Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable RNA-binding protein 19

Gene

Rbm19

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in embryo pre-implantation development.1 Publication

GO - Molecular functioni

GO - Biological processi

  • multicellular organism development Source: UniProtKB-KW
  • positive regulation of embryonic development Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Probable RNA-binding protein 19
Alternative name(s):
RNA-binding motif protein 19
Gene namesi
Name:Rbm19
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:1921361. Rbm19.

Subcellular locationi

  • Nucleusnucleolus
  • Nucleusnucleoplasm
  • Cytoplasm
  • Chromosome

  • Note: Colocalizes with NPM1 during interphase. By late prophase, metaphase, anaphase and telophase, associates with the chromosome periphery. By telophase localizes to nucleolar precursor body (NPB) (By similarity). In discrete foci distributed throughout the cytoplasm and nucleoplasm during the 4 to 8 cell stages and the morula stage, but not in the periphery of the NPB. During blastocyst development, becomes increasingly localized to the nucleolus and less to the cytoplasm. At the late blastocyst stage, localized predominantly in the nucleolus. Localized in the nucleolus during interphase and to the perichromosomal sheath during mitosis. Does not colocalize in the cytoplasm with GW182 in P-bodies. May translocate to the nucleolus upon early embryonic development.By similarity

GO - Cellular componenti

  • chromosome Source: UniProtKB-SubCell
  • cytoplasm Source: UniProtKB
  • membrane Source: MGI
  • nucleolus Source: UniProtKB
  • nucleoplasm Source: UniProtKB
  • nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Cytoplasm, Nucleus

Pathology & Biotechi

Disruption phenotypei

Arrests embryonic development prior to implantation. Embryos at 3.5 dpc lack the mature, tripartite nucleoli, but instead, contain spheres resembling nucleolar precursor body (NPB), indicating arrest of nucleologenesis.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000817821 – 952Probable RNA-binding protein 19Add BLAST952

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei177PhosphoserineBy similarity1
Modified residuei179PhosphoserineBy similarity1
Modified residuei183PhosphoserineBy similarity1
Modified residuei693PhosphoserineCombined sources1
Modified residuei928PhosphoserineBy similarity1
Modified residuei944PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8R3C6.
PaxDbiQ8R3C6.
PeptideAtlasiQ8R3C6.
PRIDEiQ8R3C6.

PTM databases

iPTMnetiQ8R3C6.
PhosphoSitePlusiQ8R3C6.

Expressioni

Tissue specificityi

Expressed in the crypts of Lieberkuhn of the intestine (at protein level).1 Publication

Developmental stagei

Expressed during early development. Expressed in the epithelium of the embryonic gut tube (at protein level).1 Publication

Gene expression databases

BgeeiENSMUSG00000029594.
CleanExiMM_RBM19.
ExpressionAtlasiQ8R3C6. baseline and differential.
GenevisibleiQ8R3C6. MM.

Interactioni

Protein-protein interaction databases

BioGridi216500. 2 interactors.
IntActiQ8R3C6. 1 interactor.
MINTiMINT-4118964.
STRINGi10090.ENSMUSP00000031590.

Structurei

Secondary structure

1952
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi400 – 405Combined sources6
Helixi413 – 421Combined sources9
Beta strandi426 – 430Combined sources5
Turni435 – 437Combined sources3
Beta strandi442 – 450Combined sources9
Helixi451 – 460Combined sources10
Turni461 – 463Combined sources3
Beta strandi464 – 468Combined sources5
Beta strandi470 – 475Combined sources6
Beta strandi581 – 590Combined sources10
Helixi597 – 605Combined sources9
Beta strandi610 – 614Combined sources5
Beta strandi617 – 620Combined sources4
Beta strandi622 – 627Combined sources6
Helixi629 – 639Combined sources11
Beta strandi643 – 648Combined sources6
Beta strandi650 – 655Combined sources6
Turni656 – 659Combined sources4
Helixi666 – 670Combined sources5
Helixi675 – 677Combined sources3
Beta strandi724 – 728Combined sources5
Helixi735 – 743Combined sources9
Beta strandi748 – 757Combined sources10
Beta strandi763 – 775Combined sources13
Helixi776 – 785Combined sources10
Beta strandi797 – 799Combined sources3
Beta strandi826 – 830Combined sources5
Helixi837 – 845Combined sources9
Beta strandi850 – 854Combined sources5
Beta strandi860 – 862Combined sources3
Beta strandi867 – 875Combined sources9
Helixi876 – 887Combined sources12
Beta strandi891 – 894Combined sources4
Beta strandi898 – 901Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WHWNMR-A399-484[»]
1WHXNMR-A581-678[»]
2CPFNMR-A724-808[»]
2CPHNMR-A816-909[»]
ProteinModelPortaliQ8R3C6.
SMRiQ8R3C6.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8R3C6.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini2 – 79RRM 1PROSITE-ProRule annotationAdd BLAST78
Domaini293 – 368RRM 2PROSITE-ProRule annotationAdd BLAST76
Domaini400 – 478RRM 3PROSITE-ProRule annotationAdd BLAST79
Domaini584 – 656RRM 4PROSITE-ProRule annotationAdd BLAST73
Domaini722 – 803RRM 5PROSITE-ProRule annotationAdd BLAST82
Domaini824 – 904RRM 6PROSITE-ProRule annotationAdd BLAST81

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi182 – 250Asp/Glu-richAdd BLAST69
Compositional biasi389 – 394Poly-Glu6
Compositional biasi671 – 717Glu-richAdd BLAST47

Sequence similaritiesi

Belongs to the RRM MRD1 family.Curated
Contains 6 RRM (RNA recognition motif) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0110. Eukaryota.
ENOG410XQZ5. LUCA.
GeneTreeiENSGT00840000129953.
HOGENOMiHOG000211156.
HOVERGENiHBG055637.
InParanoidiQ8R3C6.
KOiK14787.
OMAiPNGMKED.
OrthoDBiEOG091G02IZ.
PhylomeDBiQ8R3C6.
TreeFamiTF105725.

Family and domain databases

Gene3Di3.30.70.330. 6 hits.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
IPR003954. RRM_dom_euk.
[Graphical view]
PfamiPF00076. RRM_1. 5 hits.
[Graphical view]
SMARTiSM00360. RRM. 6 hits.
SM00361. RRM_1. 2 hits.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 6 hits.
PROSITEiPS50102. RRM. 6 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8R3C6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSRLIVKNLP NGMKEERFRQ LFAAFGTLTD CSLKFTKDGK FRKFGFIGFK
60 70 80 90 100
SEEEAQAALN HFHRSFIDTT RITVEFCKSF GDPSKPRAWS KHAQKSSQPK
110 120 130 140 150
QPSQDSVPSD TKKDKKKKGP SDLEKLKEDA KFQEFLSIHQ KRTQVATWAN
160 170 180 190 200
DALEAKLPKA KTKASSDYLN FDSDSNSDSG QESEEEPARE DPEEEQGLQP
210 220 230 240 250
KAAVQKELSD MDYLKSKMVR AEVSSEDEDE EDSEDEAVNC EEGSEEEEEE
260 270 280 290 300
GSPASPAKQG GVSRGAVPGV LRPQEAAGKV EKPVSQKEPT TPYTVKLRGA
310 320 330 340 350
PFNVTEKNVI EFLAPLKPVA IRIVRNAHGN KTGYVFVDLS SEEEVKKALK
360 370 380 390 400
CNRDYMGGRY IEVFREKQAP TARGPPKSTT PWQGRTLGEN EEEEDLADSG
410 420 430 440 450
RLFVRNLSYT SSEEDLEKLF SAYGPLSELH YPIDSLTKKP KGFAFVTFMF
460 470 480 490 500
PEHAVKAYAE VDGQVFQGRM LHVLPSTIKK EASQEANAPG SSYKKKKEAM
510 520 530 540 550
DKANSSSSHN WNTLFMGPNA VADAIAQKYN ATKSQVFDHE TRGSVAVRVA
560 570 580 590 600
LGETQLVQEV RSFLIDNGVC LDSFSQAAAE RSKTVILAKN LPAGTLAAEI
610 620 630 640 650
QETFSRFGSL GRVLLPEGGI TAIVEFLEPL EARKAFRHLA YSKFHHVPLY
660 670 680 690 700
LEWAPIGVFG AAPQKKDSQH EQPAEKAEVE QETVLDPEGE KASVEGAEAS
710 720 730 740 750
TGKMEEEEEE EEEEEEESIP GCTLFIKNLN FSTTEETLKG VFSKVGAIKS
760 770 780 790 800
CTISKKKNKA GVLLSMGFGF VEYKKPEQAQ KALKQLQGHT VDGHKLEVRI
810 820 830 840 850
SERATKPALT STRKKQVPKK QTTSKILVRN IPFQANQREI RELFSTFGEL
860 870 880 890 900
KTVRLPKKMT GTGAHRGFGF VDFITKQDAK KAFNALCHST HLYGRRLVLE
910 920 930 940 950
WADSEVTVQT LRRKTARHFQ EPPKKKRSAV LDGILEQLED EDNSDGEQAL

QL
Length:952
Mass (Da):106,083
Last modified:June 1, 2002 - v1
Checksum:i91C45ADB66F8CDB2
GO
Isoform 2 (identifier: Q8R3C6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     485-521: EANAPGSSYKKKKEAMDKANSSSSHNWNTLFMGPNAV → APAALSPPQQDCWPVDRAGDSTSSSGPLPCPCDAARF
     522-952: Missing.

Show »
Length:521
Mass (Da):57,940
Checksum:i83C0C09AD3AB0BB2
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_015005485 – 521EANAP…GPNAV → APAALSPPQQDCWPVDRAGD STSSSGPLPCPCDAARF in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_015006522 – 952Missing in isoform 2. 1 PublicationAdd BLAST431

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC025619 mRNA. Translation: AAH25619.1.
BC034010 mRNA. Translation: AAH34010.1.
AK004657 mRNA. Translation: BAB23448.1.
AK053511 mRNA. Translation: BAC35411.1.
CCDSiCCDS19616.1. [Q8R3C6-1]
RefSeqiNP_083038.1. NM_028762.1. [Q8R3C6-1]
UniGeneiMm.41022.

Genome annotation databases

EnsembliENSMUST00000031590; ENSMUSP00000031590; ENSMUSG00000029594. [Q8R3C6-1]
GeneIDi74111.
KEGGimmu:74111.
UCSCiuc008zha.1. mouse. [Q8R3C6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC025619 mRNA. Translation: AAH25619.1.
BC034010 mRNA. Translation: AAH34010.1.
AK004657 mRNA. Translation: BAB23448.1.
AK053511 mRNA. Translation: BAC35411.1.
CCDSiCCDS19616.1. [Q8R3C6-1]
RefSeqiNP_083038.1. NM_028762.1. [Q8R3C6-1]
UniGeneiMm.41022.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WHWNMR-A399-484[»]
1WHXNMR-A581-678[»]
2CPFNMR-A724-808[»]
2CPHNMR-A816-909[»]
ProteinModelPortaliQ8R3C6.
SMRiQ8R3C6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi216500. 2 interactors.
IntActiQ8R3C6. 1 interactor.
MINTiMINT-4118964.
STRINGi10090.ENSMUSP00000031590.

PTM databases

iPTMnetiQ8R3C6.
PhosphoSitePlusiQ8R3C6.

Proteomic databases

EPDiQ8R3C6.
PaxDbiQ8R3C6.
PeptideAtlasiQ8R3C6.
PRIDEiQ8R3C6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000031590; ENSMUSP00000031590; ENSMUSG00000029594. [Q8R3C6-1]
GeneIDi74111.
KEGGimmu:74111.
UCSCiuc008zha.1. mouse. [Q8R3C6-1]

Organism-specific databases

CTDi9904.
MGIiMGI:1921361. Rbm19.

Phylogenomic databases

eggNOGiKOG0110. Eukaryota.
ENOG410XQZ5. LUCA.
GeneTreeiENSGT00840000129953.
HOGENOMiHOG000211156.
HOVERGENiHBG055637.
InParanoidiQ8R3C6.
KOiK14787.
OMAiPNGMKED.
OrthoDBiEOG091G02IZ.
PhylomeDBiQ8R3C6.
TreeFamiTF105725.

Miscellaneous databases

EvolutionaryTraceiQ8R3C6.
PROiQ8R3C6.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000029594.
CleanExiMM_RBM19.
ExpressionAtlasiQ8R3C6. baseline and differential.
GenevisibleiQ8R3C6. MM.

Family and domain databases

Gene3Di3.30.70.330. 6 hits.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
IPR003954. RRM_dom_euk.
[Graphical view]
PfamiPF00076. RRM_1. 5 hits.
[Graphical view]
SMARTiSM00360. RRM. 6 hits.
SM00361. RRM_1. 2 hits.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 6 hits.
PROSITEiPS50102. RRM. 6 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRBM19_MOUSE
AccessioniPrimary (citable) accession number: Q8R3C6
Secondary accession number(s): Q8BHR0, Q9CW63
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: June 1, 2002
Last modified: November 2, 2016
This is version 126 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.