Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2

Gene

Degs2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Bifunctional enzyme which acts as both a sphingolipid delta(4)-desaturase and a sphingolipid C4-monooxygenase.3 Publications

Catalytic activityi

A dihydroceramide + 2 ferrocytochrome b5 + O2 + 2 H+ = a (4R)-4-hydroxysphinganine ceramide + 2 ferricytochrome b5 + H2O.2 Publications
A dihydroceramide + 2 ferrocytochrome b5 + O2 + 2 H+ = a (4E)-sphing-4-enine ceramide + 2 ferricytochrome b5 + 2 H2O.2 Publications

pH dependencei

Optimum pH is 7.0-8.0.1 Publication

Pathwayi: sphingolipid biosynthesis

This protein is involved in the pathway sphingolipid biosynthesis, which is part of Membrane lipid metabolism.1 Publication
View all proteins of this organism that are known to be involved in the pathway sphingolipid biosynthesis and in Membrane lipid metabolism.

GO - Molecular functioni

  • sphingolipid delta-4 desaturase activity Source: MGI
  • sphingosine hydroxylase activity Source: MGI

GO - Biological processi

  • ceramide biosynthetic process Source: MGI
  • sphinganine metabolic process Source: MGI
  • sphingolipid biosynthetic process Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Biological processi

Lipid biosynthesis, Lipid metabolism

Enzyme and pathway databases

ReactomeiR-MMU-1660661. Sphingolipid de novo biosynthesis.
UniPathwayiUPA00786.

Chemistry

SwissLipidsiSLP:000000168.

Names & Taxonomyi

Protein namesi
Recommended name:
Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2 (EC:1.14.18.52 Publications, EC:1.14.19.172 Publications)
Alternative name(s):
Degenerative spermatocyte homolog 2
Sphingolipid 4-desaturase
Sphingolipid C4-monooxygenase
Gene namesi
Name:Degs2Imported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 12

Organism-specific databases

MGIiMGI:1917309. Degs2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei41 – 6121HelicalSequence analysisAdd
BLAST
Transmembranei68 – 8821HelicalSequence analysisAdd
BLAST
Transmembranei210 – 23122HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemovedBy similarity
Chaini2 – 323322Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2By similarityPRO_0000312817Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Lipidationi2 – 21N-myristoyl glycineBy similarity

Keywords - PTMi

Lipoprotein, Myristate

Proteomic databases

PaxDbiQ8R2F2.
PRIDEiQ8R2F2.

PTM databases

PhosphoSiteiQ8R2F2.

Expressioni

Tissue specificityi

Highly expressed in intestinal crypt cells and adjacent epithelial cells (at protein level).1 Publication

Gene expression databases

BgeeiENSMUSG00000021263.
GenevisibleiQ8R2F2. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000021691.

Structurei

3D structure databases

ProteinModelPortaliQ8R2F2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni95 – 995Required for C4-hydroxylase activity1 Publication

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi89 – 935Histidine box-1Curated
Motifi128 – 1325Histidine box-2Curated
Motifi259 – 2635Histidine box-3Curated

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2987. Eukaryota.
ENOG410XQVT. LUCA.
GeneTreeiENSGT00390000013448.
HOGENOMiHOG000188299.
HOVERGENiHBG052775.
InParanoidiQ8R2F2.
KOiK04712.
OMAiWFFCTPA.
OrthoDBiEOG091G09NW.
PhylomeDBiQ8R2F2.
TreeFamiTF313582.

Family and domain databases

InterProiIPR011388. DES1/DES2.
IPR031195. Des2.
IPR005804. Fatty_acid_desaturase_dom.
IPR013866. Sphingolipid_d4-desaturase_N.
[Graphical view]
PANTHERiPTHR12879:SF1. PTHR12879:SF1. 1 hit.
PfamiPF00487. FA_desaturase. 1 hit.
PF08557. Lipid_DES. 1 hit.
[Graphical view]
PIRSFiPIRSF017228. Sphnglp_dlt4_des. 1 hit.
SMARTiSM01269. Lipid_DES. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q8R2F2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNSAARSDF EWVYSDQPHT QRRKEMLAKY PAIKALMRPD PHIKWTVSGM
60 70 80 90 100
VLVQVLACWL VRGLSWRWLL FWAYAFGGCI NHSLTLAIHD ISHNTAFGTS
110 120 130 140 150
CVSRNRWFAI FANLPIGLPY ATSFKKYHVD HHRYLGGDGL DVDIPTNFEG
160 170 180 190 200
WFFCTPARKL LWLVLQPFFY SLRPLCVNPK VVTRMEILNA LVQLAFDVTI
210 220 230 240 250
FALWGIKPIV YLLGSSLLGL GLHPISGHFV AEHYMFLKGH ETYSYYGPLN
260 270 280 290 300
WITFNVGYHM EHHDFPSIPG YYLPLVRKIA PEYYDHLPQH HSWVKVLWDF
310 320
VFEDSMGPYS RVKRKCKLAK DHL
Length:323
Mass (Da):37,491
Last modified:June 1, 2002 - v1
Checksum:iE5B63884E45B5E16
GO
Isoform 21 Publication (identifier: Q8R2F2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     276-323: VRKIAPEYYDHLPQHHSWVKVLWDFVFEDSMGPYSRVKRKCKLAKDHL → DDWNPVRRDVL

Note: No experimental confirmation available.Curated
Show »
Length:286
Mass (Da):33,020
Checksum:i7FB65936C8D51E22
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti88 – 881I → T in BAE37145 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei276 – 32348VRKIA…AKDHL → DDWNPVRRDVL in isoform 2. 1 PublicationVSP_052629Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF466377 mRNA. Translation: AAM12533.1.
AK162979 mRNA. Translation: BAE37145.1.
BC016427 mRNA. Translation: AAH16427.2.
CCDSiCCDS26162.1. [Q8R2F2-1]
CCDS49170.1. [Q8R2F2-2]
RefSeqiNP_001164473.1. NM_001171002.1. [Q8R2F2-2]
NP_081575.2. NM_027299.5. [Q8R2F2-1]
UniGeneiMm.207605.

Genome annotation databases

EnsembliENSMUST00000021691; ENSMUSP00000021691; ENSMUSG00000021263. [Q8R2F2-1]
ENSMUST00000167978; ENSMUSP00000125891; ENSMUSG00000021263. [Q8R2F2-2]
GeneIDi70059.
KEGGimmu:70059.
UCSCiuc007pab.2. mouse. [Q8R2F2-1]
uc011yrv.1. mouse. [Q8R2F2-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF466377 mRNA. Translation: AAM12533.1.
AK162979 mRNA. Translation: BAE37145.1.
BC016427 mRNA. Translation: AAH16427.2.
CCDSiCCDS26162.1. [Q8R2F2-1]
CCDS49170.1. [Q8R2F2-2]
RefSeqiNP_001164473.1. NM_001171002.1. [Q8R2F2-2]
NP_081575.2. NM_027299.5. [Q8R2F2-1]
UniGeneiMm.207605.

3D structure databases

ProteinModelPortaliQ8R2F2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000021691.

Chemistry

SwissLipidsiSLP:000000168.

PTM databases

PhosphoSiteiQ8R2F2.

Proteomic databases

PaxDbiQ8R2F2.
PRIDEiQ8R2F2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000021691; ENSMUSP00000021691; ENSMUSG00000021263. [Q8R2F2-1]
ENSMUST00000167978; ENSMUSP00000125891; ENSMUSG00000021263. [Q8R2F2-2]
GeneIDi70059.
KEGGimmu:70059.
UCSCiuc007pab.2. mouse. [Q8R2F2-1]
uc011yrv.1. mouse. [Q8R2F2-2]

Organism-specific databases

CTDi123099.
MGIiMGI:1917309. Degs2.

Phylogenomic databases

eggNOGiKOG2987. Eukaryota.
ENOG410XQVT. LUCA.
GeneTreeiENSGT00390000013448.
HOGENOMiHOG000188299.
HOVERGENiHBG052775.
InParanoidiQ8R2F2.
KOiK04712.
OMAiWFFCTPA.
OrthoDBiEOG091G09NW.
PhylomeDBiQ8R2F2.
TreeFamiTF313582.

Enzyme and pathway databases

UniPathwayiUPA00786.
ReactomeiR-MMU-1660661. Sphingolipid de novo biosynthesis.

Miscellaneous databases

PROiQ8R2F2.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000021263.
GenevisibleiQ8R2F2. MM.

Family and domain databases

InterProiIPR011388. DES1/DES2.
IPR031195. Des2.
IPR005804. Fatty_acid_desaturase_dom.
IPR013866. Sphingolipid_d4-desaturase_N.
[Graphical view]
PANTHERiPTHR12879:SF1. PTHR12879:SF1. 1 hit.
PfamiPF00487. FA_desaturase. 1 hit.
PF08557. Lipid_DES. 1 hit.
[Graphical view]
PIRSFiPIRSF017228. Sphnglp_dlt4_des. 1 hit.
SMARTiSM01269. Lipid_DES. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDEGS2_MOUSE
AccessioniPrimary (citable) accession number: Q8R2F2
Secondary accession number(s): Q3TR85, Q78JJ1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: June 1, 2002
Last modified: September 7, 2016
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.