SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8R3C6

- RBM19_MOUSE

UniProt

Q8R3C6 - RBM19_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Probable RNA-binding protein 19

Gene
Rbm19
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Plays a role in embryo pre-implantation development.1 Publication

GO - Molecular functioni

  1. nucleotide binding Source: InterPro
  2. RNA binding Source: UniProtKB-KW

GO - Biological processi

  1. multicellular organismal development Source: UniProtKB-KW
  2. positive regulation of embryonic development Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Probable RNA-binding protein 19
Alternative name(s):
RNA-binding motif protein 19
Gene namesi
Name:Rbm19
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 5

Organism-specific databases

MGIiMGI:1921361. Rbm19.

Subcellular locationi

Nucleusnucleolus. Nucleusnucleoplasm. Cytoplasm. Chromosome
Note: Colocalizes with NPM1 during interphase. By late prophase, metaphase, anaphase and telophase, associates with the chromosome periphery. By telophase localizes to nucleolar precursor body (NPB) By similarity. In discrete foci distributed throughout the cytoplasm and nucleoplasm during the 4 to 8 cell stages and the morula stage, but not in the periphery of the NPB. During blastocyst development, becomes increasingly localized to the nucleolus and less to the cytoplasm. At the late blastocyst stage, localized predominantly in the nucleolus. Localized in the nucleolus during interphase and to the perichromosomal sheath during mitosis. Does not colocalize in the cytoplasm with GW182 in P-bodies. May translocate to the nucleolus upon early embryonic development.2 Publications

GO - Cellular componenti

  1. chromosome Source: UniProtKB-SubCell
  2. cytoplasm Source: UniProtKB
  3. nucleolus Source: UniProtKB
  4. nucleoplasm Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Cytoplasm, Nucleus

Pathology & Biotechi

Disruption phenotypei

Arrests embryonic development prior to implantation. Embryos at 3.5 dpc lack the mature, tripartite nucleoli, but instead, contain spheres resembling nucleolar precursor body (NPB), indicating arrest of nucleologenesis.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 952952Probable RNA-binding protein 19PRO_0000081782Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei177 – 1771Phosphoserine By similarity
Modified residuei179 – 1791Phosphoserine By similarity
Modified residuei183 – 1831Phosphoserine By similarity
Modified residuei693 – 6931Phosphoserine1 Publication
Modified residuei928 – 9281Phosphoserine By similarity
Modified residuei944 – 9441Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8R3C6.
PRIDEiQ8R3C6.

PTM databases

PhosphoSiteiQ8R3C6.

Expressioni

Tissue specificityi

Expressed in the crypts of Lieberkuhn of the intestine (at protein level).1 Publication

Developmental stagei

Expressed during early development. Expressed in the epithelium of the embryonic gut tube (at protein level).1 Publication

Gene expression databases

BgeeiQ8R3C6.
CleanExiMM_RBM19.
GenevestigatoriQ8R3C6.

Interactioni

Protein-protein interaction databases

BioGridi216500. 2 interactions.
IntActiQ8R3C6. 1 interaction.
MINTiMINT-4118964.
STRINGi10090.ENSMUSP00000031590.

Structurei

Secondary structure

1
952
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi400 – 4056
Helixi413 – 4219
Beta strandi426 – 4305
Turni435 – 4373
Beta strandi442 – 4509
Helixi451 – 46010
Turni461 – 4633
Beta strandi464 – 4685
Beta strandi470 – 4756
Beta strandi581 – 59010
Helixi597 – 6059
Beta strandi610 – 6145
Beta strandi617 – 6204
Beta strandi622 – 6276
Helixi629 – 63911
Beta strandi643 – 6486
Beta strandi650 – 6556
Turni656 – 6594
Helixi666 – 6705
Helixi675 – 6773
Beta strandi724 – 7285
Helixi735 – 7439
Beta strandi748 – 75710
Beta strandi763 – 77513
Helixi776 – 78510
Beta strandi797 – 7993
Beta strandi826 – 8305
Helixi837 – 8459
Beta strandi850 – 8545
Beta strandi860 – 8623
Beta strandi867 – 8759
Helixi876 – 88712
Beta strandi891 – 8944
Beta strandi898 – 9014

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1WHWNMR-A399-484[»]
1WHXNMR-A581-678[»]
2CPFNMR-A724-808[»]
2CPHNMR-A816-909[»]
ProteinModelPortaliQ8R3C6.
SMRiQ8R3C6. Positions 290-490, 583-678, 724-910.

Miscellaneous databases

EvolutionaryTraceiQ8R3C6.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini2 – 7978RRM 1Add
BLAST
Domaini293 – 36876RRM 2Add
BLAST
Domaini400 – 47879RRM 3Add
BLAST
Domaini584 – 65673RRM 4Add
BLAST
Domaini722 – 80382RRM 5Add
BLAST
Domaini824 – 90481RRM 6Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi182 – 25069Asp/Glu-richAdd
BLAST
Compositional biasi389 – 3946Poly-Glu
Compositional biasi671 – 71747Glu-richAdd
BLAST

Sequence similaritiesi

Belongs to the RRM MRD1 family.

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiCOG0724.
GeneTreeiENSGT00700000104575.
HOGENOMiHOG000211156.
HOVERGENiHBG055637.
InParanoidiQ8R3C6.
KOiK14787.
OMAiQRERGNT.
OrthoDBiEOG7K0ZBH.
PhylomeDBiQ8R3C6.
TreeFamiTF105725.

Family and domain databases

Gene3Di3.30.70.330. 6 hits.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 4 hits.
[Graphical view]
SMARTiSM00360. RRM. 6 hits.
[Graphical view]
PROSITEiPS50102. RRM. 6 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8R3C6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSRLIVKNLP NGMKEERFRQ LFAAFGTLTD CSLKFTKDGK FRKFGFIGFK    50
SEEEAQAALN HFHRSFIDTT RITVEFCKSF GDPSKPRAWS KHAQKSSQPK 100
QPSQDSVPSD TKKDKKKKGP SDLEKLKEDA KFQEFLSIHQ KRTQVATWAN 150
DALEAKLPKA KTKASSDYLN FDSDSNSDSG QESEEEPARE DPEEEQGLQP 200
KAAVQKELSD MDYLKSKMVR AEVSSEDEDE EDSEDEAVNC EEGSEEEEEE 250
GSPASPAKQG GVSRGAVPGV LRPQEAAGKV EKPVSQKEPT TPYTVKLRGA 300
PFNVTEKNVI EFLAPLKPVA IRIVRNAHGN KTGYVFVDLS SEEEVKKALK 350
CNRDYMGGRY IEVFREKQAP TARGPPKSTT PWQGRTLGEN EEEEDLADSG 400
RLFVRNLSYT SSEEDLEKLF SAYGPLSELH YPIDSLTKKP KGFAFVTFMF 450
PEHAVKAYAE VDGQVFQGRM LHVLPSTIKK EASQEANAPG SSYKKKKEAM 500
DKANSSSSHN WNTLFMGPNA VADAIAQKYN ATKSQVFDHE TRGSVAVRVA 550
LGETQLVQEV RSFLIDNGVC LDSFSQAAAE RSKTVILAKN LPAGTLAAEI 600
QETFSRFGSL GRVLLPEGGI TAIVEFLEPL EARKAFRHLA YSKFHHVPLY 650
LEWAPIGVFG AAPQKKDSQH EQPAEKAEVE QETVLDPEGE KASVEGAEAS 700
TGKMEEEEEE EEEEEEESIP GCTLFIKNLN FSTTEETLKG VFSKVGAIKS 750
CTISKKKNKA GVLLSMGFGF VEYKKPEQAQ KALKQLQGHT VDGHKLEVRI 800
SERATKPALT STRKKQVPKK QTTSKILVRN IPFQANQREI RELFSTFGEL 850
KTVRLPKKMT GTGAHRGFGF VDFITKQDAK KAFNALCHST HLYGRRLVLE 900
WADSEVTVQT LRRKTARHFQ EPPKKKRSAV LDGILEQLED EDNSDGEQAL 950
QL 952
Length:952
Mass (Da):106,083
Last modified:June 1, 2002 - v1
Checksum:i91C45ADB66F8CDB2
GO
Isoform 2 (identifier: Q8R3C6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     485-521: EANAPGSSYKKKKEAMDKANSSSSHNWNTLFMGPNAV → APAALSPPQQDCWPVDRAGDSTSSSGPLPCPCDAARF
     522-952: Missing.

Show »
Length:521
Mass (Da):57,940
Checksum:i83C0C09AD3AB0BB2
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei485 – 52137EANAP…GPNAV → APAALSPPQQDCWPVDRAGD STSSSGPLPCPCDAARF in isoform 2. VSP_015005Add
BLAST
Alternative sequencei522 – 952431Missing in isoform 2. VSP_015006Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
BC025619 mRNA. Translation: AAH25619.1.
BC034010 mRNA. Translation: AAH34010.1.
AK004657 mRNA. Translation: BAB23448.1.
AK053511 mRNA. Translation: BAC35411.1.
CCDSiCCDS19616.1. [Q8R3C6-1]
RefSeqiNP_083038.1. NM_028762.1. [Q8R3C6-1]
UniGeneiMm.41022.

Genome annotation databases

EnsembliENSMUST00000031590; ENSMUSP00000031590; ENSMUSG00000029594. [Q8R3C6-1]
GeneIDi74111.
KEGGimmu:74111.
UCSCiuc008zha.1. mouse. [Q8R3C6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
BC025619 mRNA. Translation: AAH25619.1 .
BC034010 mRNA. Translation: AAH34010.1 .
AK004657 mRNA. Translation: BAB23448.1 .
AK053511 mRNA. Translation: BAC35411.1 .
CCDSi CCDS19616.1. [Q8R3C6-1 ]
RefSeqi NP_083038.1. NM_028762.1. [Q8R3C6-1 ]
UniGenei Mm.41022.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1WHW NMR - A 399-484 [» ]
1WHX NMR - A 581-678 [» ]
2CPF NMR - A 724-808 [» ]
2CPH NMR - A 816-909 [» ]
ProteinModelPortali Q8R3C6.
SMRi Q8R3C6. Positions 290-490, 583-678, 724-910.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 216500. 2 interactions.
IntActi Q8R3C6. 1 interaction.
MINTi MINT-4118964.
STRINGi 10090.ENSMUSP00000031590.

PTM databases

PhosphoSitei Q8R3C6.

Proteomic databases

PaxDbi Q8R3C6.
PRIDEi Q8R3C6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000031590 ; ENSMUSP00000031590 ; ENSMUSG00000029594 . [Q8R3C6-1 ]
GeneIDi 74111.
KEGGi mmu:74111.
UCSCi uc008zha.1. mouse. [Q8R3C6-1 ]

Organism-specific databases

CTDi 9904.
MGIi MGI:1921361. Rbm19.

Phylogenomic databases

eggNOGi COG0724.
GeneTreei ENSGT00700000104575.
HOGENOMi HOG000211156.
HOVERGENi HBG055637.
InParanoidi Q8R3C6.
KOi K14787.
OMAi QRERGNT.
OrthoDBi EOG7K0ZBH.
PhylomeDBi Q8R3C6.
TreeFami TF105725.

Miscellaneous databases

ChiTaRSi RBM19. mouse.
EvolutionaryTracei Q8R3C6.
NextBioi 339804.
PROi Q8R3C6.
SOURCEi Search...

Gene expression databases

Bgeei Q8R3C6.
CleanExi MM_RBM19.
Genevestigatori Q8R3C6.

Family and domain databases

Gene3Di 3.30.70.330. 6 hits.
InterProi IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view ]
Pfami PF00076. RRM_1. 4 hits.
[Graphical view ]
SMARTi SM00360. RRM. 6 hits.
[Graphical view ]
PROSITEi PS50102. RRM. 6 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: FVB/N.
    Tissue: Colon and Mammary cancer.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 363-952 (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Eye and Lung.
  3. "Rbm19 is a nucleolar protein expressed in crypt/progenitor cells of the intestinal epithelium."
    Lorenzen J.A., Bonacci B.B., Palmer R.E., Wells C., Zhang J., Haber D.A., Goldstein A.M., Mayer A.N.
    Gene Expr. Patterns 6:45-56(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE, TISSUE SPECIFICITY.
  4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-693, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  5. "RBM19 is essential for preimplantation development in the mouse."
    Zhang J., Tomasini A.J., Mayer A.N.
    BMC Dev. Biol. 8:115-115(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE, FUNCTION.
  6. "The phagosomal proteome in interferon-gamma-activated macrophages."
    Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
    Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-944, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "Solution structure of the second RNA binding domain from hypothetical protein BAB23448."
    RIKEN structural genomics initiative (RSGI)
    Submitted (NOV-2004) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 581-678.

Entry informationi

Entry nameiRBM19_MOUSE
AccessioniPrimary (citable) accession number: Q8R3C6
Secondary accession number(s): Q8BHR0, Q9CW63
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: June 1, 2002
Last modified: July 9, 2014
This is version 106 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi