Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cell surface glycoprotein MUC18

Gene

Mcam

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. Could be an adhesion molecule active in neural crest cells during embryonic development. Acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2/FAK1, and a transient increase in the intracellular calcium concentration (By similarity).By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Cell surface glycoprotein MUC18
Alternative name(s):
Gicerin
Melanoma cell adhesion molecule
Melanoma-associated antigen MUC18
CD_antigen: CD146
Gene namesi
Name:Mcam
Synonyms:Muc18
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:1933966. Mcam.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini24 – 563540ExtracellularSequence analysisAdd
BLAST
Transmembranei564 – 58421HelicalSequence analysisAdd
BLAST
Topological domaini585 – 64864CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2323By similarityAdd
BLAST
Chaini24 – 648625Cell surface glycoprotein MUC18PRO_0000045460Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi50 ↔ 118PROSITE-ProRule annotation
Glycosylationi58 – 581N-linked (GlcNAc...)1 Publication
Disulfide bondi163 ↔ 225PROSITE-ProRule annotation
Disulfide bondi274 ↔ 322PROSITE-ProRule annotation
Disulfide bondi367 ↔ 409PROSITE-ProRule annotation
Disulfide bondi454 ↔ 501PROSITE-ProRule annotation
Glycosylationi510 – 5101N-linked (GlcNAc...)1 Publication
Modified residuei608 – 6081PhosphoserineCombined sources
Modified residuei616 – 6161PhosphoserineBy similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ8R2Y2.
MaxQBiQ8R2Y2.
PaxDbiQ8R2Y2.
PeptideAtlasiQ8R2Y2.
PRIDEiQ8R2Y2.

PTM databases

iPTMnetiQ8R2Y2.
PhosphoSiteiQ8R2Y2.
SwissPalmiQ8R2Y2.

Expressioni

Tissue specificityi

Detected in melanoma cell lines.1 Publication

Gene expression databases

BgeeiQ8R2Y2.
CleanExiMM_MCAM.
ExpressionAtlasiQ8R2Y2. baseline and differential.
GenevisibleiQ8R2Y2. MM.

Interactioni

Protein-protein interaction databases

IntActiQ8R2Y2. 1 interaction.
MINTiMINT-4128850.
STRINGi10090.ENSMUSP00000034650.

Structurei

3D structure databases

ProteinModelPortaliQ8R2Y2.
SMRiQ8R2Y2. Positions 35-516.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini24 – 131108Ig-like V-type 1Add
BLAST
Domaini141 – 244104Ig-like V-type 2Add
BLAST
Domaini246 – 33287Ig-like C2-type 1Add
BLAST
Domaini337 – 42690Ig-like C2-type 2Add
BLAST
Domaini432 – 51281Ig-like C2-type 3Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IEC2. Eukaryota.
ENOG4110RPG. LUCA.
GeneTreeiENSGT00530000063457.
HOGENOMiHOG000015427.
HOVERGENiHBG002808.
InParanoidiQ8R2Y2.
KOiK06534.
OMAiPSRKSEF.
OrthoDBiEOG7RFTH4.
PhylomeDBiQ8R2Y2.
TreeFamiTF330534.

Family and domain databases

Gene3Di2.60.40.10. 5 hits.
InterProiIPR013162. CD80_C2-set.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF08205. C2-set_2. 1 hit.
PF07679. I-set. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 4 hits.
SM00408. IGc2. 4 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 5 hits.
PROSITEiPS50835. IG_LIKE. 4 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8R2Y2-1) [UniParc]FASTAAdd to basket

Also known as: L-gicerin

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGLPKLVCVF LFAACCCCRR AAGVPGEEKQ PVPTPDLVEA EVGSTALLKC
60 70 80 90 100
GPSRASGNFS QVDWFLIHKE RQILIFRVHQ GKGQREPGEY EHRLSLQDSV
110 120 130 140 150
ATLALSHVTP HDERMFLCKS KRPRLQDHYV ELQVFKAPEE PTIQANVVGI
160 170 180 190 200
HVDRQELREV ATCVGRNGYP IPQVLWYKNS LPLQEEENRV HIQSSQIVES
210 220 230 240 250
SGLYTLKSVL SARLVKEDKD AQFYCELSYR LPSGNHMKES KEVTVPVFYP
260 270 280 290 300
AEKVWVEVEP VGLLKEGDHV TIRCLTDGNP QPHFTINKKD PSTGEMEEES
310 320 330 340 350
TDENGLLSLE PAEKHHSGLY QCQSLDLETT ITLSSDPLEL LVNYVSDVQV
360 370 380 390 400
NPTAPEVQEG ESLTLTCEAE SNQDLEFEWL RDKTGQLLGK GPVLQLNNVR
410 420 430 440 450
REAGGRYLCM ASVPRVPGLN RTQLVSVGIF GSPWMALKER KVWVQENAVL
460 470 480 490 500
NLSCEASGHP QPTISWNVNG SATEWNPDPQ TVVSTLNVLV TPELLETGAE
510 520 530 540 550
CTASNSLGSN TTTIVLKLVT LTTLIPDSSQ TTGLSTLTVS PHTRANSTST
560 570 580 590 600
EKKLPQPESK GVVIVAVIVC TLVLAVLGAA LYFFYKKGKL PCGRSGKQEI
610 620 630 640
TLPPTRKSEF VVEVKSDKLP EEMALLQGSN GDKRAPGDQG EKYIDLRH
Length:648
Mass (Da):71,545
Last modified:June 1, 2002 - v1
Checksum:iE468DABDB56C28FD
GO
Isoform 2 (identifier: Q8R2Y2-2) [UniParc]FASTAAdd to basket

Also known as: S-gicerin

The sequence of this isoform differs from the canonical sequence as follows:
     600-648: ITLPPTRKSEFVVEVKSDKLPEEMALLQGSNGDKRAPGDQGEKYIDLRH → MERNTSI

Show »
Length:606
Mass (Da):66,901
Checksum:iD53CBAC0A5F2967D
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti584 – 5841F → L in BAB16050 (Ref. 1) Curated
Sequence conflicti584 – 5841F → L in BAB16051 (Ref. 1) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei600 – 64849ITLPP…IDLRH → MERNTSI in isoform 2. 2 PublicationsVSP_016940Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB035508 mRNA. Translation: BAB16050.1.
AB035509 mRNA. Translation: BAB16051.1.
BC026985 mRNA. Translation: AAH26985.1.
AJ297450 mRNA. Translation: CAB97362.1.
AJ297451 mRNA. Translation: CAB97363.1.
CCDSiCCDS23097.1. [Q8R2Y2-1]
RefSeqiNP_075548.2. NM_023061.2. [Q8R2Y2-1]
XP_006510779.1. XM_006510716.1. [Q8R2Y2-2]
UniGeneiMm.275003.

Genome annotation databases

EnsembliENSMUST00000034650; ENSMUSP00000034650; ENSMUSG00000032135. [Q8R2Y2-1]
ENSMUST00000098852; ENSMUSP00000096451; ENSMUSG00000032135. [Q8R2Y2-2]
GeneIDi84004.
KEGGimmu:84004.
UCSCiuc009pbw.2. mouse. [Q8R2Y2-1]
uc009pbx.2. mouse. [Q8R2Y2-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB035508 mRNA. Translation: BAB16050.1.
AB035509 mRNA. Translation: BAB16051.1.
BC026985 mRNA. Translation: AAH26985.1.
AJ297450 mRNA. Translation: CAB97362.1.
AJ297451 mRNA. Translation: CAB97363.1.
CCDSiCCDS23097.1. [Q8R2Y2-1]
RefSeqiNP_075548.2. NM_023061.2. [Q8R2Y2-1]
XP_006510779.1. XM_006510716.1. [Q8R2Y2-2]
UniGeneiMm.275003.

3D structure databases

ProteinModelPortaliQ8R2Y2.
SMRiQ8R2Y2. Positions 35-516.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8R2Y2. 1 interaction.
MINTiMINT-4128850.
STRINGi10090.ENSMUSP00000034650.

PTM databases

iPTMnetiQ8R2Y2.
PhosphoSiteiQ8R2Y2.
SwissPalmiQ8R2Y2.

Proteomic databases

EPDiQ8R2Y2.
MaxQBiQ8R2Y2.
PaxDbiQ8R2Y2.
PeptideAtlasiQ8R2Y2.
PRIDEiQ8R2Y2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000034650; ENSMUSP00000034650; ENSMUSG00000032135. [Q8R2Y2-1]
ENSMUST00000098852; ENSMUSP00000096451; ENSMUSG00000032135. [Q8R2Y2-2]
GeneIDi84004.
KEGGimmu:84004.
UCSCiuc009pbw.2. mouse. [Q8R2Y2-1]
uc009pbx.2. mouse. [Q8R2Y2-2]

Organism-specific databases

CTDi4162.
MGIiMGI:1933966. Mcam.

Phylogenomic databases

eggNOGiENOG410IEC2. Eukaryota.
ENOG4110RPG. LUCA.
GeneTreeiENSGT00530000063457.
HOGENOMiHOG000015427.
HOVERGENiHBG002808.
InParanoidiQ8R2Y2.
KOiK06534.
OMAiPSRKSEF.
OrthoDBiEOG7RFTH4.
PhylomeDBiQ8R2Y2.
TreeFamiTF330534.

Miscellaneous databases

ChiTaRSiMcam. mouse.
PROiQ8R2Y2.
SOURCEiSearch...

Gene expression databases

BgeeiQ8R2Y2.
CleanExiMM_MCAM.
ExpressionAtlasiQ8R2Y2. baseline and differential.
GenevisibleiQ8R2Y2. MM.

Family and domain databases

Gene3Di2.60.40.10. 5 hits.
InterProiIPR013162. CD80_C2-set.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF08205. C2-set_2. 1 hit.
PF07679. I-set. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 4 hits.
SM00408. IGc2. 4 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 5 hits.
PROSITEiPS50835. IG_LIKE. 4 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Taira E., Okumura S., Miki N.
    Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Strain: BALB/cJ.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: FVB/N-3.
    Tissue: Mammary tumor.
  3. "HEMCAM/CD146 down regulates cell surface expression of beta-1 integrins."
    Alais S., Allioli N., Pujades C., Duband J.-L., Vainio O., Imhof B.A., Dunon D.
    J. Cell Sci. 114:1847-1859(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 561-648 (ISOFORMS 1 AND 2).
  4. "Isolation and characterization of mouse MUC18 cDNA gene, and correlation of MUC18 expression in mouse melanoma cell lines with metastatic ability."
    Yang H., Wang S.-W., Liu Z., Wu M.-W.H., McAlpine B., Ansel J., Armstrong C., Wu G.-J.
    Gene 265:133-145(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, ROLE IN MELANOMA.
  5. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
    Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
    Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-58 AND ASN-510.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-608, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Heart, Kidney, Liver, Lung, Pancreas, Spleen and Testis.

Entry informationi

Entry nameiMUC18_MOUSE
AccessioniPrimary (citable) accession number: Q8R2Y2
Secondary accession number(s): Q9EPF1
, Q9ESS7, Q9JHQ2, Q9JHQ3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: June 1, 2002
Last modified: July 6, 2016
This is version 118 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.