Q8R3C6 (RBM19_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 94.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Probable RNA-binding protein 19 Alternative name(s): RNA-binding motif protein 19 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 952 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role in embryo pre-implantation development. Ref.4 |
| Subcellular location | Nucleus › nucleolus. Nucleus › nucleoplasm. Cytoplasm. Chromosome. Note: Colocalizes with NPM1 during interphase. By late prophase, metaphase, anaphase and telophase, associates with the chromosome periphery. By telophase localizes to nucleolar precursor body (NPB) By similarity. In discrete foci distributed throughout the cytoplasm and nucleoplasm during the 4 to 8 cell stages and the morula stage, but not in the periphery of the NPB. During blastocyst development, becomes increasingly localized to the nucleolus and less to the cytoplasm. At the late blastocyst stage, localized predominantly in the nucleolus. Localized in the nucleolus during interphase and to the perichromosomal sheath during mitosis. Does not colocalize in the cytoplasm with GW182 in P-bodies. May translocate to the nucleolus upon early embryonic development. Ref.3 Ref.4 |
| Tissue specificity | Expressed in the crypts of Lieberkuhn of the intestine (at protein level). Ref.3 |
| Developmental stage | Expressed during early development. Expressed in the epithelium of the embryonic gut tube (at protein level). Ref.3 |
| Disruption phenotype | Arrests embryonic development prior to implantation. Embryos at 3.5 dpc lack the mature, tripartite nucleoli, but instead, contain spheres resembling nucleolar precursor body (NPB), indicating arrest of nucleologenesis. Ref.4 |
| Sequence similarities | Belongs to the RRM MRD1 family. Contains 6 RRM (RNA recognition motif) domains. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Chromosome Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Ligand | RNA-binding |
| Molecular function | Developmental protein |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | multicellular organismal development Inferred from electronic annotation. Source: UniProtKB-KW positive regulation of embryonic developmentInferred from mutant phenotype Ref.3. Source: UniProtKB |
| Cellular_component | chromosome Inferred from electronic annotation. Source: UniProtKB-SubCell cytoplasmInferred from direct assay Ref.3. Source: UniProtKB nucleolusInferred from direct assay Ref.3. Source: UniProtKB nucleoplasmInferred from direct assay Ref.3. Source: UniProtKB |
| Molecular_function | RNA binding Inferred from electronic annotation. Source: UniProtKB-KW nucleotide bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8R3C6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8R3C6-2) The sequence of this isoform differs from the canonical sequence as follows: 485-521: EANAPGSSYKKKKEAMDKANSSSSHNWNTLFMGPNAV → APAALSPPQQDCWPVDRAGDSTSSSGPLPCPCDAARF 522-952: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 952 | 952 | Probable RNA-binding protein 19 | PRO_0000081782 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 2 – 79 | 78 | RRM 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 293 – 368 | 76 | RRM 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 400 – 478 | 79 | RRM 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 584 – 656 | 73 | RRM 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 722 – 803 | 82 | RRM 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 824 – 904 | 81 | RRM 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 182 – 250 | 69 | Asp/Glu-rich | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 389 – 394 | 6 | Poly-Glu | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 671 – 717 | 47 | Glu-rich | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 177 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 179 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 183 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 928 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 944 | 1 | Phosphoserine Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 485 – 521 | 37 | EANAP…GPNAV → APAALSPPQQDCWPVDRAGD STSSSGPLPCPCDAARF in isoform 2. | VSP_015005 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 522 – 952 | 431 | Missing in isoform 2. | VSP_015006 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 400 – 405 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 413 – 421 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 426 – 430 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 435 – 437 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 442 – 450 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 451 – 460 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 461 – 463 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 464 – 468 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 470 – 475 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 581 – 590 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 597 – 605 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 610 – 614 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 617 – 620 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 622 – 627 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 629 – 639 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 643 – 648 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 650 – 655 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 656 – 659 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 666 – 670 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 675 – 677 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 724 – 728 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 735 – 743 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 748 – 757 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 763 – 775 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 776 – 785 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 797 – 799 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 826 – 830 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 837 – 845 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 850 – 854 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 860 – 862 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 867 – 875 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 876 – 887 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 891 – 894 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 898 – 901 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: FVB/N. Tissue: Colon and Mammary cancer. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 363-952 (ISOFORM 1). Strain: C57BL/6J. Tissue: Eye and Lung. |
| [3] | "Rbm19 is a nucleolar protein expressed in crypt/progenitor cells of the intestinal epithelium." Lorenzen J.A., Bonacci B.B., Palmer R.E., Wells C., Zhang J., Haber D.A., Goldstein A.M., Mayer A.N. Gene Expr. Patterns 6:45-56(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE, TISSUE SPECIFICITY. |
| [4] | "RBM19 is essential for preimplantation development in the mouse." Zhang J., Tomasini A.J., Mayer A.N. BMC Dev. Biol. 8:115-115(2008) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE, FUNCTION. |
| [5] | "The phagosomal proteome in interferon-gamma-activated macrophages." Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P. Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-944, MASS SPECTROMETRY. Tissue: Macrophage. |
| [6] | "Solution structure of the second RNA binding domain from hypothetical protein BAB23448." RIKEN structural genomics initiative (RSGI) Submitted (NOV-2004) to the PDB data bank Cited for: STRUCTURE BY NMR OF 581-678. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | BC025619 mRNA. Translation: AAH25619.1. BC034010 mRNA. Translation: AAH34010.1. AK004657 mRNA. Translation: BAB23448.1. AK053511 mRNA. Translation: BAC35411.1. | ||||||||||||||||||||||||||||||
| IPI | IPI00165762. IPI00475221. | ||||||||||||||||||||||||||||||
| RefSeq | NP_083038.1. NM_028762.1. | ||||||||||||||||||||||||||||||
| UniGene | Mm.41022. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | Q8R3C6. | ||||||||||||||||||||||||||||||
| SMR | Q8R3C6. Positions 4-78, 290-490, 583-678, 724-910. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| STRING | 10090.ENSMUSP00000031590. | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | Q8R3C6. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PaxDb | Q8R3C6. | ||||||||||||||||||||||||||||||
| PRIDE | Q8R3C6. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENSMUST00000031590; ENSMUSP00000031590; ENSMUSG00000029594. | ||||||||||||||||||||||||||||||
| GeneID | 74111. | ||||||||||||||||||||||||||||||
| KEGG | mmu:74111. | ||||||||||||||||||||||||||||||
| UCSC | uc008zha.1. mouse. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 9904. | ||||||||||||||||||||||||||||||
| MGI | MGI:1921361. Rbm19. | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | COG0724. | ||||||||||||||||||||||||||||||
| GeneTree | ENSGT00700000104575. | ||||||||||||||||||||||||||||||
| HOGENOM | HOG000211156. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG055637. | ||||||||||||||||||||||||||||||
| InParanoid | Q8R3C6. | ||||||||||||||||||||||||||||||
| KO | K14787. | ||||||||||||||||||||||||||||||
| OMA | VFREKNV. | ||||||||||||||||||||||||||||||
| OrthoDB | EOG4D7Z56. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| Bgee | Q8R3C6. | ||||||||||||||||||||||||||||||
| CleanEx | MM_RBM19. | ||||||||||||||||||||||||||||||
| Genevestigator | Q8R3C6. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| Gene3D | 3.30.70.330. 6 hits. | ||||||||||||||||||||||||||||||
| InterPro | IPR012677. Nucleotide-bd_a/b_plait. IPR000504. RRM_dom. [Graphical view] | ||||||||||||||||||||||||||||||
| Pfam | PF00076. RRM_1. 4 hits. [Graphical view] | ||||||||||||||||||||||||||||||
| SMART | SM00360. RRM. 6 hits. [Graphical view] | ||||||||||||||||||||||||||||||
| PROSITE | PS50102. RRM. 6 hits. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| ChiTaRS | RBM19. mouse. | ||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q8R3C6. | ||||||||||||||||||||||||||||||
| NextBio | 339804. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | RBM19_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8R3C6 Secondary accession number(s): Q8BHR0, Q9CW63 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
