 (cca-) family.

    PTM databases

    PhosphoSitei Q8R3Z5.

    Proteomic databases

    MaxQBi Q8R3Z5.
    PaxDbi Q8R3Z5.
    PRIDEi Q8R3Z5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000103144 ; ENSMUSP00000099433 ; ENSMUSG00000020882 .
    ENSMUST00000107562 ; ENSMUSP00000103187 ; ENSMUSG00000020882 . [Q8R3Z5-3 ]
    GeneIDi 12295.
    KEGGi mmu:12295.
    UCSCi uc007lfi.2. mouse. [Q8R3Z5-3 ]

    Organism-specific databases

    CTDi 782.
    MGIi MGI:102522. Cacnb1.

    Phylogenomic databases

    eggNOGi NOG326500.
    GeneTreei ENSGT00390000002740.
    HOGENOMi HOG000230979.
    HOVERGENi HBG050765.
    KOi K04862.
    PhylomeDBi Q8R3Z5.

    Enzyme and pathway databases

    Reactomei REACT_225645. Depolarization of the Presynaptic Terminal Triggers the Opening of Calcium Channels.

    Miscellaneous databases

    NextBioi 280796.
    PROi Q8R3Z5.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8R3Z5.
    Bgeei Q8R3Z5.
    Genevestigatori Q8R3Z5.

    Family and domain databases

    Gene3Di 3.40.50.300. 1 hit.
    InterProi IPR008145. GK/Ca_channel_bsu.
    IPR027417. P-loop_NTPase.
    IPR001452. SH3_domain.
    IPR005443. VDCC_L_b1su.
    IPR000584. VDCC_L_bsu.
    [Graphical view ]
    PANTHERi PTHR11824. PTHR11824. 1 hit.
    Pfami PF00625. Guanylate_kin. 1 hit.
    PF12052. VGCC_beta4Aa_N. 1 hit.
    [Graphical view ]
    PRINTSi PR01626. LCACHANNELB.
    PR01627. LCACHANNELB1.
    SMARTi SM00072. GuKc. 1 hit.
    SM00326. SH3. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50044. SSF50044. 1 hit.
    SSF52540. SSF52540. 1 hit.
    PROSITEi PS50002. SH3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The Mus musculus cDNA sequence of the skeletal muscle beta 1-A isoform of the L-type calcium channel."
      Powers P.A., Ahern C.A., Iacovelli J.
      Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 4).
      Strain: BALB/c.
      Tissue: Skeletal muscle.
    2. "Structures of the murine genes for the beta1- and beta4-Subunits of the voltage-dependent calcium channel."
      Murakami M., Miyoshi I., Suzuki T., Sasano H., Iijima T.
      J. Mol. Neurosci. 21:13-22(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2), ALTERNATIVE SPLICING.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    4. "The mouse voltage-gated calcium channel beta 1 subunit, partial cDNA sequence."
      Hildenbrand J., Ammon H.P.T., Wahl M.A.
      Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 9-109.
      Strain: NMRI.
      Tissue: Brain.
    5. "The junctional SR protein JP-45 affects the functional expression of the voltage-dependent Ca2+ channel Cav1.1."
      Anderson A.A., Altafaj X., Zheng Z., Wang Z.-M., Delbono O., Ronjat M., Treves S., Zorzato F.
      J. Cell Sci. 119:2145-2155(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH JSRP1.
    6. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
      Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
      Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-499, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain.
    7. "The beta(1a) subunit of the skeletal DHPR binds to skeletal RyR1 and activates the channel via its 35-residue C-terminal tail."
      Rebbeck R.T., Karunasekara Y., Gallant E.M., Board P.G., Beard N.A., Casarotto M.G., Dulhunty A.F.
      Biophys. J. 100:922-930(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH RYR1.

    Entry informationi

    Entry nameiCACB1_MOUSE
    AccessioniPrimary (citable) accession number: Q8R3Z5
    Secondary accession number(s): A2A544
    , O88517, Q7TPF2, Q8R3Z6, Q9EPT9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 5, 2004
    Last sequence update: June 1, 2002
    Last modified: October 1, 2014
    This is version 107 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3