Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8R3C6

- RBM19_MOUSE

UniProt

Q8R3C6 - RBM19_MOUSE

Protein

Probable RNA-binding protein 19

Gene

Rbm19

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 107 (01 Oct 2014)
      Sequence version 1 (01 Jun 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Plays a role in embryo pre-implantation development.1 Publication

    GO - Molecular functioni

    1. nucleotide binding Source: InterPro
    2. RNA binding Source: UniProtKB-KW

    GO - Biological processi

    1. multicellular organismal development Source: UniProtKB-KW
    2. positive regulation of embryonic development Source: UniProtKB

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Ligandi

    RNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Probable RNA-binding protein 19
    Alternative name(s):
    RNA-binding motif protein 19
    Gene namesi
    Name:Rbm19
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 5

    Organism-specific databases

    MGIiMGI:1921361. Rbm19.

    Subcellular locationi

    Nucleusnucleolus. Nucleusnucleoplasm. Cytoplasm. Chromosome
    Note: Colocalizes with NPM1 during interphase. By late prophase, metaphase, anaphase and telophase, associates with the chromosome periphery. By telophase localizes to nucleolar precursor body (NPB) By similarity. In discrete foci distributed throughout the cytoplasm and nucleoplasm during the 4 to 8 cell stages and the morula stage, but not in the periphery of the NPB. During blastocyst development, becomes increasingly localized to the nucleolus and less to the cytoplasm. At the late blastocyst stage, localized predominantly in the nucleolus. Localized in the nucleolus during interphase and to the perichromosomal sheath during mitosis. Does not colocalize in the cytoplasm with GW182 in P-bodies. May translocate to the nucleolus upon early embryonic development.By similarity

    GO - Cellular componenti

    1. chromosome Source: UniProtKB-SubCell
    2. cytoplasm Source: UniProtKB
    3. nucleolus Source: UniProtKB
    4. nucleoplasm Source: UniProtKB

    Keywords - Cellular componenti

    Chromosome, Cytoplasm, Nucleus

    Pathology & Biotechi

    Disruption phenotypei

    Arrests embryonic development prior to implantation. Embryos at 3.5 dpc lack the mature, tripartite nucleoli, but instead, contain spheres resembling nucleolar precursor body (NPB), indicating arrest of nucleologenesis.1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 952952Probable RNA-binding protein 19PRO_0000081782Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei177 – 1771PhosphoserineBy similarity
    Modified residuei179 – 1791PhosphoserineBy similarity
    Modified residuei183 – 1831PhosphoserineBy similarity
    Modified residuei693 – 6931Phosphoserine1 Publication
    Modified residuei928 – 9281PhosphoserineBy similarity
    Modified residuei944 – 9441Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiQ8R3C6.
    PRIDEiQ8R3C6.

    PTM databases

    PhosphoSiteiQ8R3C6.

    Expressioni

    Tissue specificityi

    Expressed in the crypts of Lieberkuhn of the intestine (at protein level).1 Publication

    Developmental stagei

    Expressed during early development. Expressed in the epithelium of the embryonic gut tube (at protein level).1 Publication

    Gene expression databases

    BgeeiQ8R3C6.
    CleanExiMM_RBM19.
    GenevestigatoriQ8R3C6.

    Interactioni

    Protein-protein interaction databases

    BioGridi216500. 2 interactions.
    IntActiQ8R3C6. 1 interaction.
    MINTiMINT-4118964.
    STRINGi10090.ENSMUSP00000031590.

    Structurei

    Secondary structure

    1
    952
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi400 – 4056
    Helixi413 – 4219
    Beta strandi426 – 4305
    Turni435 – 4373
    Beta strandi442 – 4509
    Helixi451 – 46010
    Turni461 – 4633
    Beta strandi464 – 4685
    Beta strandi470 – 4756
    Beta strandi581 – 59010
    Helixi597 – 6059
    Beta strandi610 – 6145
    Beta strandi617 – 6204
    Beta strandi622 – 6276
    Helixi629 – 63911
    Beta strandi643 – 6486
    Beta strandi650 – 6556
    Turni656 – 6594
    Helixi666 – 6705
    Helixi675 – 6773
    Beta strandi724 – 7285
    Helixi735 – 7439
    Beta strandi748 – 75710
    Beta strandi763 – 77513
    Helixi776 – 78510
    Beta strandi797 – 7993
    Beta strandi826 – 8305
    Helixi837 – 8459
    Beta strandi850 – 8545
    Beta strandi860 – 8623
    Beta strandi867 – 8759
    Helixi876 – 88712
    Beta strandi891 – 8944
    Beta strandi898 – 9014

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1WHWNMR-A399-484[»]
    1WHXNMR-A581-678[»]
    2CPFNMR-A724-808[»]
    2CPHNMR-A816-909[»]
    ProteinModelPortaliQ8R3C6.
    SMRiQ8R3C6. Positions 290-490, 583-678, 724-910.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ8R3C6.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini2 – 7978RRM 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini293 – 36876RRM 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini400 – 47879RRM 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini584 – 65673RRM 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini722 – 80382RRM 5PROSITE-ProRule annotationAdd
    BLAST
    Domaini824 – 90481RRM 6PROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi182 – 25069Asp/Glu-richAdd
    BLAST
    Compositional biasi389 – 3946Poly-Glu
    Compositional biasi671 – 71747Glu-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the RRM MRD1 family.Curated
    Contains 6 RRM (RNA recognition motif) domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiCOG0724.
    GeneTreeiENSGT00700000104575.
    HOGENOMiHOG000211156.
    HOVERGENiHBG055637.
    InParanoidiQ8R3C6.
    KOiK14787.
    OMAiQRERGNT.
    OrthoDBiEOG7K0ZBH.
    PhylomeDBiQ8R3C6.
    TreeFamiTF105725.

    Family and domain databases

    Gene3Di3.30.70.330. 6 hits.
    InterProiIPR012677. Nucleotide-bd_a/b_plait.
    IPR000504. RRM_dom.
    [Graphical view]
    PfamiPF00076. RRM_1. 4 hits.
    [Graphical view]
    SMARTiSM00360. RRM. 6 hits.
    [Graphical view]
    PROSITEiPS50102. RRM. 6 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8R3C6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSRLIVKNLP NGMKEERFRQ LFAAFGTLTD CSLKFTKDGK FRKFGFIGFK    50
    SEEEAQAALN HFHRSFIDTT RITVEFCKSF GDPSKPRAWS KHAQKSSQPK 100
    QPSQDSVPSD TKKDKKKKGP SDLEKLKEDA KFQEFLSIHQ KRTQVATWAN 150
    DALEAKLPKA KTKASSDYLN FDSDSNSDSG QESEEEPARE DPEEEQGLQP 200
    KAAVQKELSD MDYLKSKMVR AEVSSEDEDE EDSEDEAVNC EEGSEEEEEE 250
    GSPASPAKQG GVSRGAVPGV LRPQEAAGKV EKPVSQKEPT TPYTVKLRGA 300
    PFNVTEKNVI EFLAPLKPVA IRIVRNAHGN KTGYVFVDLS SEEEVKKALK 350
    CNRDYMGGRY IEVFREKQAP TARGPPKSTT PWQGRTLGEN EEEEDLADSG 400
    RLFVRNLSYT SSEEDLEKLF SAYGPLSELH YPIDSLTKKP KGFAFVTFMF 450
    PEHAVKAYAE VDGQVFQGRM LHVLPSTIKK EASQEANAPG SSYKKKKEAM 500
    DKANSSSSHN WNTLFMGPNA VADAIAQKYN ATKSQVFDHE TRGSVAVRVA 550
    LGETQLVQEV RSFLIDNGVC LDSFSQAAAE RSKTVILAKN LPAGTLAAEI 600
    QETFSRFGSL GRVLLPEGGI TAIVEFLEPL EARKAFRHLA YSKFHHVPLY 650
    LEWAPIGVFG AAPQKKDSQH EQPAEKAEVE QETVLDPEGE KASVEGAEAS 700
    TGKMEEEEEE EEEEEEESIP GCTLFIKNLN FSTTEETLKG VFSKVGAIKS 750
    CTISKKKNKA GVLLSMGFGF VEYKKPEQAQ KALKQLQGHT VDGHKLEVRI 800
    SERATKPALT STRKKQVPKK QTTSKILVRN IPFQANQREI RELFSTFGEL 850
    KTVRLPKKMT GTGAHRGFGF VDFITKQDAK KAFNALCHST HLYGRRLVLE 900
    WADSEVTVQT LRRKTARHFQ EPPKKKRSAV LDGILEQLED EDNSDGEQAL 950
    QL 952
    Length:952
    Mass (Da):106,083
    Last modified:June 1, 2002 - v1
    Checksum:i91C45ADB66F8CDB2
    GO
    Isoform 2 (identifier: Q8R3C6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         485-521: EANAPGSSYKKKKEAMDKANSSSSHNWNTLFMGPNAV → APAALSPPQQDCWPVDRAGDSTSSSGPLPCPCDAARF
         522-952: Missing.

    Show »
    Length:521
    Mass (Da):57,940
    Checksum:i83C0C09AD3AB0BB2
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei485 – 52137EANAP…GPNAV → APAALSPPQQDCWPVDRAGD STSSSGPLPCPCDAARF in isoform 2. 1 PublicationVSP_015005Add
    BLAST
    Alternative sequencei522 – 952431Missing in isoform 2. 1 PublicationVSP_015006Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    BC025619 mRNA. Translation: AAH25619.1.
    BC034010 mRNA. Translation: AAH34010.1.
    AK004657 mRNA. Translation: BAB23448.1.
    AK053511 mRNA. Translation: BAC35411.1.
    CCDSiCCDS19616.1. [Q8R3C6-1]
    RefSeqiNP_083038.1. NM_028762.1. [Q8R3C6-1]
    UniGeneiMm.41022.

    Genome annotation databases

    EnsembliENSMUST00000031590; ENSMUSP00000031590; ENSMUSG00000029594. [Q8R3C6-1]
    GeneIDi74111.
    KEGGimmu:74111.
    UCSCiuc008zha.1. mouse. [Q8R3C6-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    BC025619 mRNA. Translation: AAH25619.1 .
    BC034010 mRNA. Translation: AAH34010.1 .
    AK004657 mRNA. Translation: BAB23448.1 .
    AK053511 mRNA. Translation: BAC35411.1 .
    CCDSi CCDS19616.1. [Q8R3C6-1 ]
    RefSeqi NP_083038.1. NM_028762.1. [Q8R3C6-1 ]
    UniGenei Mm.41022.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1WHW NMR - A 399-484 [» ]
    1WHX NMR - A 581-678 [» ]
    2CPF NMR - A 724-808 [» ]
    2CPH NMR - A 816-909 [» ]
    ProteinModelPortali Q8R3C6.
    SMRi Q8R3C6. Positions 290-490, 583-678, 724-910.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 216500. 2 interactions.
    IntActi Q8R3C6. 1 interaction.
    MINTi MINT-4118964.
    STRINGi 10090.ENSMUSP00000031590.

    PTM databases

    PhosphoSitei Q8R3C6.

    Proteomic databases

    PaxDbi Q8R3C6.
    PRIDEi Q8R3C6.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000031590 ; ENSMUSP00000031590 ; ENSMUSG00000029594 . [Q8R3C6-1 ]
    GeneIDi 74111.
    KEGGi mmu:74111.
    UCSCi uc008zha.1. mouse. [Q8R3C6-1 ]

    Organism-specific databases

    CTDi 9904.
    MGIi MGI:1921361. Rbm19.

    Phylogenomic databases

    eggNOGi COG0724.
    GeneTreei ENSGT00700000104575.
    HOGENOMi HOG000211156.
    HOVERGENi HBG055637.
    InParanoidi Q8R3C6.
    KOi K14787.
    OMAi QRERGNT.
    OrthoDBi EOG7K0ZBH.
    PhylomeDBi Q8R3C6.
    TreeFami TF105725.

    Miscellaneous databases

    ChiTaRSi RBM19. mouse.
    EvolutionaryTracei Q8R3C6.
    NextBioi 339804.
    PROi Q8R3C6.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8R3C6.
    CleanExi MM_RBM19.
    Genevestigatori Q8R3C6.

    Family and domain databases

    Gene3Di 3.30.70.330. 6 hits.
    InterProi IPR012677. Nucleotide-bd_a/b_plait.
    IPR000504. RRM_dom.
    [Graphical view ]
    Pfami PF00076. RRM_1. 4 hits.
    [Graphical view ]
    SMARTi SM00360. RRM. 6 hits.
    [Graphical view ]
    PROSITEi PS50102. RRM. 6 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: FVB/N.
      Tissue: Colon and Mammary cancer.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 363-952 (ISOFORM 1).
      Strain: C57BL/6J.
      Tissue: Eye and Lung.
    3. "Rbm19 is a nucleolar protein expressed in crypt/progenitor cells of the intestinal epithelium."
      Lorenzen J.A., Bonacci B.B., Palmer R.E., Wells C., Zhang J., Haber D.A., Goldstein A.M., Mayer A.N.
      Gene Expr. Patterns 6:45-56(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE, TISSUE SPECIFICITY.
    4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-693, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.
    5. "RBM19 is essential for preimplantation development in the mouse."
      Zhang J., Tomasini A.J., Mayer A.N.
      BMC Dev. Biol. 8:115-115(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE, FUNCTION.
    6. "The phagosomal proteome in interferon-gamma-activated macrophages."
      Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
      Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-944, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. "Solution structure of the second RNA binding domain from hypothetical protein BAB23448."
      RIKEN structural genomics initiative (RSGI)
      Submitted (NOV-2004) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 581-678.

    Entry informationi

    Entry nameiRBM19_MOUSE
    AccessioniPrimary (citable) accession number: Q8R3C6
    Secondary accession number(s): Q8BHR0, Q9CW63
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 16, 2005
    Last sequence update: June 1, 2002
    Last modified: October 1, 2014
    This is version 107 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3