Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Voltage-dependent L-type calcium channel subunit beta-1

Gene

Cacnb1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.By similarity

GO - Molecular functioni

  • high voltage-gated calcium channel activity Source: MGI
  • voltage-gated calcium channel activity Source: MGI

GO - Biological processi

Keywordsi

Molecular functionCalcium channel, Ion channel, Voltage-gated channel
Biological processCalcium transport, Ion transport, Transport
LigandCalcium

Enzyme and pathway databases

ReactomeiR-MMU-112308 Presynaptic depolarization and calcium channel opening
R-MMU-5576892 Phase 0 - rapid depolarisation
R-MMU-5576893 Phase 2 - plateau phase

Protein family/group databases

TCDBi8.A.22.1.1 the ca(2+) channel auxiliary subunit Beta types 1-4 (cca-Beta) family

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit beta-1
Short name:
CAB1
Alternative name(s):
Calcium channel voltage-dependent subunit beta 1
Gene namesi
Name:Cacnb1
Synonyms:Cacnlb1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:102522 Cacnb1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001440471 – 597Voltage-dependent L-type calcium channel subunit beta-1Add BLAST597

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei44PhosphoserineBy similarity1
Modified residuei47PhosphoserineBy similarity1
Modified residuei73PhosphoserineBy similarity1
Modified residuei186PhosphoserineCombined sources1
Modified residuei193PhosphoserineBy similarity1
Modified residuei499PhosphothreonineCombined sources1
Modified residuei547PhosphoserineCombined sources1
Isoform 2 (identifier: Q8R3Z5-2)
Modified residuei205PhosphothreonineCombined sources1
Modified residuei501PhosphoserineCombined sources1
Isoform 4 (identifier: Q8R3Z5-4)
Modified residuei205PhosphothreonineCombined sources1
Isoform 3 (identifier: Q8R3Z5-3)
Modified residuei456PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8R3Z5
PRIDEiQ8R3Z5

PTM databases

iPTMnetiQ8R3Z5
PhosphoSitePlusiQ8R3Z5

Expressioni

Gene expression databases

BgeeiENSMUSG00000020882
ExpressionAtlasiQ8R3Z5 baseline and differential
GenevisibleiQ8R3Z5 MM

Interactioni

Subunit structurei

The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma (By similarity). Interacts with JSRP1. Interacts with RYR1. Interacts with CBARP.By similarity3 Publications

Protein-protein interaction databases

BioGridi198439, 5 interactors
IntActiQ8R3Z5, 6 interactors
MINTiQ8R3Z5
STRINGi10090.ENSMUSP00000017552

Structurei

Secondary structure

1597
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi79 – 96Combined sources18
Beta strandi103 – 109Combined sources7
Helixi115 – 117Combined sources3
Beta strandi133 – 139Combined sources7
Beta strandi141 – 151Combined sources11
Beta strandi157 – 160Combined sources4
Helixi162 – 179Combined sources18
Beta strandi222 – 226Combined sources5
Beta strandi232 – 235Combined sources4
Helixi243 – 259Combined sources17
Turni260 – 262Combined sources3
Beta strandi263 – 268Combined sources6
Helixi273 – 275Combined sources3
Helixi278 – 282Combined sources5
Helixi284 – 287Combined sources4
Helixi299 – 313Combined sources15
Beta strandi318 – 322Combined sources5
Helixi329 – 331Combined sources3
Turni332 – 334Combined sources3
Beta strandi340 – 344Combined sources5
Helixi349 – 358Combined sources10
Helixi361 – 364Combined sources4
Helixi367 – 379Combined sources13
Helixi382 – 384Combined sources3
Beta strandi386 – 389Combined sources4
Helixi394 – 412Combined sources19

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4ZW2X-ray1.86A68-185[»]
A216-417[»]
ProteinModelPortaliQ8R3Z5
SMRiQ8R3Z5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini100 – 169SH3PROSITE-ProRule annotationAdd BLAST70

Sequence similaritiesi

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiKOG3812 Eukaryota
ENOG410XRDI LUCA
GeneTreeiENSGT00390000002740
HOGENOMiHOG000230979
HOVERGENiHBG050765
InParanoidiQ8R3Z5
KOiK04862
PhylomeDBiQ8R3Z5

Family and domain databases

InterProiView protein in InterPro
IPR008145 GK/Ca_channel_bsu
IPR027417 P-loop_NTPase
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR005443 VDCC_L_b1su
IPR000584 VDCC_L_bsu
PANTHERiPTHR11824 PTHR11824, 1 hit
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF12052 VGCC_beta4Aa_N, 1 hit
PRINTSiPR01626 LCACHANNELB
PR01627 LCACHANNELB1
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8R3Z5-1) [UniParc]FASTAAdd to basket
Also known as: Beta 1B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVQKSGMSRG PYPPSQEIPM EVFDPSPQGK YSKRKGRFKR SDGSTSSDTT
60 70 80 90 100
SNSFVRQGSA ESYTSRPSDS DVSLEEDREA LRKEAERQAL AQLEKAKTKP
110 120 130 140 150
VAFAVRTNVG YNPSPGDEVP VQGVAITFEP KDFLHIKEKY NNDWWIGRLV
160 170 180 190 200
KEGCEVGFIP SPVKLDSLRL LQEQTLRQNR LSSSKSGDNS SSSLGDVVTG
210 220 230 240 250
TRRPTPPASA KQKQKSTEHV PPYDVVPSMR PIILVGPSLK GYEVTDMMQK
260 270 280 290 300
ALFDFLKHRF DGRISITRVT ADISLAKRSV LNNPSKHIII ERSNTRSSLA
310 320 330 340 350
EVQSEIERIF ELARTLQLVA LDADTINHPA QLSKTSLAPI IVYIKITSPK
360 370 380 390 400
VLQRLIKSRG KSQSKHLNVQ IAASEKLAQC PPEMFDIILD ENQLEDACEH
410 420 430 440 450
LAEYLEAYWK ATHPPSSTPP NPLLNRTMAT AALAASPAPV SNLQGPYLAS
460 470 480 490 500
GDQPLDRATG EHASVHEYPG ELGQPPGLYP SNHPLGRAGT LRALSRQDTF
510 520 530 540 550
DADTPGSRNS AYTEPGDSCV DMETDPSEGP GPGDPAGGGT PPARQGSWED
560 570 580 590
EEDYEEEMTD NRNRGRNKAR YCAEGGGPVL GRNKNELEGW GQGVYTR
Length:597
Mass (Da):65,486
Last modified:June 1, 2002 - v1
Checksum:iB912CEB24A6BAFB9
GO
Isoform 2 (identifier: Q8R3Z5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     210-216: AKQKQKS → GNEMTNFAFELDPLELEEEEAELGEHGGSAKTSVSSVTTPPPHGKRIPFFKK
     444-444: Q → QVQVLTSLRRNLSFWGGLEASPRGGDAVAQPQEHAM

Show »
Length:677
Mass (Da):74,118
Checksum:iC14AB2E0BFD9CC25
GO
Isoform 3 (identifier: Q8R3Z5-3) [UniParc]FASTAAdd to basket
Also known as: Beta 1C

The sequence of this isoform differs from the canonical sequence as follows:
     445-479: GPYLASGDQPLDRATGEHASVHEYPGELGQPPGLY → VQVLTSLRRNLSFWGGLEASPRGGDAVAQPQEHAM
     480-597: Missing.

Show »
Length:479
Mass (Da):52,947
Checksum:i1050A2010A4BF7D5
GO
Isoform 4 (identifier: Q8R3Z5-4) [UniParc]FASTAAdd to basket
Also known as: Beta 1A

The sequence of this isoform differs from the canonical sequence as follows:
     210-216: AKQKQKS → GNEMTNFAFELDPLELEEEEAELGEHGGSAKTSVSSVTTPPPHGKRIPFFKK
     480-597: Missing.

Show »
Length:524
Mass (Da):57,718
Checksum:i7E2D857F81CE1EFD
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti485L → P in BAC80138 (PubMed:14500989).Curated1
Sequence conflicti596T → I in BAC80138 (PubMed:14500989).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_010726210 – 216AKQKQKS → GNEMTNFAFELDPLELEEEE AELGEHGGSAKTSVSSVTTP PPHGKRIPFFKK in isoform 2 and isoform 4. 1 Publication7
Alternative sequenceiVSP_010727444Q → QVQVLTSLRRNLSFWGGLEA SPRGGDAVAQPQEHAM in isoform 2. Curated1
Alternative sequenceiVSP_010728445 – 479GPYLA…PPGLY → VQVLTSLRRNLSFWGGLEAS PRGGDAVAQPQEHAM in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_010729480 – 597Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST118

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF322905 mRNA Translation: AAG42829.1
AY094172 mRNA Translation: AAM11473.1
AY094173 mRNA Translation: AAM11474.1
AB100389 Genomic DNA Translation: BAC80138.1
AL591209 Genomic DNA Translation: CAM20417.1
AF068898 mRNA Translation: AAC19386.1
CCDSiCCDS25335.1 [Q8R3Z5-1]
CCDS48899.1 [Q8R3Z5-3]
RefSeqiNP_001152791.1, NM_001159319.2 [Q8R3Z5-3]
NP_112450.1, NM_031173.4
UniGeneiMm.41252

Genome annotation databases

EnsembliENSMUST00000107562; ENSMUSP00000103187; ENSMUSG00000020882 [Q8R3Z5-3]
GeneIDi12295
KEGGimmu:12295
UCSCiuc007lfi.2 mouse [Q8R3Z5-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCACB1_MOUSE
AccessioniPrimary (citable) accession number: Q8R3Z5
Secondary accession number(s): A2A544
, O88517, Q7TPF2, Q8R3Z6, Q9EPT9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2004
Last sequence update: June 1, 2002
Last modified: March 28, 2018
This is version 138 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health