Reviewed,
UniProtKB/Swiss-Prot Q8R3Z5 (CACB1_MOUSE)
Last modified
May 26, 2009.
Version 60.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Voltage-dependent L-type calcium channel subunit beta-1 Short name=CAB1 Alternative name(s): Calcium channel voltage-dependent subunit beta 1 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 597 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting By similarity. |
| Subunit structure | The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma By similarity. Interacts with JSRP1. |
| Subcellular location | Cell membrane › sarcolemma; Peripheral membrane protein; Cytoplasmic side By similarity. |
| Sequence similarities | Belongs to the calcium channel beta subunit family. Contains 1 SH3 domain. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8R3Z5-1) Also known as: Beta 1B; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8R3Z5-2) The sequence of this isoform differs from the canonical sequence as follows: 210-216: AKQKQKS → GNEMTNFAFELDPLELEEEEAELGEHGGSAKTSVSSVTTPPPHGKRIPFFKK 444-444: Q → QVQVLTSLRRNLSFWGGLEASPRGGDAVAQPQEHAM | ||||||
| Isoform 3 (identifier: Q8R3Z5-3) Also known as: Beta 1C; The sequence of this isoform differs from the canonical sequence as follows: 445-479: GPYLASGDQPLDRATGEHASVHEYPGELGQPPGLY → VQVLTSLRRNLSFWGGLEASPRGGDAVAQPQEHAM 480-597: Missing. | ||||||
| Isoform 4 (identifier: Q8R3Z5-4) Also known as: Beta 1A; The sequence of this isoform differs from the canonical sequence as follows: 210-216: AKQKQKS → GNEMTNFAFELDPLELEEEEAELGEHGGSAKTSVSSVTTPPPHGKRIPFFKK 480-597: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 597 | 597 | Voltage-dependent L-type calcium channel subunit beta-1 | PRO_0000144047 | |||||
Regions | |||||||||
| Domain | 100 – 169 | 70 | SH3 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 186 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 418 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 499 | 1 | Phosphothreonine Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 210 – 216 | 7 | AKQKQKS → GNEMTNFAFELDPLELEEEE AELGEHGGSAKTSVSSVTTP PPHGKRIPFFKK in isoform 2 and isoform 4. | VSP_010726 | |||||
| Alternative sequence | 444 | 1 | Q → QVQVLTSLRRNLSFWGGLEA SPRGGDAVAQPQEHAM in isoform 2. | VSP_010727 | |||||
| Alternative sequence | 445 – 479 | 35 | GPYLA…PPGLY → VQVLTSLRRNLSFWGGLEAS PRGGDAVAQPQEHAM in isoform 3. | VSP_010728 | |||||
| Alternative sequence | 480 – 597 | 118 | Missing in isoform 3 and isoform 4. | VSP_010729 | |||||
Experimental info | |||||||||
| Sequence conflict | 485 | 1 | L → P in BAC80138. Ref.2 | ||||||
| Sequence conflict | 596 | 1 | T → I in BAC80138. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The Mus musculus cDNA sequence of the skeletal muscle beta 1-A isoform of the L-type calcium channel." Powers P.A., Ahern C.A., Iacovelli J. Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS 1; 3 AND 4). Strain: BALB/c. Tissue: Skeletal muscle. |
| [2] | "Structures of the murine genes for the beta1- and beta4-Subunits of the voltage-dependent calcium channel." Murakami M., Miyoshi I., Suzuki T., Sasano H., Iijima T. J. Mol. Neurosci. 21:13-22(2003) [PubMed: 14500989] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 2), ALTERNATIVE SPLICING. |
| [3] | "The mouse voltage-gated calcium channel beta 1 subunit, partial cDNA sequence." Hildenbrand J., Ammon H.P.T., Wahl M.A. Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE OF 9-109. Strain: NMRI. Tissue: Brain. |
| [4] | "The junctional SR protein JP-45 affects the functional expression of the voltage-dependent Ca2+ channel Cav1.1." Anderson A.A., Altafaj X., Zheng Z., Wang Z.-M., Delbono O., Ronjat M., Treves S., Zorzato F. J. Cell Sci. 119:2145-2155(2006) [PubMed: 16638807] [Abstract] Cited for: INTERACTION WITH JSRP1. |
| [5] | "Comprehensive identification of phosphorylation sites in postsynaptic density preparations." Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L. Mol. Cell. Proteomics 5:914-922(2006) [PubMed: 16452087] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-499, MASS SPECTROMETRY. Tissue: Brain. |
| [6] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed: 17114649] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-186, MASS SPECTROMETRY. Tissue: Brain cortex. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF322905 mRNA. Translation: AAG42829.1. AY094172 mRNA. Translation: AAM11473.1. AY094173 mRNA. Translation: AAM11474.1. AB100389 Genomic DNA. Translation: BAC80138.1. AF068898 mRNA. Translation: AAC19386.1. | |
| IPI | IPI00321850. IPI00421276. IPI00421277. IPI00421278. |
| UniGene | Mm.41252 |
3D structure databases | |
| SMR | Q8R3Z5. Positions 74-417. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8R3Z5. 2 interactions. |
Protein family/group databases | |
| TCDB | 8.A.22.1.1. Ca2+ channel auxiliary subunit beta types 1-4 (CCA-beta) family. |
PTM databases | |
| PhosphoSite | Q8R3Z5. |
Proteomic databases | |
| PRIDE | Q8R3Z5. |
Genome annotation databases | |
| Ensembl | ENSMUSG00000020882. Mus musculus. [Contig view] |
Organism-specific databases | |
| MGI | MGI:102522. Cacnb1. |
Phylogenomic databases | |
| HOGENOM | Q8R3Z5. |
| HOVERGEN | Q8R3Z5. |
Gene expression databases | |
| ArrayExpress | Q8R3Z5. |
| Bgee | Q8R3Z5. |
| GermOnline | ENSMUSG00000020882. Mus musculus. |
Family and domain databases | |
| InterPro | IPR008145. Guanylt/Ca. IPR001452. SH3_domain. IPR005443. VDCC_L_b1su. IPR000584. VDCC_L_bsu. [Graphical view] |
| PANTHER | PTHR11824. Ca_channel_B. 1 hit. |
| Pfam | PF00774. Ca_channel_B. 1 hit. PF00018. SH3_1. 1 hit. [Graphical view] |
| PRINTS | PR01626. LCACHANNELB. PR01627. LCACHANNELB1. |
| ProDom | PD000066. SH3. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00072. GuKc. 1 hit. SM00326. SH3. 1 hit. [Graphical view] |
| PROSITE | PS50002. SH3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 280796. |
| SOURCE | Search... |
Entry information
| Entry name | CACB1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8R3Z5 Secondary accession number(s): O88517 Q9EPT9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


